Inside - Rappahannock Record

Transcription

Thursday, June 12, 2008
•
Kilmarnock, Virginia
•
Ninety-first Year
•
Number 36
•
Three Sections
•
50¢
Lancaster board puts
$26.6 million budget
up for citizen perusal
Breaking ground for maternity center
Despite Sunday’s record-breaking heat, more than 100 supporters celebrated the
ground-breaking ceremony for the Family Maternity Center of the Northern Neck at
Devils Bottom and Mary Ball roads in Lancaster. Several manned shovels. Rep. Rob
Wittman called the ground-breaking the first step of “a vision of the community to
advance the cause of health care in the Northern Neck.” Del. Albert Pollard called
for a strong health care system to build a strong community and noted that every $1
of pre-natal care at the center will save $3 in post-natal care. The outpatient facility
will be geared toward low-risk patients with mid-wives delivering the babies, according to Dr. James Hamilton. He also praised project coordinator Shirley McAdoo and
many other health care professionals for their efforts. (Photo by Audrey Thomasson) Kilmarnock budget
work session targets
several items to cut
by Alex Haseltine
KILMARNOCK—Some 45
concerned citizens convened
at the Kilmarnock Town Hall
Wednesday for a budget workshop hosted by the town council.
What was advertised to be an
informal meeting with citizens,
council and staff lasted less than
an hour. Citizens were limited
to three minutes each to voice
concerns regarding the upcoming budget, and town officials
provided no feedback.
Mayor Curtis Smith, who
took his seat 20 minutes into
the proceedings, remained silent
except to explain why so few
town officials were present. By
law, if more than two members
were present, they would have to
advertise the meeting, he said.
Town council has proposed a
$5,369,810 budget while keeping the real estate tax rate at 14
cents per $100 of assessed value,
resulting in an effective tax rate
increase of some 51.8 percent.
Councilwoman-elect Rebecca
Nunn outlined what she considered unnecessary expenditures in the proposed 2008-09
budget.
She cited a $4,500 increase
in legal fees to town attorney
Chris Stamm, an “unconscionable” across-the-board
4 percent pay raise for town
employees, some of whom
have been employed less than
one year, and an unjustified
increased office staff at the
town hall.
“In 2000, the population
was 1,244 and there were two
women in the office with a town
manager. Now, eight years later,
with a population growth of only
250, we have eight people in the
office,” said Nunn. “Is it necessary to add a new staff person
for each growth in population of
50 people?”
Nunn compared the town to a
corporation, in which the mayor
is the chief executive officer and
the council members are the
board of directors.
“We, the taxpayers of Kilmarnock, are the stockholders and
we, those paying the bills, want
(continued on page A15)
by Audrey Thomasson
LANCASTER—The board
of supervisors will conduct a
public hearing on the fiscal
2008-09 budget for Lancaster County Monday, June
16, at 7 p.m. in the General
District courtroom in Lancaster.
Supervisors also will hold
a separate public hearing on
a proposed real estate tax
rate increase at their regular
monthly meeting June 26 at
7 p.m.
The proposed budget for
the fiscal year beginning
July 1 and ending June 30,
2009, totals $26,650,727. It
is $813,972 higher than the
current budget.
As advertised, projected
revenue of $26,746,133
include $16,694,236 in general property taxes and other
local funds, $5,521,418 from
school operating and cafeteria sources, and $4,529,479
from state and federal governments. There also is a
$557,436 fund balance from
the current budget.
IDA approves
judicial center
financing plan
Commencement ‘08
LANCASTER—County
administrator Bill Pennell said
the Lancaster County Industrial Development Authority on
Tuesday approved the board of
supervisors’ request for a bond
issue to finance construction of
a new judicial center.
As reported last week, supervisors agreed to borrow $7
million at an interest rate of 4
percent for a total of $8,637,44
in debt over the life of the
10-year loan.
Financing would be done
through a combined loan from
Chesapeake Bank and Bank of
Lancaster and a “moral obligation bond” which will be borrowed through the IDA. The
IDA would lease the building
to the county until the loan is
paid, at which time the county
would own the building.
Pennell also clarified the
impact on real estate property
taxes phased in over three years.
He said the financing cost for
2009 equals approximately a
quarter of one cent ($0.0024)
per $100 of the county’s real
estate values. The board plans
to absorb the quarter cent necessary next year in the current
advertised tax rates.
Over a period of three years,
the final, total financing will
cost $0.0136 per $100 of real
estate values, said Pennell.
Northumberland adopts
$49.2 million fiscal plan
by Reid Pierce Armstrong
H E AT H S V I L L E — T h e
Northumberland board of
supervisors adopted a $49.2
million budget last week and
approved a 4-cent real estate
tax rate increase.
Prior to adoption, the board
cut nearly $576,000 from
budget requests submitted by
departmental heads.
Big items pulled from the
budget included $50,000
for the next reassessment,
$18,704 in part-time wages
for the Clerk of Circuit
Court’s office, $16,000 for a
new vehicle for the building
inspector’s office, $6,000 in
part-time wages for the treasurer’s office, $14,750 for
animal control and $10,000
to the local health department.
Smaller cuts were taken
across the board from travel
budgets, dues, part-time
wages and equipment and
supply requests.
Proposed
five-percent
cuts to the Community Ser(continued on page A16)
Inside
n River rescue:
Flotilla 33 assists boat and
crew taking on water on
the Rappahannock River off
Carter’s Creek................A15
n Help wanted:
Northumberland County
Red Cross Chapter seeks
volunteer to serve as
executive director.........A16
n Steptoe’s show:
The Nighthawks cap the
June 6 First Friday
Walkabout in downtown
Kilmarnock...................A16
See Steptoe’s First
Friday Walkabout video
at rrecord.com
6
56525 10491
6
Sky high: A10
Business...........B6-7
Calendar............A2-3
Churches..........B2-5
Classified........C2-10
Directory...............C9
Notices..............C5-8
Obituaries..........B3-4
Opinion..............A4-5
Police....................B1
Schools...........B8-11
Sports...........A10-14
Upcoming.....A2-3,6-9
The anticipated fund balance at the end of the 2009
fiscal year is $651,842.
Decreases/increases
In year-to-year comparisons, spending will be down
in three categories:
• General government,
down from $1,382,744 to
$1,174,629, a savings of
$208,116;
• Recreation, down from
$161,750
to
$160,345,
saving $1,405; and
• School cafeteria, down
Dr. Mendez to speak
at LHS commencement
LANCASTER—Commencement exercises for Lancaster High
School will begin at 10 a.m. Saturday, June 14, in the school’s
gymnasium.
There are 110 candidates for graduation in the Class of 2008.
Enrique Mendez Jr., M.D., the grandfather of LHS science
teacher Maria Cabrero, will be the keynote speaker.
Dr. Mendez was born in Puerto Rico in 1931 and graduated
from the Stitch School of Medicine of Loyola University and
completed his internship at Mercy Hospital in Chicago.
After serving in the U.S. Army Medical Corps for 28 years, he
returned to his native Puerto Rico to become the dean and then
president of the Ponce School of Medicine. He also served as the
medical director of the Damas Hospital in Ponce before becoming Secretary of Health for the Commonwealth of Puerto Rico.
Former President George Bush nominated Dr. Mendez to be
Assistant Secretary of Defense for Health Affairs in 1989. He
served in that position from March 1990 until January 1993.
He is now a partner in Martin, Blanck and Associates, a consulting firm to the health care industry.
Timberlake to address
Northumberland grads
HEATHSVILLE—Northumberland High School will hold
commencement exercises for the Class of 2008 at 9 a.m.Saturday,
June 14, on the school athletic fields in Heathsville.
Brent M. Timberlake will address the class. Timberlake, a 1997
graduate of NHS, is a senior associate at the Richmond-based
law firm Setliff & Holland PC where he practices civil litigation,
representing large corporations such as Amtrak, CSX Transportation Inc., Circuit City, Norfolk Southern Company and Dominion Resources.
Selected by his peers as one of Virginia Business Magazine’s
“Legal Elite” in 2007, Timberlake has been recognized for his pro
bono efforts and his service to the Virginia Bar. He was named a
“Rising Star” by SuperLawyers magazine this year.
He also is an adjunct assistant professor of law at the University of Richmond’s school of law where he teaches writing and
oral advocacy to first-year law students.
During his time at NHS, Timberlake was a Beta Club member
and class officer for four years. He graduated magna cum laude
from Virginia Tech in 2001 and served as chief justice of the university’s undergraduate honor system. He graduated summa cum
laude from the T.C. Williams School of Law.
He and his wife, Carole, have a son, Samuel Archer, and
another due in October.
Five top RHS graduates
will address classmates
Concrete deterioration at the rain water grate exposes a
sharp metal edge which could puncture tires making contact with the curb.
Some Kilmarnock curbs
hazardous for auto tires
by Audrey Thomasson
KILMARNOCK—“It
sounded like a gunshot,” said
Chris Winstanley, who works
at Kelsick Gardens Too.
The loud bang she was referring to turned out to be a tire
popping as the driver tried to
parallel park in front of Twice
Told Tales bookstore on South
Main Street. The driver had
miscalculated the distance to
the curb and caught his rear
tire on the sharp edge of a steel
plated rain gutter which sliced
through the side of the tire.
The incident occurred just
weeks after the grand opening
celebration of the newly renovated streets and sidewalks of
the Steptoe’s District.
According to Winstanley, the
irate driver complained to town
hall and demanded they replace
his tire. Not only did he not
get a new tire from the town,
his complaints went largely
unheeded and the popping tires
have continued ever since.
“About eight people have
punctured their tires on that
curb,” she said.
Winstanley advised other
“gutter” victims to call the
town hall. She felt encouraged
when the former town manager
came by to inspect it with the
project manager. After that, the
contractor took a look at it. She
said about three months ago
the new town manager came
by and poked around. But
the response was always the
same—the construction met
Virginia Department of Transportation standards.
When Rappahannock Record
reporter Lisa Hinton-Valdrighi
popped a brand new tire on
WARSAW—Commencement exercises for Rappahannock
High School will be held Saturday, June 14, at 9 a.m. at the
school.
The ceremony will include music by the school band under
the direction of William D. Fields and by members of the chorus
under the direction of Marcellus C. Dungee.
Alyson Packett Pugh, senior class president, will give the welcoming address.
The five graduates with the highest academic average for their
four years at Rappahannock will speak during the ceremony.
They are Lowery Constance Pemberton, the daughter of Robert
and Brenda Pemberton of Sharps; Jackson Hart Morris, the son
of Jackie and Bonnie Morris of Warsaw; Kevin Lian Nguyen, the
son of Nghia Nguygen and Jin Huang of Warsaw; Lupita Oceguera, the daughter of Enrique and Maria Oceguera of Warsaw;
and Renee Antionette Brown, the daughter of Sonya Brown of
Warsaw. All are honor graduates and will receive the Advanced
Studies diploma with the Governor’s Seal.
Rep. Wittman speaks
at Washington and Lee
MONTROSS—Washington and Lee High School’s graduation
exercises were held June 7. The keynote speaker was First District U. S. Congressman Robert Wittman.
The W&L High School Class of 2008 valedictorian is Lindsay
Hundley, the daughter of Pamela and John Hundley of Montross.
The salutatorian is Christina Cheng, the daughter of Charles and
Kiem Cheng of Montross.
Photographs of the candidates for graduation appear
in the school pages.
Upcoming
A2
Rappahannock Record • Kilmarnock, VA • June 12, 2008
June
12
Thursday
Al-ANON meets at 8 p.m. at
Palmer Hall in Kilmarnock.
The RFM Boat Shop opens
at 9 a.m. at the Reedville
Fishermen’s Museum.
453-6629.
The RFM Modelers meet
at 10 a.m. at Reedville
453-6529.
The RFM Photo Group
meets at 2 p.m. at the
Reedville Fishermen’s
Museum. 435-6529.
No-Name Needlers will
gather at 1 p.m. at The
Art of Coffee in Montross.
493-0873.
The Wetlands Board for
Lancaster County will meet at
9:30 a.m. at the courthouse in
Lancaster.
The Irvington Town Council
will meet at 7:30 p.m. at the
town office.
The Upper Lancaster
Ruritan Club will meet at
6:30 p.m. at the Ruritan
Center in Lively.
A Cancer Support Group
will meet at Rappahannock
General Hospital at 3 p.m.
435-8593.
The Board of Supervisors
for Northumberland County
will meet at 5 p.m.
The Heathsville Forge
Blacksmith Guild meets from
10 a.m. to 3 p.m. at Rice’s
Hotel/Hughlett’s Tavern.
580-3377.
Acoustic Night at Cruisers
Sports Bar in Gloucester.
693-6246.
The Potomac River Festival
Carnival will be held on Town
Hill in Colonial Beach. Jackie
Guyer, 224-0021. The carnival
will continue through June 15.
Auditions will be held at
7 p.m. at The Playhouse
in White Stone for a series
of three one-act plays
directed by John Baumhardt.
No previous experience
necessary. The play will be
staged July 16 through 19.
Casts call for four females
and a teenage male. Call
Baumhardt at 436-9027.
The Interfaith Service
Council will meet at Good
Shepherd Lutheran Church in
Callao. Covered-dish dinner
at 6 p.m., meeting at 7 p.m.
The Rappahannock
Amateur Radio Association
will meet at 7:30 p.m. at 7990
Northumberland Highway
near Heathsville.Family
Movie Night will be held at
the Northumberland Public
Library in Heathsville at 6
p.m.
The Westmoreland Players
will present “The Importance
of Being Earnest” at 8 p.m. at
The Players Theatre at 16217
Richmond Road near Callao.
$15 adults/$10 students.
Reservations necessary.
529-9345.
The Annual Meeting of the
Northumberland County Red
Cross will be held at 7 p.m. at
the Transportation Museum at
Rice’s Hotel/Hughlett’s Tavern
in Heathsville.
The MP Brain Injury Support
Group will meet at 10:30 a.m.
725-2829.
The Lancaster/Northern
Neck Interfaith Service
Council will meet at St.
Andrews Presbyterian Church
in Kilmarnock at 7:30 p.m.
donk’s
(
Third Talent Search
of 2008
(
Sat. June 21th - 8 pm
14
Saturday
The Reedville Bluefish
Tournament to benefit
Smith Point Sea Rescue
will be held from Buzzards
Point Marina, Smith Point
Marina and Norview Marina.
Eligible species which will
qualify for over $32,000 in
cash and prizes are bluefish,
striped bass and croaker.
For applications, visit
smithpointsearescue.com, or
call 453-5325.
Casper will entertain the
Reedville Bluefish Derby crowd
at Buzzards Point Marina at 8
p.m. The public is invited to
the dance.
Crossroads plays Cruisers
Sports Bar in Gloucester.
693-6246.
Judge Smith will entertain
the Potomac River Festival
crowd in Colonial Beach. The
concert will begin at 7 p.m. on
the Town Stage.Sweet Justice
rocks the deck at Savannah
Joe’s in Kilmarnock from 6 to
Keith at the park
10 p.m. $5. 435-6000.
Steve Keith of Weems will be featured on the Music By The The Westmoreland Players
River stage at Belle Isle State Park Saturday, June 14, at 6 will present “The Importance
p.m. Keith plans to share his new song, “Chesapeake Pearl,” of Being Earnest” at 8 p.m. at
and many other favorites. Folks are urged to bring picnics, The Players Theatre at 16217
lawn chairs and blankets. Children’s craft activities will be Richmond Road near Callao.
available. The concert is free, however, the park’s $3 per $15 adults/$10 students.
vehicle parking fee applies.
529-9345.
The Urbanna Farmers’
Market will be from 9 a.m.
to 1 p.m. in the parking lot of
Friday
Saturday
the Southside Sentinel and on
Bingo will be played at the
the lawn of the Marble House.
Upper Lancaster Ruritan
758-2000.
Center in Lively at 5:45 p.m.
A Full Moon Canoe Trip will
Itchy Dog rocks the deck
be held at Belle Isle State
at Savannah Joe’s in
580-3377.
Park from 8 to 10 p.m. Paddle
Kilmarnock from 6 to 10 p.m.
The Lancaster High School
$5. 435-6000.Downside
Class of 2008 Graduation will under a full moon as it reflects
on Mulberry Creek and the
will be featured at Damon
be held at 10 a.m. at LHS.
Rappahannock River. Hear
and Company in Gloucester.
The Northumberland High
how the moon affects the
693-7218.
School Class of 2008
tides, nature, and people,
The Reedville Bluefish
Graduation will be held at 9
and how our senses change
Tournament to benefit
a.m. at NHS.
at night. Canoe, paddle, life
Smith Point Sea Rescue
The Rappahannock High
jacket and experienced guide
will be held from Buzzards
School Class of 2008
included. $6. Reservations
Point Marina, Smith Point
Graduation will be held at 9
required. 462-5030.
Marina and Norview Marina.
a.m. at RHS.
A Yard Sale will be held
Competition continues June
Steve Keith will be featured
from 8 a.m. to 1 p.m. by the
14. For applications, visit
on the Music By The River
Northumberland County
smithpointsearescue.com, or
stage at Belle Isle State Park
Animal Shelter at the
call 453-5325.
in Lancaster County. Jazz,
The Ray Pittman Project will
blues, country, bluegrass, rock, Northumberland County
School Board building in
entertain the Reedville Bluefish originals and more. Picnics
Lottsburg.
Derby Crowd at Buzzards
encouraged. $3 parking fee.
A Yard Sale will be held by
Point Marina at 8 p.m. The
462-5030.
public is invited to the dance.
Solid Rock Gospel Band, Mill- the Marine Corps League
Second Friday Art Walk
Town Grass Band, Code Blue Detachment 1062 from 8 a.m. to
1 p.m. at Banes Northern Neck
in Colonial Beach. Sherri
Band, and Thunder Creek
Sundberg, 224-8411.
Gospel Band will perform from Upholstery Shop in Callao.
A Bake Sale will be held by
10 a.m. to 5:30 p.m. at the
the Church of New Vision
5th annual Bluegrass Family
at Wal-Mart in Kilmarnock,
Day and Fly-In to benefit the
beginning at 8 a.m.
American Cancer Society and
the Peninsula Cancer Institute at A Car Wash will be held by
the Church of New Vision at
the Middle Peninsula Regional
Airport in Mattaponi. Donations Advance Auto in Kilmarnock,
beginning at 8:30 a.m.
529-9345.
appreciated. Bring lawn chairs.
The 57th annual Potomac
785-9725 or 785-6512.
River Festival opens in
Buddy & Tripp Waymack
Colonial Beach with a parade
with Richard Callis and
at 7:30 p.m. Activities continue Kevin Machen will perform
Sunday
June 14 and 15 with a carnival, classic rock and country at 8
karaoke contest, children’s
p.m. at the Southwind Cafe
Father’s Day
events, arts, crafts, raffles,
in Mathews. Free, Families
The Widowed Persons
music, fireworks, classic cars, welcome. 725-2766.
Service for Lancaster and
car parades, boat parades,
Bad Dog Band will perform
Northumberland counties
and pet parades.
from 6 to 10 p.m. at the River
holds its lunch brunch at
A Welcome Campfire will
Ball at the Milford Home on
Great Fortune Restaurant
be held at Belle Isle State
Stutts Creek. A Mathews
in Kilmarnock immediately
Park from 8 to 9 p.m.
Main Street fund-raiser. $60.
following church services.
Learn about the park and
725-9682 or 725-5747.
its programs, enjoy stories
around the campfire and roast
marshmallows. Free.
13
14
15
À>ÃÃÊ*Ã}ÊÊÊ
*Ã}ÊÀ>ÃÃÊEÊÀ>ÃÃÊi`Ã
À>ÃÃ]Ê
««iÀ]Ê-ÛiÀÊEÊ*iÜÌiÀ
Ài«>ViÊVViÃÃÀiÃ
ÀÊ>ìÃÉViÀÃ
"ÌiÀÊiÊÌiÃ
>«ÃÊEÊ>«Ê,i«>À
ÀiiÊ*VÕ«ÉiÛiÀÞ
ÎäÊÞi>ÀÃÊiÝ«iÀiVi
&ORMOREINFORMATIONPLEAECALL
-ICHAEL"#ALLIS
!
-ARY"ALL2D
!
,ANCASTER6!
-iÀÛ}Ê6À}>ÊÊÊ
7>ÞiÊ>ÀÀÃÊÊUÊÇxÇÊÓÓäÎ{ÈÈ
i\ÊÇxÇn£ä£ÈÇÇ
An Ecological Bible School
Sunday, June 22 - Friday, June 27
6-8 pm
Trinity Episcopal Church
BAR POINT SEAFOOD: Casual
dining with a friendly atmosphere.
Featuring Nightly Specials, No Filler
Crab Cakes, Burgers and Seafood.
Dine In or Carry out available. New
Hours starting May 7th. Wed.-Fri.
(Lunch) 11am-2pm & 4pm-9pm
(Dinner). Sat. & Sun. 1pm-9pm.
8657 Mary Ball Road, Lancaster
462-7272.
BU ENOS NAC HOS M EXICAN
GRILL: Delicious Mexican fare in an
exciting atmosphere. Outdoor seating available. Mon.-Thurs. 11:00am8:30pm. Fri. & Sat. 11:00am-9pm.
Sunday 11am-3pm. 45 S Main St.
Kilmarnock. 435-6262.
DIXIE DELI: Family owned and
operated (forever!) Serving lunch 5
days a week, Mon-Fri., 10:30-3:00,
Subs, soup, our famous potato &
chicken salad and sandwiches,
50 Irvington Rd., Kilmarnock
435-6745.
LEE’S RESTAURANT: Hometown
cooking and atmosphere in a
popular downtown Kilmarnock
tradition. Full menu, fresh local
seafood in season, homemade pies
made daily, Beer & Wine on premises. (B,L,D) Main St. Kilmarnock,
435-1255
THE MOUNT HOLLY STEAMBOAT
INN: Overlooking beautiful Nomini Creek in historic Westmoreland County. Winter Hours
Dinner Wednesday to Saturday.
5:00-9:00 Grand Sunday Brunch
Buffet 11:00-2:00. 804-472-9070.
3673 Cople Highway (Rt. 202 at
Nomini Bay)
www.mthollysteamboatinn.com
NETCRUISERS CAFE: Lancaster’s
Place to Relax! Featuring Fine
Gourmet ESPRESSO Coffees,
Flowering & Herbal teas and
tasty Foods. Chicken Salad and
Deli Sandwiches and REAL Fruit
Smoothies. New Activity Room
with Local Artwork. FREE Internet
for customers. Outdoor Seating
available. LIVE Entertainment one
Saturday evening per month, NOW
Open 7 Days a week. (Breakfast &
Lunch) 8872 Mary Ball Rd Across
from LHS. 804-462-7711
www.netcruiserscafe.com
SAL’S PIZZA:Pizza, Subs, Burgers, Dinners, Beer & Wine. Large
parties welcome. Dine in; carry
out. 456 N. Main St., Kilmarnock.
435-6770, 435-1384.
HORN HARBOR HOUSE SEAFOOD RESTAURANT: 836 Horn
Harbor Rd., Burgess, VA 22432,
804-453-3351; Come by Land or by
Sea: Hours: Dinner: Wed., Thurs.,
Sun., 5-9 pm; Fri., Sat. 5-10 pm;
Nightly Specials, Fresh Seafood
and Hand cut steaks, full menu
available in lounge and deck Wed.
- Sun. (Weather Permitting)
435-1701 join the
Record’s Dining Guide
g ^Û N a d d a Y e k Z m j _
Caring for God’s Creations
Your guide to the most delicious food & tastiest treats
in the Northern Neck and Middle Peninsula.
Hands on presentations by watermen, foresters, a
beekeeper, wildlife rehabilitator and more.
All children are welcome.
For information & registration, call Janie Smith at 462-5908
Sponsored by: Trinity Episcopal Church, St. Mary’s
Whitechaple Church, Corrotoman Baptist Church & Bethel
United Methodist Church.
TH E STEAM BOAT RESTAURANT: Enjoy casual dining while
overlooking the beautiful Piankatank River Golf Club. We offer a
traditional lunch menu, gourmet
and traditional evening menus and
Sunday Brunch selections. Open
Tues.-Sat., 11:00 am - 2:30 pm,
Thurs., Fri. & Sat. evenings 5:30
pm - 9:00 pm, and Sunday Brunch
10:30 am - 2:00 pm. Banquets,
functions and group outings also
available. Call 776-6589 (Reservations suggested). Located off Rt. 33
at 629, Hartfield, Va.
SWANK’S ON MAIN: Continental
dining experience located downtown at 36 N. Main Street. Enjoy
dishes with a southern flair in a
warm and inviting atmosphere
with full bar and an extensive wine
list. Open for lunch every day and
brunch Sunday 11-2pm. Dinner
Monday-Saturday 5pm-closing,
full bar, outside seating weather
permitting. 804-436-1010.
TALK OF THE TOWN COFFEE
HOUSE: Featuring a wide selection
of gourmet coffees. Freshly prepared pastries, wraps and salads.
Delicious ice cream. 41 S. Main
St., Kilmarnock 436-TALK (8255).
Open 7 days a week.
TH E TAVERN RESTAU R ANT:
Exceptional comfort food in
lovingly restored Rice’s Hotel/
Hughlett’s Tavern, Heathsville.
Homemade breads, soups, desserts, & more. Local seafood &
produce featured. Lunch & Dinner, Wed-Sat. 580-7900.
BISTRO: Casual upscale
TOWN BISTRO
dining in an intimate setting. Featuring a Seasonal Menu of locally
inspired dishes. Open Kitchen. Full
Bar. Dinner Only. Chef owned
and operated. 62 Irvington Road,
U P P E R D EC K C R A B & R I B
HOUSE: Featuring fresh local
seafood in an inviting riverfront
atmosphere. Thurs. 4-8pm, Friday
5-10pm, Sat. 12pm-10pm, Sun.
11am-5pm. 1947 Rocky Neck
Road, Mollusk,VA. Near Lively.
462-7400.
WILLABY’S: Comfortable casual
atmosphere. Featuring daily chef’s
specials, gourmet burgers & delectable desserts. Eat in or carry out
available. Monday-Saturday 11-3.
Items available for take home until
4:00. White Stone. (L) 435-0044.
ÀÊ>ÊÌÞÊVÕÌÞÊV>i`>ÀÊÛÃÌ\
ÜÜÜ°ViVÌiÌÜÀ°À}ÉÀ>««>>V
HILLSIDE CINEMA
(804) 693-2770
(804) 693-7766
*#,!94/.()'(7!9',/5#%34%26!s3#(%$5,%&/2n
Monday - Ladies Special
$6.00
KUNF-FU PANDA (PG) 1 Hr. 32 Min. ZOHAN (PG-13) 1 Hr. 53 Min.
American Legion
Fri. (4:15), 6:30, 8:30
Sat. (2:00, 4:15), 6:30, 8:30
Father's Day Special
Sun. (2:00, 4:15), 6:30
Mon. - Thurs. (5:15), 7:15
Fri. (4:30), 6:45, 9:00
Sat. (2:15, 4:30); 6:45, 9:00
Father's Day Special
Sun. (2:15, 4:30), 6:45
Mon. - Wed. (5:05), 7:30
Students, Senior Citizen & Active Militar y $4.00 for all shows
Children under 2yrs. (any show) FREE/Children 2 to16yrs. (any show) $4.00
**Shows in parentheses ( ) all seats $4.00 /Adults all shows on & after 6pm $5.50 **
Visit us at www.hillsidecinema.com for show times.
To print money-saving coupon click on certificate then free stuff icon.
Lancaster Courthouse
A vacation bible school
focusing on the stewardship of God’s creations
in the Northern Neck.
ST ANDREWS GRILL AT THE
TARTAN GOLF CLUB
Open daily 11-3; Closed Tuesday.
Daily Specials. Homemade Soups,
Salads, Seafood and Sandwiches.
Call 438-6009
Admission, Medium Drink and Medium Popcorn are all for
+()(,"(")"( "%".#+"% *!"*/&"(.*!*&-%&"%%%*!()*
& ** &+* %*!$ #+ (&)) % #+ !"# ") *! *( %$ &%*!$ #*!
#%)&"( "%"%%"%'%%*#"%)&*!#+(&))%#+!"#))&"*"&%
SANDPIPER RESTAURANT: Est.
1982. Casual relaxed dining with
friendly service. Featuring nightly
specials, charbroiled steaks and
fresh seafood dishes. Full menu. (D)
Route 3, White Stone. 435-6176.
ESSEX 5 CINEMAS
SAT., Aug 27
EVERY THURSDAY NIGHT
Guaranteed $500.
The 2nd & 4th Thursday of every month
Come out and support your veterans!
$OORSOPENATPMs0LAYSTARTSPM
7AVERLY!VE+ILMARNOCK
MILEPASTFAIRGROUNDSONTHERIGHT
BRING THIS AD AND SAVE A $BUCK
located on Route 17 in the Essex Square Shopping Center,
Tappahannock • Movie Hotline: 804-445-1166
ADULTS: $7.00 CHILDREN 11 AND UNDER: $5.00
SENIORS 62 AND OLDER: $5.00
ALL SHOWS BEFORE 6:00 ARE $5.00 FOR EVERYONE
* NO PASSES OR COUPONS
FOR FURTHER INFORMATION CALL 804-445-1166
*Now accepting
Visa,
Mastercard &
Discover*
No one under
17 admitted
to R Rated
films without
parent or adult
accompaniment
- ID’s required
FRIDAY, JUNE 13
SATURDAY, JUNE 14
SUNDAY, JUNE 15
MON.-THURS. JUNE 16-19
THE INCREDIBLE HULK (PG13)
12:15, 2:45, 5:15, 7:35
THE HAPPENING (R)
1:00, 3:05, 5:10, 7:25
KUNG FU PANDA (PG)
1:00, 3:00, 5:05, 7:15
YOU DON’T MESS WITH ZOHAN (PG13)
12:30, 3:00, 5:25, 7:35
INDIANA JONES (PG13)
12:00, 2:30, 5:00, 7:30
2:45, 5:15, 7:35
THE HAPPENING (R)
3:05, 5:10, 7:25
KUNG FU PANDA (PG)
3:00, 5:05, 7:15
3:00, 5:25, 7:35
2:30, 5:00, 7:30
5:15, 7:35, 9:55
THE HAPPENING (R)
5:10, 7:25, 9:45
KUNG FU PANDA (PG)
5:05, 7:15, 9:25
5:25, 7:35, 9:50
5:00, 7:30, 9:55
12:15, 2:45, 5:15, 7:35, 9:55
THE HAPPENING (R)
1:00, 3:05, 5:10, 7:25, 9:45
KUNG FU PANDA (PG)
1:00, 3:00, 5:05, 7:15, 9:25
12:30, 3:00, 5:25, 7:35, 9:50
12:00, 2:30, 5:00, 7:30, 9:55
Upcoming
15
(continued from page A2)
18
Sunday
Mr. Entertainment-Glen
Abbott, will be featured at
Kentucky Fried Chicken in
Kilmarnock from 5 to 8 p.m.
A Father’s Day Canoe Trip will
be held at Belle Isle State Park
from 2 to 4 p.m. Fathers are
free with one paying participant.
Enjoy a paddle on the river while
learning about animal fathers.
Canoe, paddle, life jacket and
experienced guide included.
$5. Reservations required.
462-5030.
529-9345.
16
Rappahannock Record • Kilmarnock, VA • June 12, 2008 •
Monday
The Hisoryland Community
Workshop volunteer craft
group meets at the Lancaster
Woman’s Club from 10 a.m. to
2 p.m. Brown bag lunch. New
members welcome.
The Historical Society for
Lancaster County will meet
at 7 p.m. at the G.C. Dawson
administrative office in
The Northumberland
Homemakers will meet at
11 a.m. at St. Stephen’s
Episcopal Church in
Heathsville. 580-8613.
The National Alliance for
Mental Illness-Tidewater
Chapter meets at 7 p.m.
at Urbanna Baptist Church.
435-7509.
The NAACP for Lancaster
County will meet at 7 p.m.
at the Bank of Lancaster
northside branch. 435-3099.
The Kilmarnock Town
Council will meet at 7 p.m.
at 514 North Main Street in
Kilmarnock.
The Kilmarnock Garden
Club will meet at 1:30 p.m. at
Kilmarnock Baptist Church.
“Life Along the Rivers,” a
Rappahannock Art League
member show, will open at
The Studio Gallery at 19 North
Main Street in Kilmarnock. The
show will continue through
June 28. Hours are 10 a.m.
to 4 p.m. Tuesday through
Saturday.
Goin-N-Seine at Belle Isle
State Park from 10 a.m. to
noon. Seines are large nets for
catching fish and other small
aquatic animals. Dress to go
in the water and get wet. $2.
462-5030.
The Summer Reading
Program will begin at
Lancaster Community Library
in Kilmarnock. A magic show
will be held at 10 a.m.
Jammin’ at Joe’s
Local favorite Itchy Dog will be featured at the Friday night
jam at Savannah Joe’s in Kilmarnock from 6:30 to 10:30 p.m.
June 13. From left are Don Lee of Locust Hill, keys, guitar
and vocals; Joe Merolli of Irvington, guitar and vocals; and
Jim Gallon of Towles Point, bass and vocals. Bill Vought of
Gloucester plays drums.
16
Monday
The Richard Henry Lee
Chapter of the Sons of
the American Revolution
(SAR) will hold a luncheon
meeting at Rappahannock
Westminster-Canterbury at
11:30 a.m. The speaker will
be Justine McKnight, an
archeobotanical consultant.
The Board of Supervisors for
Lancaster County will conduct
a public hearing on the
proposed 2008-09 budget at
7 p.m. in the General District
courtroom at the Lancaster
County courthouse.
17
Tuesday
The Kilmarnock & District
Pipe Band rehearses at 7:15
p.m. at Campbell Memorial
Presbyterian Church in
Weems. 462-7125.
Kilmarnock United Methodist
Church.
Duplicate Bridge will be
played at 1 p.m. at the
Woman’s Club of Lancaster.
462-0742.
580-3377.
The RFM Boat Shop opens
at 9 a.m. at the Reedville
453-6529.
The Economic Development
Commission for
Northumberland County will
meet at the courthouse in
Heathsville at 7 p.m.
American Legion Post 86 will
meet at 7 p.m. at the Legion
building on Waverly Avenue in
Kilmarnock.
Savannah
Joe’s
6:30pm - 10:30pm • $5.00 Cover
Itchy Dog • Friday, June 13
William Kyle • Sunday, 1-4pm, no cover
Beer & Barbeque
& Rock n’Roll
We’ve got you covered - 2400 sq. ft. under cover
Remember.... what happens at Savannah Joe’s
stays at Savannah Joe’s
804-435-6000 • Kilmarnock
17
Tuesday
The Corrottoman Seniors
will meet at 10 a.m. at the
Ruritan Club near Lively.
The Lancaster County
Republican Committee
will meet at 7 p.m. at The
Chesapeake Bank Training
Center on School Street in
Kilmarnock.
A Grief Support Group will
be held by Rappahannock
General Hospital and
Hospice of Virginia from 6 to
7:30 p.m. in the outpatient
waiting area at RGH in
Kilmarnock. Pre-registration
required; call 435-8515, or
443-4090.
Art In The Park will be held
at the Deltaville Maritime
Museum and Holly Point
Nature Park with Deltaville
artist Kathy Noffsinger.
776-7191. The program will
continue June 18.
A Marsh March will be held
at Belle Isle State Park in
Lancaster County from 10
a.m. to noon. Learn about
the plants and animals that
make the marsh their home,
and why it is important
to protect them. Go on a
walk with a ranger to see
where they live. Animals
found at Belle Isle include
herons, bald eagles, turkeys,
otters, raccoons, deer, and
many species of birds. $2.
462-5030.
Club will meet at 11 a.m. at
Kilmarnock Baptist Church.
Carol Medlin will address
underwater designs.
The Middle PeninsulaNorthern Neck Community
Services Board will meet
at 3:30 p.m. at the Essex
County Library.
18
Wednesday
The Rotary Breakfast Club
meets at 7:30 a.m. at Lee’s
Restaurant in Kilmarnock.
The Kiwanis Club meets
at 7:30 a.m. at St. Andrews
Presbyterian Church in
Kilmarnock.
The Rotary Club for
Kilmarnock, Irvington and
White Stone meets at 12:30
p.m. at Rappahannock
Westminster-Canterbury.
The Northern Neck Bay
Tones meets at 2 p.m. at
St. Andrews Presbyterian
Church in Kilmarnock.
453-2633.
.A Parkinson’s Support
Group will meet at
Rappahannock WestminsterCanterbury at 1 p.m.
435-9553.
Wednesday
Sandwich Bridge will be
played at the Woman’s Club of
Lancaster.
The Billy Williams Jazz
Quartet will play at Graceful Summer Sounds on the
lawn at Grace Episcopal
Church at 303 South Main
Street in Kilmarnock. Picnics
welcome. Bring chairs and
blankets. Grounds open at 6
p.m. Concert begins at 7 p.m.
435-1285.
A Creatures Of The Night
program will be held at Belle
Isle State Park from 8 to
10 p.m. Bats and owls and
raccoons, oh my! Learn about
these and other animals and
how they have adapted to
living in the dark on a walk with
a ranger. $3 per person, or $8
per family. 462-5030.
Vector, the United States Air
Force Heritage of America
Band’s newest ensemble,
will perform at the Irvington
Commons at 7 p.m.
19
Thursday
Palmer Hall in Kilmarnock.
580-3377..
A Depression Recovery
Support Group will meet
at 3 p.m. at the SeventhDay Adventist Church in
Duplicate Bridge will be
played at 1 p.m. at the
Woman’s Club of White Stone.
Men, women and newcomers
are invited. No reservations are
needed. 462-7605.
The Planning Commission
for Lancaster County will meet
at 7 p.m. at the courthouse in
Lancaster.
The Planning Commission
for Northumberland County
will meet at 7 p.m. at the
courthouse in Heathsville.
The Northern Neck/Middle
Peninsula Chapter of the
Virginia Aeronautical Historical
Society will meet at noon at
the Pilot House Restaurant in
Topping. Visitors welcome.
Nest In Peace at Belle Isle
State Park from 10 a.m. to
noon. Make a bird house while
learning about the kinds of
birds that will make it their
home. Take a walk afterwards
to look for birds and learn
more about them. $2 plus $15
per birdhouse. Reservations
required. 462-5030.
Auditions for “Mary Poppins”
will be held at The Playhouse
in White Stone at 6:30 p.m.
Lancaster Players directors
Robin Blake and Mark
Favazza are seeking boys,
girls, men and women of all
ages. No previous experience,
appointment or audition
preparation is necessary. Call
Blake at 435-1005.
The Upper Deck
Crab & Rib House
All You Can Eat Buffet !!!! $19.95
Friday & Saturday 5pm-9pm
Father’s Day 12pm - 7pm
Open:
/ÕÀÃ`>ÞÊ{«n«ÊUÊÀ`>ÞÊx«£ä«
->ÌÕÀ`>ÞÊ£Ó«£ä«ÊUÊ-Õ`>ÞÊ££>x«
Attention Customers:
New Sunday hours 11am-5pm
462-7400
Lancaster, VA (Mollusk)
A Historic Northern Neck
Tradition of Delicious Meals
at Affordable Prices
Open Seven Days a Week
BREAKFAST
Mon.-Sat. 7a.m.-11a.m.
Sunday 7a.m.-3p.m.
LUNCH
Every Day 11a.m.-3p.m.
DINNER
Fri., Sat., Sun., Mon.
5p.m.-8p.m.
We offer CATERING for
Weddings, Graduations, Reunions,
Private Parties, and Meetings!
Book your Party Now!
Lancaster Tavern
Bed & Breakfast
Is Now Open!
Located down the street
from Lancaster Court
House Across the street
from Mary Ball Washington Museum 8373
Mary Ball Road (Route
3) Lancaster, Virginia
22503
One Free Meal for Any
Group of Four People
Limit one per customer
Offer Expires 12/31/08
Enchanting
Christmas Markets
December 2-9, 2008
Experience the famed Christmas
markets in Salzburg, Vienna,
Prague & more.
Includes:
air from
Richmond,
hotels, 9 meals
& professional
tour
guides
8 day package
for only
$2199
Cancellation
insurance is
required
not included
Adventure Travel
Chesapeake Commons, Kilmarnock
436-9200 1-877-436-9200
“Come join us–we’re going places”
Peppers Is Closing
Goodbye sale begins TODAY!
All fixtures & furniture for sale
Last chance to use gift certificates and store credit
Hours Mon-Sat 10-5 • 804.436.9606
on the corner in White Stone
Homemade Bourbon BBQ Sauce:
presents
The USAF Heritage of America Band’s
Newest Ensemble
Vector
3 tbsp butter
½ c cider vinegar
1 tbsp chopped garlic
¼ c molasses
3 tbsp canola oil
½ c prepared mustard
½ c bourbon
2 tbsp Worcestershire
sauce
1 c chopped onion
½ c orange juice
Tides Inn Executive Chef T.V. Flynn
Enjoy this FREE high energy, diverse concert with family
and friends—it’s sure to captivate all ages!
$ONTFORGETYOURBLANKETSCHAIRSANDPICNICS
For more information call 438-9058.
Gift Certificate
(804) 462-0080
Irvington Village Improvement Association
7EDNESDAY*UNEs0-s)RVINGTON#OMMONS
+ING#ARTER$RIVE)RVINGTON
A3
¾ c catsup
S&P to taste
Melt butter with oil and sauté onion & garlic
over medium heat. Add remaining ingredients
and simmer for 30 minutes until slightly
thickened. Happy Cooking!
v Join us at The Chesapeake Club featuring regional specialties
including local pork renowned to be some of the best in Virginia. T.V.
shares his famous BBQ sauce recipe above. Try it on ribs, pork chops or
tenderloin.
v Don’t forget Dad on June 15th with a Spa treatment or a round of golf
at the Golden Eagle.
Breakfast served 7-11am, lunch 11-3pm and dinner 5-10pm daily.
+ING#ARTER$RIVEs)RVINGTON6!s
www.tidesinn.com
A4
Opinion
Fiction or
Fact
from Bob’s Almanac
Excerpts
by Henry Lane Hull
I
n the spring of 1978 I was on sabbatical from Perhaps they are too involved in their own busiteaching, and between going to Egypt for a ness to care that we pass through the woods
by Robert Mason Jr.
research trip and to the Hoover Institution nearby their operation.
For some folks, witnessing
on War, Revolution and Peace at Stanford UniLynn recruited the Elder B.E. as her “Aide
exceptional talent can be an
versity for more research, I took a week off and de Bees” and the two of them, decked in their
inspiration. A masterpiece moti- ordered some plants for the yard. I was in a self- white bee wrap, enjoy going down to check on
vates them.
sufficiency mode at the time and thought that I the progress of the hives. Lynn is more than a
Sometimes, that happens to
could grow my own Christmas trees, fence posts wealth of information about any matter of an
me. But last Thursday, I experiand walnut for furniture. In that idyllic trance I apian nature. She and her husband, Bing, a
enced the opposite.
ordered several dozen catalpa trees.
fellow retired Navy captain, visited friends in
When I left the Ferguson
I planted several hundred different trees, rep- Provence in the South of France several years
Center of Fine Arts at Chrisresenting dozens of species, but when I came to ago and came home intrigued with the apiaries
topher Newport University in
the catalpas, I had run out of time and only got they had seen.
Newport News, I wanted to rush a few placed where I wanted them. The remainThey began with an operation at their home
home and smash my guitar to
der I “heeled in,” to use my father’s old term, in Merry Point, and have diversified to other
pieces.
in a row on the edge of the vegetable garden, areas as well as ours. Lynn pays due diligence to
I don’t even own a guitar. But, intending to get them moved the following fall the plight of her bees, checking on their condiif I had gotten my hands on one
or spring.
tions regularly and making such modifications
as I exited the building, I would
Naturally, they grew more prolifically than as necessary. In her own neighborhood, she has
have destroyed it.
any of the others. They matured quickly, and partnered with her fellow apiarist, Ann Carter,
That’s how good Tommy
not surprisingly, I never got them replanted. in planting an aspiring vegetable garden of over
Emmanuel is.
The row became a wall of trees, entirely too a half acre, directly across the creek from her
To be honest, I’d never heard
close together, but not without a unique charm home apiary. Those bees will be getting a more
of him before local guitar player of their own in such a configuration. Each spring diversified palette of flowers and pollen than
Don Holt approached me last
they bloom without end and I have come to like ours, and the resulting honeys should be worthy
week to see if I’d be interested in them so much that I never would countenance of note.
seeing “the best guitar player in
cutting them for fence posts, their originally
As far as self-sufficiency has gone, the last 30
the world.”
intended purpose.
years have not unfolded quite as I planned. The
Aware of Holt’s musical
Fast forward a quarter of a century, and our cedars, which I planted with the catalpas, have
knowledge, experience, interest
friend Lynn Kallus, a retired Navy captain, provided many fence posts as they got apple
and talent, I trusted his judgewhose exploits with bees have made captivating cedar rust and died. The Norway spruce which I
ment.
news stories in the local papers, one day asked set out with them not only gave us, along with a
Holt’s in good company. Read- if she could bring several of her hives over to few customers, Christmas trees for years, but the
ers of Guitar Player Magazine
our place to diversify the production of honey. residue of those that I also heeled in now form a
recently named Emmanuel “Best We leapt at the idea and Lynn set up four hives copse of evergreens with a Vinca Minor carpet
Acoustic Guitarist.”
on the edge of the woods in full sight of the row underneath. The new patch that we planted with
A two-time Grammy nominee, of catalpas. The bees must think they have died the Elder B.E. five years ago, should be ready
Emmanuel is a household name and gone to “bee” in heaven.
to use in a few more years. The black walnuts
in his native Australia.
Each day they have a flight pattern back and grew too beautifully to become boards for panLast Thursday, Australian folk forth across the barley field to build their res- eling or furniture and their Carpathian English
guitarist Anthony Snape opened ervoir of honey from the blooms of the catal- cousins also grew well, but have been poor prothe TommyFest concert, which
pas. I admit that they use other sources as well, ducers of nuts and have started to die off.
also featured Stephen Bennett
but the catalpas seem to be providing the main
Thanks to Lynn, our focus now is on bees as
of Gloucester. Snape said he
course of their diet. New to bees myself, I am the next wave of productivity, and we are lookgot his first guitar at age 6 and it impressed at how friendly they are, or at least ing forward to some catalpa honey later this
came with a Tommy Emmanuel not in any sense aggressive towards humans. year.
instruction manual.
Emmanuel started playing
guitar at age 4 and was playing
professionally by age 6. A few
yeas ago he moved to Nashville.
In 1999, Chet Atkins honored
by Del. Albert Pollard
Emmanuel with the title of
“Certified Guitar Player” for his
The Governor as business and more complex as modern 1850, under which the people
lifetime contribution to finger
conditions effect almost light- were granted the right to elect
manager of Virginia
style guitar playing. Like playing
In 1942, Blake Tyler Newton, eninglike [sic] changes in State their own Governor. Twenty
the piano, that’s using all 10
years later, the Underwood
not yet a senator from our life.
fingers on the strings.
Apparently, delegation of Constitution invested the Govregion, wrote House Document
Among numerous other
12, The Governor of Virginia legislative authority [to the ernor with the power of limited
honors, Emmanuel was inducted as Business Manager. This Executive Branch] has come to veto. Under the Constitution
into the Thumb Pickers Hall of
publication, a copy of which stay. For the General Assembly of 1902, the power of veto was
Fame in Muhlenberg, Ky. He
I recently found among some in recess to enact specific leg- extended to the return of bills
has four Platinum and Gold
old books, explores the proper islation to meet specific condi- with suggested amendments
albums.
balance of power between the tions over a period of two years and to the [line item veto in the
One of the first to inspire
branches of government in is an obvious impossibility. budget].
Emmanuel, Atkins’ last recordGovernor
Westmoreland
order to protect democracy and Ours is not a static community
ing was “The Day The Finger
yet still have functioning gov- life. It registers swift, unfore- Davis then stepped into the
Pickers Took Over The World”
seen changes.
political picture with the idea
ernment.
with Emmanuel in 1996.
The powers of the Governor of an executive budget, purI rearranged and condensed
The recording earned them a
some of his writing for this of Virginia have developed to chasing commission, and a
Grammy nomination.
column, but his musings are the point where his position is revitalized penal commission.
Always, the General Assemlargely intact. What is fascinat- somewhat comparable to that
ing is that many of the questions of the president of a corpora- bly may convene itself to curb a
he asks, and observations he tion, directing with decision, tyrannical or subversive GoverUSPS (455-600)
makes, are as applicable today dispatch and finality the affairs nor and to reaffirm in its actions
27 N. Main St., P.O. Box 400,
of the stockholders for whom the principals of democratic
as they were 60 years ago.
Kilmarnock, VA 22482-0400
he acts.
Government. Popular election
As
a
final
note,
the
General
4
This is in sharp contradistinc- and judicial review of adminAssembly convened only once
".&/"111--" +-! +)
every two years until the late tion to the position of limited istrative acts are safeguards to
Mr. and Mrs. Frederick A. Gaskins,
authority occupied by Patrick any arbitrary action. Therefore,
1960s
General Managers
Henry under the Constitution concentration of authority is
–

––––––
Robert D. Mason Jr., Editor
of 1776, an instrument born of not without thorough and readThere
are
many
Virginians
J. E. Currell, Publisher, 1927-1993
tyranny and the fear of subse- ily invoked safeguards.
who
view
government
in
the
0(&.%"!1""'(3"2 ",/%-&./).1""'
The Governor must be in
light of a civilization vastly quent despots.
/&()-*+ '* ./"-+
"-&+!& (.+./$"&!/&()-*+ '
The
metamorphosis
of
the
reality,
as well as name, the
more
complex
than
the
civili*!!!&/&+*()&(&*$+##& ".
zation of Patrick Henry’s day, gubernatorial office had its chief executive. To hamper him
+./)./"-"*!!!-".. %*$"./+
/%",,%**+ '" +-!+2
a civilization becoming more inception in the Constitution of in the name of democracy is to
&()-*+ '
make his official designation a
Subscriptions
(payable
in in
advance):
$20
Subscriptions
(payable
advance):
misnomer and to make a mockper
in the Northern
Neck
per$25
year
inyear
the Northern
Neck and
Midand Middlesex
County;
$36elsewhere.
per year
dlesex
County; $28
per year
ery of democracy.
elsewhere.
Single copy: $.50.
Single
copy, $ .50.
Delegate’s Report
Rappahannock
ecord
")"-&-$&*&-"....+ &/&+*
*!/&+*("1.,,"-..+ &/&+*
Printed on
recycled paper.
All items submitted for publication are
subject to inclusion in digital or other
electronic formats for use in other Rappahannock Record products.
How to reach us:
To reach members of the staff, dial the
main phone number, 435-1701, and then
the employee's extension when
prompted, or use the e-mail address.
Newsroom
Staff:
Newsroom Staff:
Robert
Jr.,Editor
Editor
RobertD.
D. Mason
Mason Jr.,
extension25,
25, editor@rrecord.com
editor@rrecord.com
extension
Lisa
Hinton-Valdrighi
Lisa Hinton-Valdrighi,
extension23,
23, lvaldrighi@rrecord.com
lvaldrighi@rrecord.com
extension
Reid Pierce-Armstrong
Robb Hoff
extension
22,24,
rarmstrong@rrecord.com
extension
rhoff@rrecord.com
Alex Armstrong,
Haseltine
Reid
extension 28, ahaseltine@rrecord.com
extension 22, rarmstrong@rrecord.com
Katherine Shrader
Katherine
Shrader
extension
extension
William22,
R. editor@rrecord.com
Fix, copy editor
William
copy editor,
extensionR.
24, Fix,
editor@record.com
extensionCorrespondent:
Audrey Thomasson
Advertising
Staff:
athomasson@rrecord.com, 436-1904
(address e-mail to mail@rrecord.com)
LindaAdvertising
Troise, mgr.,Staff:
extension 13
K.C. e-mail
Troise,
extension 19
(address
to mail@rrecord.com)
Marilyn
extension 11
Sara Bryant,
Amiss, manager
extension 13
Chris McClintock,
extension 15
K.C. Troise, extension
19
Production
Staff:
Marilyn Bryant, extension 11
(address e-mail to mail@rrecord.com)
Joanna Hatch, extension 15
Wayne
Smith, mgr., extension 17
Karyn
M. Bristow, Staff:
extension 17
Production
Susan
Faulkner
, extension 18
(address e-mail
to mail@rrecord.com
GloriaSmith,
Bosher,
Wayne
Mgr.extension
, extension 17
26
Brenda
extension
SarahBurtner,
Bowis, extension
17 16
Susan Faulkner, extension 18
Publishing/Business
Staff:
Joan Ramsay-Johnson,
17
Frederick
A. Gaskins,extension
president,
Gloria20,
Bosher,
extension 17
extension
fgaskins@rrecord.com
Brenda
extension
16
Bettie
LeeBurtner,
Gaskins,
treasurer,
extension 21, fgaskins@rrecord.com
Publishing/Business
Staff:
Gladys Larson, accounts
mgr.,
3UBSCRIBETOTHE2ECORD
(Reprints from the June 12, as to patent tongs, will say-no
1908, issue of the Virginia Citi- change to the law by last Legiszen)
lature, and patent tongs will be
used next season as heretofore.
Crisp News
Police steamer Accomac
The work of dredging the
last
week broke her shaft on a
Rappahannock will commence
about June 15th at a point some fish stake off Buckroe Beach.
distance below Fredericks- Launch Greyhound was also
burg and work up to that point. out of commission last week by
Mr. Arthur Conklin, govern- breaking rings in cylinder.
ment engineer, will supervise Kilmarnock
T.B. Hurst left last week
the improvement for which
$77,500 has been appropriated to attend the Confederate
Reunion in Birmingham, Ala.,
by Congress.
this week.
Fish and Oyster Notes
Misses Grace and Annie
Answering many inquiries
Hurst have returned to their
home near here, the former
from Norfolk where she has
been teaching the past session, and the latter from Bowling Green, where she attended
school.
The boys from here played
Crisfield Wednesday. The score
being in favor of Crisfield.
Mrs. J.T. Wayman and little
son, Brent, also Walter Brent,
Ã«>ÞÊ`ÛiÀÌÃ}\
who has been attending school
in Staunton, arrived this week
`>ÞÊJxÊ«°°
to spend a month or more at
their parental home.
>ÃÃwi`Ê`ÛiÀÌÃ}\
The protracted meeting held
here by Revs. Claybrook and
/ÕiÃ`>ÞÊJÊ ""
Fisher closed Thursday night.
This has been a very interesting
iÜÃ\
meeting and attendance good.
(Transcribed by Stephen A.
/ÕiÃ`>ÞÊJÊ ""
Redd, volunteer of the Mary
Ball Washington Museum and
nä{°{Îx°£Çä£
Library)
&ORPAPERSMAILEDTOOTHERAREAS
QPERYEARQPERMONTHS
3TUDENTSUBSCRIPTIONQFORMONTHS
/2/RDERAN)NTERNETSUBSCRIPTION
ANDDOWNLOADA0$&VERSIONOFTHE
ENTIRE2APPAHANNOCK2ECORDON
YOURCOMPUTER'ETIT7EDNESDAYS
QPERYEARQPERMONTHS
Q0AYMENTENCLOSED.EWQ2ENEWALQ
Q"ILLME
Q#HARGETOORFAD
.AME??????????????????????????????????????
!DDRESS????????????????????????????????????
#ITY????????????????????????????????????????
3TATE????:IP??????????0HONE?????????????
3IGNATURE?????????????????????????????????
extension
mail@rrecord.com
Kim Kent,16,
accounts
manager
extension 14, ardesk@rrecord.com
Ann Shelton, accounts manager
extension 12, mail@rrecord.com
Subscriptions:
Anna Ticer, circulation manager
extension 16, circulation@rrecord.com
The article “Farmers say
increased ethanol production
saving consumers” in the May
29 edition of your paper is at
best a compilation of only the
favorable facts, ignoring the
whole truth.
Tony Banks of the Virginia Farm Bureau Federation
asserts that American consumers benefit from greatly
increased ethanol production from domestic corn. But
the facts are otherwise. Corn
prices have almost tripled and
corn is a far more basic ingredient in food than in fuel.
The bloated corn crop has
reduced plantings of other
basic crops, such as soybeans,
whose price has almost tripled. Not only is there a 51
cent per gallon tax credit for
ethanol used in fuel, but also
a 54 cent per gallon tariff to
keep Brazilian ethanol from
being imported. American
taxpayers directly subsidize
corn farmers for corn production while elevating its price
by keeping foreign ethanol
out of the American market.
Who really benefits from
this wrongheaded governmental policy? Archer Daniels Midland and other large
agricultural
corporations
do. ADM’s stock price has
doubled since ethanol was
mandated by Congress and
approved by the President.
Measured in dollars midwest
farmers in general are having
booming harvests. Moreover,
the more recent energy bill
signed in December 2007
sets ethanol production goals
that must increase six-fold by
2022, and guess what? It will
be domestic production thus
increasing basic corn prices
much more, even if ethanol
derived from cellulose comes
into the U.S. production pipeline. In 2008, ethanol production will gobble up one-third
of U.S. corn production which
has increased at the expense
of other crops whose prices
have also risen.
Yet there are more negative
aspects of ethanol as a motor
fuel. Its production process
requires as much or more
energy as the resulting ethanol energy content, only 85
percent that of gasoline. It is
a solvent, thus dissolving fuel
system accumulations which
can clog fuel filters and which
can result in leaks. It is hygroscopic, thus taking moisture
from the air in fuel tanks not
fully filled and adding water
to the fuel which, in turn,
settles to the bottom where
the fuel intake is. For vehicles
used only infrequently, such
as pleasure boats, this means
the engine won’t start. Simply
put, ethanol is not a good substitute for other motor fuels.
QPERYEARQPERMONTHS
extension
koliver@rrecord.com
Anna
Ticer,21,circulation
manager,
extension 21, blgaskins@ssentinel.com
Subscriptions:
Kate Oliver,
CPA, accounts payable
From Sam Marshall,
White Stone
Yesteryear in Lancaster
Bettie Lee
Gaskins,
treasurer
extension
12,
mail@rrecord.com
extension 20, fgaskins@rrecord.com
Ann
Shelton, accounts mgr.,
What’s wrong
with ethanol?
&ORPAPERSMAILEDTOADDRESSESIN,ANCASTER
.ORTHUMBERLAND2ICHMOND
7ESTMORELANDAND-IDDLESEXCOUNTIES
#REDIT#ARD.O???????????????????????????
%XPIRATION$ATE???????????????????????????
Frederick A.
president
extension
14,Gaskins,
mail@rrecord.com
,ETTERS
TOTHE%DITOR
-AILTO2APPAHANNOCK2ECORD#IRCULATION$EPT
0/"OXs+ILMARNOCK6!
0HONEEXTOREMAILCIRCULATION RRECORDCOM
2APPAHANNOCK
2ECORD
$EADLINES
It should come as no surprise that the great increase in
prices of farm commodities
raises food costs for everyone. As a partial remedy, food
stamp benefits were sharply
increased in the 2008 Farm
Bill. Globally, there is a real
food crisis in less developed
countries. There, a far greater
portion of personal income
is devoted to food than in
the U.S., and the prices of
exported U.S. foodstuffs are
increased through tariffs and
other restrictions protective
of American labor. How can
we in this rich country justify burning food just to avoid
slightly higher fuel prices or
more fuel conservation while
keeping the costs of food
exports inordinately high?
So, don’t tell us how great
ethanol in fuel is when, in
fact, it is a great gift to American farmers that Congress has
said U.S. taxpayers must pay
for through increased direct
costs of food plus indirect
costs of protectionist subsidies and tariffs.
And to top it off, the 2008
Farm Bill passed last month
over the President’s veto gave
a traditionally magnanimous
revenue guarantee for farmers
based on the five-year state
average yield and the twoyear national average price,
no matter what the actual crop
value is. Talk about a windfall
profit! It’s a special interest
policy on top of an energy
non-policy.
A closer look
at ignorance
From Tara Simmons,
Kilmarnock
I was horrified to read the
recent article by Jane Tims,
who in the past has written
wonderful stories of helping
our furry friends, switch her
views on nature and write
such a cruel view on another
of nature’s wonders.
This was an article that
glorified
animal
abuse.
Black and other local snakes
are for the most part, harmless to humans and extremely
important to the environment.
They are responsible for killing thousands of rodents
each year here in Virginia.
They are shy animals that
would much rather run from
people that confront them.
Even if that snake at the end
of “Dee’s” driveway had in
fact been a copperhead, it
would have just crawled off
into the woods to live its life.
We have so many species of
harmless snakes in this area,
assuming one is deadly is
playing long odds.
Reptiles are often the
object of unfounded fear. A
recent study done by a major
university and published in
“Reptiles” magazine actually
studied the behavior of drivers against box turtles and
snakes on the road. A rubber
turtle and a rubber snake
were placed on the road, out
of the way of an accidental
strike, so that a driver would
have to go out of their way to
hit it. A hidden recorder then
counted the number of times
each reptile was struck.
The numbers were frightening. A majority of drivers purposely hit the snake.
How sad that we have let our
fear hurt such creatures. This
time of year in particular,
the local reptiles are coming
out of hiding and are looking for warm places to sun,
and to find new love. Please
don’t take the advice of this
column and let fear cause
more animal abuse.
I am appalled that anyone
would find amusement at
the use of a car as a deadly
weapon. I am appalled that
such an act of brutality was
found to be funny and printed.
I am frightened that others
would think such a heartless
action was acceptable and do
it themselves.
How sad to think the poor
thing could easily have been
real and that these people
would feel justified in the
killing they would have
committed of an innocent
animal.
Please remember, snakes
and other reptiles were here
in the Northern Neck long
before we humans. We are
all come-heres to them, they
should be respected and
allowed to live in peace.
A5
Letters to the Editor
Arts programs
come to a close
Give it away
From Mary Alice Eubank,
Kilmarnock
Under the rubric of better
late than never, I would like
to add to the dialogue that the
Rappahannock Record initiated a month or two ago in its
supplement about what we are
doing and what we can do to
become greener.
When I visit my parents, I
often offer to cart back with me
the things in their garage that
are dumpward bound. “Why?”
they wonder. “You don’t need
the extra worry of disposing
this junk.” I answer, “It’s no
worry! People will come to me
to pick it up for their personal
use.” “Boxes?” Old computer
equipment? Used packing
materials? Why would anyone
in Northern Virginia have any
use for this!” To date, I have
found takers for every piece
of “junk” I’ve moved from my
parents’ garage to the trunk of
my car. What’s more, the takers
come to my very door for it.
I’m talking about the Freecycle network, like the one that is
already active in Essex County.
The idea behind Freecycle is
so simple, it’s brilliant—why
throw away something that
someone else might use, when
our landfills are completely out
of control? Why buy something
if you can find some similar
used item for free?
How it works is simple: if
you have something you wish
to part with, you offer it online:
“OFFER: balls of yarn left over
from 10 years of knitting projects—various colors. I live just
off the intersection of 17 and
95.” If you need something, you
post a message: “WANTED:
Working floor lamp in any
condition. I’m trying to sell a
dimly lit house. I can pick up at
your convenience.”
In the six months I’ve known
about Freecycle, I’ve given
away old fingernail polish, new
weather stripping, plastic plant
pots, used electric outlet and
switch covers, a cat scratching
post, styrofoam peanuts, old
venetian blinds, a broken lamp,
huge quantities of clothes,
equipment I no longer needed
after surgery, an old CRT
monitor, keyboard, mouse,
and empty computer case. I’ve
received a cat condo, a bed bolster, a table, kitchen utensils,
glass brownie pan, bedding,
two twin beds, a futon couch
in a fold-down wooden frame,
two floor lamps—the list goes
on.
I’ve also received immense
satisfaction knowing that these
transactions reduce the flood
of things heading for the landfills; reduce, too, the rampant
consumerism that has seized
hold of us. But best of all? It’s
turned a chunk of impersonal
Northern Virginia into a place
of community for me. I’ve met
really interesting people and
made a few real friends.
Is this too good to be true—
free stuff? No, and only a few
rules are in place: no offering
of personal services, illegal
substances, or pornographic
items; no selling, borrowing,
bartering, or trading—it must
be no strings attached.
Visit
www.freecycle.org.
Find out how easy it is to
bring the Freecycle network to
your area and transform your
neighborhood into an even
more active community than it
already is.
From Elizabeth L. Cobb,
Vienna
In May 2007, The Center for
the Arts Corporation ended.
For the last 17 years this corporation served the community in many ways.
Programs included presentations of American musicals
such as “My Fair Lady,” “The
Music Man,” “Oklahoma!,”
“Carousel” and “Fiddler on
the Roof.”
All people interested in the
theater were invited to come
and be part of the musical,
either on stage or back stage.
The original history play,
“Come Here’s In Eden,” a
story of the beginnings of The
Northern Neck and written
by three of The Center for the
Arts’ board members, was performed in two different years.
Another program was The
Children’s Theater Series
which offered to over 30,000
students from both public and
private schools the opportunity
to see close up and personal
many professional, traveling
actors in plays and musicals.
These Children’s Theater productions included some local
artists also. They were seen
in “Peter and the Wolf,” “The
Carnival of the Animals,”
“Heidi,” “The Nutcracker”
and “Hansel and Gretel” performed four different years.
The center also hosted performances by The Virginia
Opera Company, and local
musicians in a performance
of “The Messiah” with local
orchestra members, chorus
and professional soloists at
the Lancaster Middle School
as well as a “Messiah” singa-long with members of the
local orchestra.
The center offered music
scholarships to those who
aspired to higher education in
the music field, both vocal and
instrumental, and has helped a
number of local musicians to
continue their training at the
college level.
In May 2008, The Academy
of Performing and Creative
Arts closed. The academy had
been in operation since 1991
in The Eubank Building in
Kilmarnock and before that, in
a little building at the corner
of Augusta and School streets
in Kilmarnock. The property
is now a parking lot. The academy was in business for over
20 years, offering classes in
dance, karate, modeling, art
and music instruction for
adults and children. Many of
the families, young and old,
have enjoyed learning and
developing a talent of their
own interest. It was a first of
its kind in the area and offered
the community the opportunity to enjoy the arts in all of
its glorious expressions.
My pleasure has been in the
birth, growth and development
of these two corporations, The
Center for the Arts and The
Academy of Performing and
Creative Arts. The dedicated
and talented teachers, directors, board members and actors
as well as the students and
their families who have been
part of the development of the
programs and with whom I
worked have been a joy and a
great pleasure to know.
It is with pride and some
sadness that I end the classes
held in The Eubank Building.
The last APCA function will
be a recital of my piano and
harp students June 22. The
dance and karate classes ended
in May. After 20 years of offering performing and creative
art classes, I have decided that
it is time for me to look to the
future in different ways.
I hope that the community will continue to strive
for higher goals in education
in the arts and that each and
every one the academy and the
center has touched over the
years will keep art and music
in their lives and a song in
their heart.
Judge not...
From Mr. and
Mrs. John Grigsby,
Kilmarnock
Several weeks ago an article
was published in the Rappahannock Record regarding a
confrontation between two
individuals. One of the individuals—interestingly the one
who called the police in the
first place—was arrested. The
case recently went to trial, and
he was found not guilty as he
knew all along he would be.
The article was, unfortunately, printed before the ver-
dict; and, therefore, served
no purpose other than to fuel
rumors and to humiliate a
person who was later found to
have done nothing wrong. The
article referenced an incident
that occurred many years ago
that, without some context,
was misleading and open to the
wrong interpretation. The article also contained information
related to the alleged incident,
some of it exaggerated and
some just simply personal.
Although he was found not
guilty, nothing can undo the
damage that was done by the
article. His livelihood, selfesteem, and dignity were
impacted by dredging up the
past for no purpose and by sensationalizing the current incident, again for which he was
found not guilty.
We are not saying that this
person hasn’t made mistakes
or that all of the information
was completely untrue. We are
saying that there is no reason
to print information about any
person’s past unless there is
some compelling reason to do
so. Given the not guilty verdict,
that was not the case here.
Trillion $
meltdown
expected
From Jerry Peill,
Lancaster
The May 28 letter “Secret
federal plans revealed” invites
fact checking. Those who chose
to do similar web research will
have noted the amateur sources
of most predictions of financial
collapse, but this is not to deny
such an eventuality, only to
question its timing.
A year ago outstanding financial claims already exceeded
the value of all capital by about
four times, and globally, not
just in America. Now the total
of all obligations, and notably derivative instruments, is
approaching $500 trillion. It
equals 10 times the value of
global GDP; a virtually impossible amount to cover.
This growth is asymptotic
and, as any analyst will tell
you, an asymptotic curve is
unsustainable. Our government
has led us to this. It should be
leading us out, but so far its
only “cure” has been more of
the same.
The foregoing figures come
from “Trillion Dollar Meltdown” by Charles Morris. He
is a venerable writer on financial megatrends who has seen
it all.
Mayor’s response
From Dr. Curtis H. Smith,
Mayor of Kilmarnock
First, I appreciate the citizens and members of the business community who came
forward at our recent town hall
public comment session. They
voiced their concerns loud and
clear.
For the record, I want to
clear up some inaccuracies in
the last week’s Record. Mr.
Booth stated that I approved
the tax increase, which I did
not, and in fact, stated my concern in an open council session that the rate needed to be
reduced. I did not “back track,”
as Booth stated, but suggested
to council that they go back
and look at what was needed to
accomplish a roll back to 10 or
12 cents or more. To be totally
revenue neutral with the new
county assessment, the rate
would have to roll back to 9.5
cents per $100 assessed value.
This budget, like all previous budgets, was prepared by
a council committee of two
members, the town manager
and staff. Certain changes are
made based on recommendations by an outside auditing
group who annually evaluates
our fiscal condition as required
by law, the bond markets, etc.
The budget and tax rate is
the prerogative of the council.
Kilmarnock, like most towns
and cities in Virginia, is a
council-manager form of gov-
Hurricane season is officially here
until November 30. Be prepared!
Flood insurance needs to be a
part of your plan. Flood insurance
takes 30 days to go into effect, so
act NOW. Isabel and Ernesto are reminders of what flooding can do.
Call us today for information. We can help.
HUBBARD INSURANCE
AGENCY, INC.
30 N. Main St., Kilmarnock, VA
(804) 435-1144
ernment. The mayor’s position
is largely ceremonial, but does
have certain powers in certain
instances, such as breaking tie
votes, conducting meetings
and handling emergency situations to insure public health,
safety and security.
It was appropriate for me to
enlist the aid of the community to voice their objections
and concerns, going the route
of the “bully pulpit” by scheduling the two public sessions.
Their voices were heard and
council is working to revise
the budget. Cuts will be made
and other projects can and will
be pushed back, hopefully for
better economic times.
As far as a new town center is
concerned, discussions for this
have been ongoing since town
councils before me moved to
the present location from the
small cottage next to the Lancaster Library. The present
building was deemed a temporary move, but as other more
pressing issues took center
stage over the years (water and
sewer improvements, Main
Street renovations, etc.), we
all felt council needed to be
conservative and move slowly
in planning for a new town
hall. The $9 to $10 million
price was a figure put out by
a consultant estimating the
cost of a total project including other buildings, water and
sewer infrastructure and road
improvements. The actual estimated cost for a new town hall
is about $2 million based on
what the community decides it
wants. If and when this project
goes forward, our citizens and
business community will have
a pivotal role in planning for it.
Council wants a new town hall
to be functional and practical,
and built when we can afford
it, which is not now.
As far as Booth’s assertions
of a $10 million town hall project, which is inaccurate, the
capital portion of this budget
in which money for this project was set aside, was reviewed
by the town planning commission, which he chairs. As
mayor, I did not receive any
objections from his committee. Perhaps if he had made his
meetings he would have been
better informed and could have
given council his recommendations, instead of choosing to
wait and attempt to grandstand
in the local paper.
I attended our Lancaster
County Board of Supervisors
meeting this past week, and listened to a packed crowd question the board’s thinking about
building a new courthouse,
which I believe is long overdue.
That really wasn’t the main
issue that night. What many
people wanted was a different
funding route. The board chose
to ignore everyone’s concerns
and it was a poor example of
what public servants sometimes do. And, by the way, you
can expect another 1 to 2 cent
increase on your assessments
to follow to pay for it. Citizens
voices were heard and ignored
that night.
I mention this only to reit-
erate that Kilmarnock Town
Council will hear its residents
and be responsive. Many citizens have come forward and
offered their expertise, which
is appreciated. As mayor of
Kilmarnock, I have no business or development interests
to complicate my thought process. I have always tried to be
consistent, reliable and forth-
right as a public servant. As a
well educated individual, I can
honestly say I am always in a
“learning mode.”
It’s been said that when a
person is doing all the talking, they’re not listening, and
not learning. I will listen, and
I will encourage the council to
do what is right for its citizens
and the Town of Kilmarnock.
Rep. Rob Wittman
attacks trash imports
Rep. Robert J. Wittman
recently introduced H.R. 6166,
legislation to give localities and
states control over the importation of interstate waste.
“Virginia should have the
ability to say ‘no’ to trash shipments from out-of-state. Being
one of the national leaders in
garbage imports is not something to be proud of. H.R. 6166
would give states and localities
a say in how to manage interstate waste,” said Rep. Wittman.
Virginia is the nation’s
second largest importer of outof-state trash. According to the
Virginia Department of Environmental Quality, Virginia
imported more than 7 million
tons of waste from other states
in 2007. Under current law,
states do not have the ability to
limit the importation of interstate waste, explained Rep.
Wittman.
Wittman
continues
the
efforts to limit trash imports
to Virginia championed by the
late Rep. Jo Ann Davis. Rep.
Wittman reintroduced Rep.
Davis’ bill to give states the
ability to impose restrictions
on interstate waste.
“I am proud to carry on the
efforts by Rep. Davis to try and
curb trash imports and change
Virginia’s reputation as a dump
site for waste from Baltimore
and the District of Columbia,”
said Rep. Wittman.
Specifically, the bill will give
localities import control over
smaller landfill facilities. Under
this legislation, if a landfill
receives less than 100,000 tons
of municipal solid waste a year,
local governments will have
the option to limit imports.
States would also have
greater influence over imports
to landfills that take in over
100,000 tons of waste a year.
For example, states will have
the ability to cap the percentage of out-of-state waste processed by these facilities. The
state legislature would determine what percentage can be
imported from out of state into
the facilities.
Penalties get tough
for underage
drinking & driving
The punishment for underage drinkers who get behind the
wheel will be stricter beginning
July 1.
Underage drinking and driving will be punishable as a Class
1 misdemeanor. Currently, the
punishment is loss of license for
six months and a $500 maximum
fine. The new penalty will be a
year in jail and either a minimum
fine of $500 or 50 hours of community service.
Alcohol use by people under
21 is prohibited in Virginia.
The Commonwealth has a zero
tolerance law regarding teens
and alcohol use. Zero tolerance
means the legal limit for teens is
a .02 blood alcohol concentration (BAC), which is the normal
alcohol content of the average
person. Even a small amount of
alcohol can result in a conviction.
Among other laws taking
effect July 1, learner’s permit
holders will be required to practice behind the wheel a minimum 45 driving hours including
at least 15 hours after sunset. The
law also requires certification of
the hours the learner’s permit
holder drives, which must be
documented on a form supplied
by the Department of Motor
Vehicles (DMV).
Beginning July 1, anyone who
operates a moped faster than 34
mph is considered to be operating a motorcycle. The operator
will be subject to the same traffic laws that govern motorcycles.
Moped operators must be at least
age 16 and every person driving
a moped must carry some form
of identification that includes
name, address and date of birth.
Also starting July 1, the penalties for repeat violators of Virginia’s child restraint law will be
more stringent. First-time offenders will continue to be subject to
the current civil penalty of $50.
Those convicted of a second or
subsequent violation on different dates could pay a civil penalty of up to $500. Virginia state
code requires children up to age
8 to be properly secured in a
child restraint device. Children
between ages 8 and 16 must be
properly secured by an appropriate safety belt.
GAMBLER’S SALE
ALL SHRUBS
ALL TREES*
June 5-11 - 30% off
June 12-18 - 40% off
June 19-25 - 50% off
Take your chances!
Will that tree or shrub be there?
*In stock merchandise, while supplies last.
161 Technology Park Drive • Kilmarnock, Virginia 22482
(Off Harris Road between Rt. 3 & DMV Drive)
(804) 435-7777
TOLL-FREE
800-448-4505
Farmers’
Workshop to feature market
underwater designs to host pet
activities
Club will have an underwater design workshop Tuesday,
A6 •
“I Do”
June 17, conducted by Carol
Medlin at the Kilmarnock
Baptist Church at 11 a.m.
“Underwater designs have
become a fascination with me.
Flowers last longer underwater
and their beauty is magnified
by the water. These designs
are related to ikebana and to
a custom of Victorian ancestors who often placed a single
bloom under water in a glass
ball,” Medlin said.
The choice of plant material is important, according to
Medlin. One must choose firm
and hard surfaced floral material that will not deteriorate
rapidly when submerged, like
roses, tropical flowers, lilies,
magnolia, evergreens, succulents, fruits and some vegetables.
“Everyone who participates
in this workshop will leave
with a beautiful underwater
design and be able to continue
creating underwater designs
at home,” she said.
Medlin, her husband, Sterling, and their two sons, have
been enjoying the Northern
Neck since 1991, when they
fell in love with it and built
a second home to enjoy the
waters. In 2007, they decided
to move from Richmond.
Medlin was formerly a registered nurse and certified nursing professional with degrees
from James Walker Memorial
Hospital, the University of
North Carolina at Wilmington
Workshop presenter Carol
Medlin displays an underwater design.
and the Medical College of
Virginia. She is a member of
the Chesapeake Bay Garden
Club and is co-chairman of the
design committee.
She is studying to become
a National Accredited Flower
Show Judge for the National
Garden Clubs, Piedmont District of the Virginia Federal of
Garden Clubs.
Attendees should bring a
clear glass container, a flower
or flowers, plant material,
silver wire, split shot fishing
lead, plumbers lead, a needle
holder, sticky clay, marbles of
various colors, rocks or anything one can imagine to cover
the mechanics, and a sandwich
for lunch. A beverage and
dessert will be provided. Call
Ruby Wilson at 580-8385.
Hostesses for the day will be
Rebecca Nunn and Barbara
Ohanesian.
Youth take the stage
As the Lancaster Players are
midway through the second
year of rekindling community theater, there has been an
infusion of young people on
the stage of The Playhouse in
White Stone.
During the past 12 months,
the six productions of the
Lancaster Players have featured 68 roles acted by young
people ages 3 to 19, said
board member Kerley LeBoeuf. The diversity of the
actors is evident based on the
schools they attended: Chesapeake Academy, Christchurch
School,
Lancaster
High
School, Lancaster Middle
School, Longwood University,
Northern Neck Homeschoolers and Northumberland High
School, he said.
Equally diverse have been
the roles assumed by these
young people, LeBoeuf continued. In addition to the
expected children’s roles
in “House at Pooh Corner”
and “Wizard of Oz,” three
adult roles in “The Mousetrap” were acted by seniors at
Christchurch and the drama
club students from Northumberland High School
presented in the “Director’s
Showcase.”
This inclusion of young
people on stage augments the
history of adult theater by
the Lancaster Players during
the past several decades, said
LeBoeuf. The emphasis on
youth is the inspiration of two
members of the board of the
Lancaster Players.
While many of these young
actors know Robin Blake and
Mark Favazza as the directors of their play, more residents know Blake as a teacher
at Lancaster Middle School
and Favazza as the executive
director of the Northern Neck
Family YMCA.
Upcoming productions will
continue to showcase young
talent, said LeBoeuf. “Three
Women and Friends” features
two teens, and “Mary Poppins” will be presented for
children. Auditions are open
to all who would like to experience being “on stage.”
Auditions for “Mary Poppins” will be held June 19
(6:30 p.m.) and 21 (10 a.m.)
at The Playhouse. There are
parts for boys, girls, men and
women of all ages. No preparation, appointment or theater
experience is necessary.
Guitarist Available
The
Northumberland
County Animal Shelter will
sponsor pet adoption activities at the Heathsville Farmers’ Market June 21 from 9
a.m. to 1 p.m.
The market is sponsored by
the Rice’s Hotel/Hughlett’s
Tavern Foundation at the
Tavern complex behind the
courthouse in Heathsville.
The shelter will bring several dogs and cats; formal
adoption must be done at the
shelter. A parade of shelter
graduates is planned.
Information about the general care of pets will be provided by groomers and other
professionals. Information on
spaying and neutering will be
provided by the Animal Welfare League. Animal control
officer Roger Briney will
discuss animal abuse and
neglect.
A representative of Northumberland County will
explain the need for dog tags
and rabies shots. A photographer who specializes in pet
portraits will be present to
photograph people and their
pets.
The Northern Neck Kennel
Club is arranging a rally for
dogs and their owners. Shelter manager Fran Warren will
report on the expansion project in progress and describe
the growing adoption success
rate. A silent auction will be
held for an animal-theme
quilt; proceeds go to the
expansion fund.
“The shelter is always
happy to promote adoption
and we are pleased that the
Tavern wanted to feature our
work,” said Warren. Animal
toys and shelter t-shirts will
be on sale. Bumper stickers
will be available.
A market vendor, The
Chicken Coop, will bring
animals for sale. According
to Pamela Glynn, the company will have baby turkeys,
bunnies, chicks and an adult
rooster. For do-it-yourself
chicken raisers, she will have
hatching eggs. Glynn raises
Rhode Island Reds, Jersey
Giants and Salmon Savorelle
chickens. The baby animals
will be shown in supervised
cages so that children can
pick them up. Information on
the care and feeding of the
pets will be available.
The market is supported by
vendors of clothing, jewelry,
fresh produce, area-grown
plants and art work. The Northumberland Public Library,
Master Gardeners, Red Cross
and the YMCA will have
information available. Food
and beverages will be sold
and the Tavern Restaurant
will be open for lunch.
}ÛiÊÕÃÊÌiÊLiÃÌÊiÜÃÊvÊÞÕÀÊvi
Üi``}ÊEÊi}>}iiÌÊ>ÕViiÌÃÊUÊi`ÌÀJ,,iVÀ`°VÊ/ÕiÃ`>ÞÊJÊ®
JEWELRY
FACTS
Carmen Rebekah Packett
and Dustin A. Martin
Packett-Martin
Mr. and Mrs. Andrew B.
Packett of Warsaw announce
the engagement of their
daughter, Carmen Rebekah,
to Dustin A. Martin, the son
of Mr. and Mrs. Gary L.
Martin of Mocksville, N.C.
Miss Packett is the granddaughter of the Rev. and Mrs.
Willard D. Bowen of Warsaw
and the late Mr. and Mrs.
Louis H. Packett, formerly of
Warsaw. She is a graduate of
the College of William and
Mary, where she received a
bachelor’s in biology in 2003
and a master’s in biology in
2005. She is employed as
an endangered species listing biologist with the U.S.
Fish and Wildlife Service in
Arlington.
The prospective groom
is the grandson of the Rev.
and Mrs. Robert M. Tenery
of Mocksville, N.C., and
Mrs. Irene Martin and the
late Paul Fletcher Martin of
Winston-Salem, N.C. He is a
2000 graduate of East Carolina University with a bachelor’s in biology. In 2006,
he received a bachelor’s in
criminal justice from Appalachian State University. He
is employed as a law enforcement officer with the U.S.
Fish and Wildlife Service in
Warsaw.
An October wedding is
planned.
Catering
by Karen
BY ROSS CHRISTIANSEN
Several gems may appear to show a
“cat’s eye” but the term “catseye” is generally
used to refer to a rare form of chrysoberyl.
The best quality catseyes are a honey colored
brownish-yellow. The eye, often bluish, is in
strong relief.
Fine jewelry is capable of giving immeasurable and long-lasting pleasures to its
fortunate owner. Give jewelry . . . the perfect
gift.
Ross’s Rings and Things, Ltd.
)RVINGTON2Ds+ILMARNOCKs
-ONDAY&RIDAYs3ATURDAY
In celebration of
our Grand Opening
Kilmarnock Inn
requests the honor of your company
at a Ribbon Cutting and Open House/Backyard
Bar-B-Que
Thursday afternoon the nineteenth of June
two thousand eight
Ribbon Cutting commences at four
Open House, five til seven
at 34 Church Street, Kilmarnock, Va.
Please RSVP to Nancy Travers at 804-435-0034
Limited space available
For all Occasions
804.435.9876
One of a Kind Gifts for a One of a Kind Dad
Weddings, Parties or Special Occasions
30 years experience, all styles
including classical & jazz
Individual instruction also available
Contact Robert Keyes
804.296.0460
804-435-8758
The New Gift, Home Decor & Accessories Store on Main St. Kilmarnock
CORK SCREW
Easy Pull with Worm
Cutter & Case
Crystal & Pewter
Wine Decanters
As well as
Wine Accessories
Reg: $35
The
Pilot
House
Join us for Father’s Day
11:30 a.m. – 6 p.m.
• Fried Oysters
• Barbecued Ribs
• Prime Rib
• Turkey with Dressing
• Lots of Vegetables, Salads
and Homemade Desserts
$15.95
Please call for reservations
2737 Greys Point Road s State Rt. 3 s Topping
(804) 758-2262
Now: $28
Crystal Wine Glasses
4x’s stronger than regular
Crystal
Lead Free/dishwasher
safe
Simply the Best
Cognac Pipes
Martini Glasses
Crystal & Pewter
Really Enjoy an
After Dinner Drink
Orrefores
Roaring 20’s
Reproduction
Autographed
Rush Limbaugh
Tie
Morgan & Peace
Silver Dollars
$100-$500
Champagne Saber
w/ Holder
A Real
Conversation Piece
Collector’s Item
$19.99
Steuben
6pc. Crystal
Vintage
Cuff Links
Estate Prints
Charles Frace’
Sherry Cordial
Decanter & Glass
Set
Largest Selection
In the Tri-Town Area
Cougar-Jaguar
Prints
Framed & Signed
Crystal
Hour
Glasses
Traditional &
Contemporary
3pc. Cafe Sets
Wood-Wicker
Iron-Marble
And More
Old Foreign Coins
From around the
World
Cooper’s
Collector Canes
Carved Wood/Nickel
$229-$999
$3
$50-$150
$24.99-$29.99
Card Protectors
For the Poker
Players
Collectibles
$8-$50
!REA%VENTS
■ Family gardens
■ Father’s garden
Celebrate Father’s Day, June
15, in the Children’s Garden
with entertainment and garden-related activities at Lewis
Ginter Botanical Garden at
1800 Lakeside Avenue in Richmond. The Jangling Reinharts
will give a concert. There will
Vector
be classic cars and motorcycles
on display. Food will be available for purchase.
Call for 262-9887 for admisThe United States Air Force seas.
sion or directions, or visit www.
Heritage of America Band’s
The percussionist recently
lewisginter.org.
newest ensemble, Vector, will returned from an unpreceperform at the Irvington Com- dented stint with an ensemble
■ Concert series
The 2008 Music By the River mons, Wednesday, June 18, at in Southwest Asia supporting
Operation Iraqi Freedom. The
series will continue June 14 7 p.m.
Vector was created earlier group sometimes includes a
with Steve Keith, June 21 with
Mercy Creek, July 12 with The this year in response to the mili- guitarist and vocalist.
Vector’s repertoire includes
Honeywind Bluegrass Boys, tary’s growing need for mobile,
July 19 with Southern Grace troop-focused ensembles and country and western, funk,
and August 16 with Ottoman at the public’s greater desire for big band and Dixieland jazz,
4:30 followed by Jumbo Lump high energy entertainment. Broadway show tunes and top
Daddy and the Backfin Boys. Each member of the group is a 40 hits.
Attendees should bring
All other shows begin at 6 p.m. seasoned, versatile performer.
The concerts are free. How- The five brass players have chairs or blankets. Picnicking is
ever, a daily parking fee of $3 been featured on international welcome. The concert is sponstages with Air Force musical sored by the Irvington Village
per vehicle applies.
organizations stationed over- Improvement Association.
Vector to perform in Irvington
■ Planting a settlement
■ Shelter yard sale
The Northumberland County
Animal Shelter will sponsor an
inside/outside yard sale from
8 a.m. to 1 p.m. June 14 at
the Northumberland County
School Board building in
Lottsburg. Proceeds benefit the
shelter.
■ Vector concert
The United States Air Force
Heritage of America Band
ensemble, Vector, will present
a concert at 7 p.m. June 18 on
the Irvington Commons. The
band plays country and western, big band, Dixieland jazz,
show tunes and Top 40 hits.
The free concert is sponsored by the Irvington Village
Improvement Association.
■ Yard sale
Marine
Corps
League
Detachment 1062 will hold its
annual yard sale June 14 from 8
a.m. to 1 p.m. at Banes Northern Neck Upholstery Shop in
Callao. This is the sole major
fund-raiser for the detachment.
The detachment supports needy
individuals, scout organizations, injured Marines and their
families and Marines in Iraq. A
50/50 raffle also will be held.
To donate furniture, electronics, art objects, antiques or
books, bring them to the sale as
early as possible and they will
be included.
■ Showtime
The Westmoreland Players will present “The Importance of Being Earnest” June 6
through June 15 at The Players
Theatre at 16217 Richmond
Road near Callao.
Tickets are $15 for adults and
$10 for students. The show is
appropriate for all age groups.
Reservations are necessary.
Call 529-9345 for specific
dates, times and reservations.
■ Seed to stalk
Through June 30 at Jamestown Settlement and Yorktown
Victory Center, American agriculture of the 17th and 18th centuries will be examined through
comparison of Powhatan Indian
and European methods of planting and cultivating crops grown
for sustenance and for profit.
For
admission,
hours
and
directions,
contact
757-253-4838, 888-593-4682,
or historyisfun.org.
■ Ophelia parade
The annual Ophelia July 4
parade will be held at 7 p.m.
July 4. An indoor concert,
featuring a bluegrass band, an
organ duet and a patriotic hymn
sing will follow.
The parade will begin at
Cockrell’s Railway and end at
Afton Church. Call 453-3689
or 453-7245 to reserve a space.
All children under 16 must be
accompanied by an adult to participate in the parade. Refreshments will be available.
■ Shrimp feast
The Upper Lancaster Volunteer Fire Department Ladies
Auxiliary will hold an all-youcan-eat shrimp dinner June 28
from 5 to 8 p.m. at the ULVFD
pavilion in Lively. The meal
will be followed by a dance
with DJ Curtis Walker from 8
to 11 p.m.
Meal tickets ($25) will only
be available in advance. Dance
only tickets will be sold at the
■ Movie night
gate, beginning at 8 p.m. Meal
Northumberland
Public tickets are available from auxLibrary and Virginia Coop- iliary members.
erative Extension will offer
“Family Movie Night” Thurs- ■ Centenarian to speak
day, June 12, at 6 p.m. at the
The Middle Peninsula Afrilibrary in Heathsville. Family can-American
Genealogical
Movie Night is free. All are and Historical Society of Virwelcome.
ginia will meet Saturday, June
15, at 11 a.m. at the Essex
■ Auditions
County Public Library at 117
The Lancaster Players will North Church Lane in Tappapresent “Mary Poppins” on hannock.
August 27-30. Directors Robin
A special guest at this meetBlake and Mark Favazza are ing will be centenarian Meta
seeking boys, girls, men and Dishman of Newtown. Dishwomen of all ages for the parts man, who will celebrate her
available.
105th birthday June 16, will
Auditions will be held at share reflections with the
The Playhouse in White Stone group. For directions, call
on June 19 at 6:30 p.m. and on Gloria Waller at 758-3613.
June 21 at 10 a.m. No previous experience, appointment or ■ One-act uditions
The Lancaster Players will
audition preparation is necespresent three one-act plays in a
sary. Call Blake at 435-1005.
program titled “Three Women
and Friends” July 16, 17, 18 and
19. Director John Baumhardt is
seeking four females and one
male for the roles that range in
age from teens to sixties.
an envelope.
Auditions will be held at 7
Among upcoming trips, Hazel p.m. June 12 at The Playhouse
Ford has planned a motor coach in White Stone. No previous
trip to Wildwood, N.J., Septem- experience or audition prepaber 7 to 11 and a motor coach ration is necessary. If you have
trip to Wheeling, W. Va., Decem- questions, call Baumhardt at
ber 5 to 7.
436-9027.
There will be a Caribbean
cruise leaving Charleston, S.C., ■ Computer users
November 13 to 23.
The Northern Neck ComFord can be reached at puter Users Group will meet at
462-7895 regarding these trips. 9:30 a.m. June 21 at RappahanAnyone wishing to entertain nock Westminster-Canterbury
or speak to the group may con- on Lancaster Drive off Old
tact Jenny Parks at 462-7216.
Salem Road near Irvington.
All other inquiries should be
A beginner’s tutorial conaddressed to president Fannie ducted by Betty Lehman will
Clingan at 435-1713.
take place at about 11 a.m. following the meeting.
Seniors Club announces
June meeting in Lively
The Corrottoman Senior
Group will meet Tuesday, June
17, at the Ruritan Club near
Lively.
The guest speaker will be a
representative from the Northern
Neck Free Health Clinic.
Lois Kellum will bring a devotion and prayer.
Hostesses will be Virginia
Parks, Nancy Hundley and Ira
Garshwiler. Roland Courtney
will host.
Lunch will include hot dogs,
baked beans, chips, beverages
and desserts. The fee is $3,
including dues for June.
Bingo will be played, so bring
A7
■ Concerts
On Tuesdays in June, July and
August, Lewis Ginter Botanical Garden at 1800 Lakeside
Avenue in Richmond will offer
a Families at Five program
from 5 to 9 p.m. Family activities will be conducted in the
Children’s Garden where the
WaterPlay remains open until
8:30 p.m.
Children-friendly
boxed
lunches may be ordered in
advance at 262-9887, ext. 352.
Call for admission or directions, or visit www.lewisginter.
org.
Jamestown Settlement on
June 14 will host “Family
Day: Planting A Settlement.”
Through guided gallery tours,
a special children’s gallery brochure and a craft activity, learn
about the English, Powhatan
and west central African family
members’ roles in planting and
harvesting crops.
Pre-register at 888-868-7593,
757-253-4939, or group.reservations@jyf.virginia.gov.
Vacuum Cleaner
and
Lamp Repairs
Also a supply of accessories
Contact Northern Neck Office Equipment
804-435-1698
33 N . Main St. Kilmarnock
■ NAACP yard sale
Lancaster County NAACP
unit #7083 will have a yard/
bake sale June 21 from 8 a.m. to
3 p.m. on North Main Street in
Kilmarnock near G.C. Dawson
Real Estate.
Donations will be accepted.
Volunteers are needed. Call
Michael Logan at 462-5304,
Mary Crockett at 435-0582, or
Lewis Conway at 435-3099.
Yates House Community
Arts Center in Deltaville
recently
announced
the
“Groovin’ on the Green”
concerts from 6 to 8 p.m.
Upcoming shows are June
21, Clayton Neal and Gary
Archer; July 12, Flatt Out
Bluegrass; July 26, Bill and
Macon Gurley; August 16,
Joshua Walker; August 30,
Jumbo Lump Daddy and the
Backfin Boys.
Sunday concerts will be
held from 2 to 4 p.m. September 7, The Phun Doctors;
and September 14, Susan
Greenbaum.
Custom Decorating, Accessories and Gifts
18 S. Main St. • Kilmarnock, VA • 435-1783
■ Farmhouse Concert
Orrin Star will present
another Farmhouse Concert
June 21 at 8:30 p.m. at Mary
Beane’s residence in Miskimon. Star plays mandolin and
guitar and sings bluegrass and
folk music.
For directions and ticket
prices and availability, email
farmhouse-concerts@hotmail.
com.
Cool Cotton
for the
Hot Summer
■ Moonshining
Moonshining in the Blue
Ridge, an exhibit organized
by the Blue Ridge Institute of
Ferrum College, will be displayed at the Virginia Historical Society (VHS) at 428 North
Boulevard in Richmond through
September 22. It is believed to
be the largest exhibit on moonshining in the United States.
For directions, hours and
admission information, call
358-4901, or visit vahistorical.
org.
■ Heritage parade
On July 5 at 2 p.m., the
annual Deltaville Heritage Day
Parade will march and motor
through the village. The Shriners and fire and rescue units
will participate.
The DCA seeks additional
participants. Call Bob Walker
at 776-6461.
Distinctive Ladies Clothing, Jewelry & Accessories
Ó{Ê7°Ê
ÕÀVÊ-ÌÀiiÌÊÊUÊ{ÎxÓÓää
°q->Ì°Ê£äÈÊUÊ-Õ°Ê£Ó{
Petite
Missy
Plus
Lively’s Lilies
Wide Variety
Garden Open Now
for Viewing
Sales begin 9 am on Sat. 6/21
5381 Mary Ball Road in Lively
Or call for an appointment 804-435-2327
■ Ground water
Middlesex Forward will hold
a forum June 16 at 7:30 p.m. at
the DCA building in Deltaville.
The focus will be “Ground
Water Resources,” and the
speaker will be T. Scott Bruce
of the Virginia Department of
Environmental Quality.
■ License plates
A Northern Neck license
plate kick-off event will be held
Wednesday, June 18, from 5 to
7 p.m. at the Northern Neck
Land Conservancy headquarters at 8424 Mary Ball Road in
Lancaster.
Please rsvp: 462-0979 or
nnlc@kaballero.com.
■ Radio club
The monthly meeting of
the Rappahannock Amateur
Radio Association will be held
at the Mid-County Volunteer
Rescue Squad Building at
7990 Northumberland Highway in Heathsville Thursday,
June 12, at 7:30 p.m.
The program will be conducted by Ed Andrews
(K7JET) and will feature
planning for the club’s field
day activities. Persons interested in or involved in radio
communication are invited to
attend.
■ License plates
A Northern Neck license
plate kick-off event will be
held Wednesday, June 18,
from 5 to 7 p.m. at the Northern Neck Land Conservancy
headquarters at 8424 Mary
Ball Road in Lancaster.
Please rsvp: 462-0979 or
nnlc@kaballero.com.
Kilmarnock Toy Store
Register now through July
4th to win a Grill & Bake
Kitchen by Kid Kraft
Purchase $2500 worth of merchandise and
enter to win a Grill and Bake Kitchen. Drawing to take place on the 4th of July. Offer
only good with purchase of $2500
Behind the Turtle
on East Church Street
Kilmarnock Toy Store
PO Box 1479
Kilmarnock, VA 22482
Phone: 804.436.8697
Fax: 804.435.7800
They are my Bug Killers,
my Mr. Fix-Its, my Guidance
Counselors, my Navigators,
They are my Heroes . . .
■ Annual meeting
The annual meeting of the
River Counties Chapter of
the American Red Cross will
be held June 26 at the Chesapeake Operations Center
on School Street in Kilmarnock.
The public is invited and
encouraged to attend for a
short business meeting followed by refreshments and a
chance to meet the board of
directors. The meeting will
take place at 5:30 p.m.
■ Museum fling
The Morattico Waterfront Museum will hold its
“Spring fling” Saturday, June
21, at the museum pavilion,
beginning at 5 p.m. with The
Randy Davis Band. Tickets
are $20 for adults, $10 for
ages 6 to 12 and free for ages
5 and younger.
The menu will include fried
chicken, pork barbecue, cole
slaw, green beans, rolls, dessert, sodas and water. Beer
and wine will be available
for a small cost. Food will be
served at 6 p.m. For tickets,
call 462-9898.
my husband
my dad
my father-in-law
What does yours look like?
Honor your hero
with a gift that tells them
how much they mean to you.
.BJO4USFFUt,JMNBSOPDLt
.BJO4USFFUt(MPVDFTUFSt
A8 •
THE RECORD ONLINE
6 72 5 $ * (
Refresh & Rejuvenate In
Costa Rica
The Chesapeake Wind Quintet performs at Grace Episcopal
Church. Occidental El Tucano & Spa
5 Nights from $415*
Grace-ful Summer
Sounds continues
The Chespeake Wind Quintet
performed June 3 to an audience of 120 at Grace Episcopal
Church who brought chairs,
blankets and picnics.
The quintet of Katherine
Shrader, Jessica Guy-Haynie,
Donna Kelley, Michelle Lybarger and David Hershiser
played a variety of pieces,
spanning the period from G.F.
Handel (1685-1759) to Percy
Grainger (1882-1961).
Next in the series is The Billy
Williams Jazz Quartet who will
perform Wednesday, June 18, in
the lot adjacent to the church.
Folks may again bring picnics
to the concert grounds at 6 p.m.
The music begins at 7 p.m. and
will conclude at about 8 p.m.
The event is free and open
to the public. Ample parking is
available in the church parking
lot. In the event of rain, picnics
will be moved indoors to Grace
Sept & Oct 2008 Travel
Other travel dates available
In the lush rainforests of Costa Rica’s Central
Valley, the Occidental El Tucano and Spa easily
blends the ecologically diverse landscape with
state-of-the-art treatments in its thermal mineral
water and hot springs spa, one of the largest
in Latin America. Enjoy a relaxing soak in the
thermal spring water pool while observing exotic
birds and other wildlife in the trees above.
Justine McKnight
McKnight
to speak
The Richard Henry Lee Chapter of the Sons of the American
Revolution (SAR) will hold a luncheon meeting June 16 at Rappahannock Westminster-Canterbury
at 11:30 a.m.
The principal speaker will be
Justine McKnight who will discuss the archaeology of plants in
Virginia and Maryland, including
recent work at George Washington’s distillery, the port towns of
Londontowne and Annapolis and
several Civil War battlefields.
McKnight is an archeobotanical consultant with 16 years
experience performing paleoethnobotanical analysis, natural
setting surveys and historical
landscape assessments.
She has worked with many
public and private clients including the National Park Service
State Historical Trusts, county
and municipal agencies, private
foundations, universities and
public and private interpretive
projects.
McKnight’s experience studying Chesapeake historic sites
includes archeological research
at Mount Clare, Hancock’s Resolution, Paca House and Garden,
Mount Vernon, Historic Londontowne, Belaire Mansion, Mount
Calvert and domestic, farm,
battlefield and cemetery sites.
She lives near Annapolis with her
husband and two daughters.
Meetings of the SAR are open
to the public. Reservations are
required. Call Tony Waring at
438-5155.
U6WRUDJH
$OO:HDWKH
[WR[
QWUROOHG
&OLPDWH&R
\VWHP
6SULQNOHU6
H6\VWHP
6XUYHLOODQF
0ACKAGING
S
3OLUTÌÊUIOÊ*>NVÌÊq-«Ì
«
ÊÊÊÊÊÊÊ7À>
RXUW\DUG
RPPRQV& 3HHEOHV
&
H
N
D
H
S
D
V
WR
&KH
WUHHWQH[W
10DLQ6 RFN
UQ
.LOPD
D\+RXUV
1HZ6DWXUG 6DW

0RQ)UL
the perfect
Father’s
present . . .
the epitome
of theDay
knit shirt…
‘the crab shirt’
designed by khakis
mid-weight,
breathable, all
cotton pique.
Ask About American Express Vacations Plan-Ahead Services
The following activities can be pre-booked at no extra charge: Spa
treatments • Golf tee times • Dinner reservations • Private tours
formable lisle collar,
ribbed sleeves,
longer tail.
* Rates are per person, based on double occupancy in Superior room category, and includes roundtrip
hotel transfers, hotel accommodations, hotel tax and service charges. Advertised rate valid for travel
9/1/08-10/31/08. Restrictions may apply.
For more information or
reservations, call
seven colors for
men and women.
xs to xxx.
(804) 435-2666
only at khakis.
$49.50
Billy Williams
House and the concert will be
held in the church sanctuary.
The final concert June 25 will
feature the Symphonicity Four
String Quartet. Visit graceepiscopalkilmarnock.com.
khakis
clothing for men and women
Antiques to be evaluated
The Westmoreland County
Museum will host “Share
Your Treasures” June 29.
A panel of experts will assist
with identification and understanding of the object at hand.
Museum executive director Walt Heyer will review
the works. Heyer was former
project director of the construction of Jamestowne
and its archaearium for the
400th anniversary. He was
chief executive officer of the
Henricus Foundation and the
Museum of American Frontier Culture and has served
We can ship
anything.. .
Use ours!!
Booking fast, great location
Middle Peninsula area
Call 888-215-9195, ext. 114.
Well, almost...
Planning a Party and
Need a Building?
www.rrecord.com
as director of Jamestown
Settlement and the Yorktown
Visitors Center. He has an
impressive knowledge of
Virginia’s history and that of
early settlers from Western
Europe, and the material culture they brought with them.
Also on the panel will
be David Jett, curator of
both the Richmond County
Museum in Warsaw and the
Essex County Museum and
Historical Society. He is an
artist and shows regularly
at the Rappahannock Art
League Studio Gallery in
Kilmarnock. He also is an art
conservator.
To round out the panel, Lee
Langston Harrison, executive director of the Museum
of Culpeper History also is
included. Her prior experience includes being senior
curator of James Madison’s
Montpelier and curator/assistant director of James Monroe
Museum in Fredericksburg.
Having been in the museum
field for over 30 years, working as a curator has helped
hone her skills in identifying
American decorative arts,
with an emphasis on textiles
and household goods.
Hours will be noon to 5
p.m. There is a $5 per item
fee to go towards the building of the new Westmoreland
County Museum.
irvington 804.438.6779
port warwick 757.596.5000
irvington &
804.438.6779
www.khakicrab.com
www.sonofbritches.com
The Lancaster Players
Auditions for
“Mary Poppins”
9OU0ICK9OUR/WN3ALE
4HATS2IGHT$URINGTHEMONTHOF-AYYOUTHECUSTOMERCAN
That’s right! During the month of June you, the customer,
PICKYOUROWNSALE9OUCANCHOOSEFROMTHEFOLLOWINGLISTOF
can pick your own sale. You can choose from the
following OURBESTSALEEVENTSOFTHEPASTYEAR
list of our best sale events of the past year.
4WOPAIRSOFEYEGLASSESFOR
OFFOFALL$ESIGNER&RAMES
OFFALL3UNGLASSESINCLUDING2AY"AN
OFFALL4RANSITION,ENSESINCLUDINGTHENEWEST
TRANSITIONLENS$RIVEWARE
Old Dominion
Eye Care & Optical Center
101 Technology Park Drive
Kilmarnock • 435-0547
Valid on multiple pairs of eyeglasses. Both frame and lenses purchase required with this
promotion. $99 promotion is for single vision and lined bifocal lens only and regularly priced
frames from $49 to $69. This promotion can not be combined with any other offer, previous
purchase, or insurance plans. Offer expires June
May 30,
31,2008.
2007
June 19 - 6:30 p.m.
June 21 - 10:00 a.m.
The Playhouse in White Stone
Roles
Mary Poppins
Bert
Adult males & females
Boys & Girls
Performace dates - August 27-30
Directed by Robin Blake
and Mark Favazza
No previous experience, appointment or
audition prep needed
If you have questions, call Robin Blake
at 435-1005
YMCA ball seeks bidders
Entertain friends with
fabulous dinners and boat
parties, to be auctioned at
the Northern Neck Family
YMCA’s Ball in the Halls,
Olympian Odyssey June 28.
Festivities will begin at
5:30 p.m. with a cocktail
hour to preview the packages
available at the auction, followed by a Greek feast provided by Swank’s on Main
Catering and dancing to the
Big Band sound of KOS.
Auction items include
a progressive dinner for
12 presented by neighbors
Loretta and Bill Warren,
Barbara and Jim Wheatley,
and Alison and Bill Holman.
The event will be held at
“The Wharf ” at the end of
Black Stump Road in Weems
overlooking the Corrotoman
River.
A dine-at-home dinner
package donated by owner
John Tripodi is another
item, with Swank’s on Main
Catering providing a fourcourse dinner for 10, pre-
White Stone United Methodist
Women’s Thrift Shop
pared by Chef Matt Turner,
paired with wine for each
course.
Bruce Watson of the White
Stone Wine and Cheese, is
donating a wine dinner for
eight.
For those preferring a high
seas adventure, there is the
Chesapeake Breeze package,
donated by Doralina and
Linwood Bowis. The boat
party for 75 will depart from
Reedville for a “three hour
tour” of the Great Wicomico
River. The package comes
with a DJ and food provided
by local restaurants. There is something for the
fisherman in the family. A
fishing trip on the Chesapeake Bay aboard the Midnight Sun is available to the
highest bidder. Capt. Ryan
will host a party of six. Rods,
reels, bait and ice included. Proceeds
benefit
the
YMCA’s Guardian Program,
Tickets are $150 each. Call
Donna McGrath at 435-0223 Loretta Warren invites folks to join her for this view and a
for tickets.
meal as part of an auction package.
1/2 off Storewide This Week
Unless Otherwise Marked
Thursday, Friday, Saturday
10AM-3PM
Route 3, White Stone
804-435-0167
Just in time for
the Bride, the Dad
& the
shearing will be performed at
11 a.m., 1 and 3 p.m., weather
permitting. Children can help
preserve the memory of Washington’s agricultural legacy by
lending their hands in planting
this year’s tobacco crop.
Washington was born on his
parents’ Popes Creek tobacco
farm February 22, 1732. The
550-acre National Monument
contains the birth site, a complete commemorative plantation, a picnic area, nature trail,
the Washington family burial
grounds, a beach, many plants
and wildlife. It is on Popes
Creek off the Potomac River
11 miles west of Montross on
Route 204 off Route 3. It is
open daily from 9 a.m. to 5
p.m. Admission is $4 for visitors 16 years and older. Call
224-1732, or visit nps.gov/
gewa.
Grad
a wonderful selection of gifts for
her, him
Birthplace to re-create a 1732 spring day
Park Rangers and volunteers
in colonial period dress will
demonstrate colonial crafts,
farm chores and domestic
activities Saturday, June 14, as
George Washington Birthplace
celebrates its annual Spring on
the Plantation festival.
“George Washington was a
product of plantations. Plantation life taught him to use
resources wisely, and patience
and attention to detail. It also
taught him habits of command and civic responsibility.
These characteristics and his
integrity were the foundation
of his accomplishments. One
cannot understand Washington
without understanding plantation life,” said scholar Jack
Warren,
Interpreters will present
open-hearth cooking, blacksmithing and spinning. Sheep
A9
and for
them
Beautifully wrapped free of charge!
(All Gift items are 20% off through June 18th!)
THE DANDELION
Distinctive Ladies’ Clothing & Gifts
Irvington, Virginia
Hours: Monday thru Saturday 9:30 to 5:00 s
If the shoe fits! Buy it!
SPRING SHOE SALE
20-30% off selected styles
SOPHISTICATED
D
AD’S
GRAD ’S
Children can help plant tobacco at the plantation event.
Concert association offers subscriptions
The Rappahannock Concert Association has been
based in Richmond County
for the past 25 years.
The association promotes
performances of quality
music by all types of musicians. In addition to its efforts
to build and maintain a permanent concert audience, the
association also is committed
to encouraging the teaching
of music and music appreciation in the schools. To this
end, it has obtained grants for
artists to spend time working
with and performing for students.
Richmond County’s elementary school will again be
the primary venue for concerts for the 2008-09 season.
However, the performances
will move in 2009-10 to the
new Northumberland County
Guitarist Doyle Dykes
Middle / High School comopen September 12, with
plex.
The 2008-09 season will finger-picking guitarist Doyle
Dykes.
On October 26, Anita Burroughs-Price, harpist, and
Brian Reagin, violinist, will
present a varied program of
classical and folk melodies,
1 Hr. Facials - $50.00
Broadway tunes and hymns.
On January 9, the Pianafid1/2 Hr. Mini Facials - $30.00
dle duo will offer toe-tapping
renditions of every kind of
Niki Henderson, Windmill Point
By Appt. 804-339-2633 music.
Certified & Licensed Esthetician
Clipper Erickson offers a
,>E:Q>*:FI>K>=
Community Issues
Forum
TUESDAY, JUNE 17
7:00-8:30 PM
LOCATION: NORTHERN NECK FAMILY YMCA
YOU ARE INVITED TO COME SHARE YOUR CONCERNS
AND EXPRESS THE ISSUES YOU FEEL ARE
OF THE UTMOST IMPORTANCE FOR THE
FUTURE OF OUR COMMUNITY
LIGHT REFRESHMENTS WILL BE SERVED
&
night of piano music March
13, with a tour of 200 years of
American composers.
On April 25, drummer Brooks Tegler and his
14-piece orchestra will recreate the historic and electrifying 1938 Benny Goodman
Carnegie Hall concert, which
featured Goodman on clarinet
and Gene Krupa on drums.
All concerts will begin at
7:30 p.m. The fee is $60, or
$10 for students A season subscription includes free admission to five performances
sponsored by Concerts by the
Bay in Mathews. Individual
concert tickets and group
tickets also are available.
Learn more about the association at rappahannockconcerts.org, or call 493-9522.
Gifts
Watches
Diamond Earrings
Signet Rings
Engravable Items
I.D. Bracelets
Pewter Ware
Pearls
Clocks & Tide Clocks
Lockets
Picture Frames
Gold & Silver Jewelry
and of course. . . Gift Certificates
Ross’s Rings and Things, Ltd.
)RVINGTON2Ds+ILMARNOCKs
-ONDAY&RIDAYs3ATURDAY
one
day
only
:f]XUm >ibY%'h\
$&
FgbcUlbheaXj
GTccT[TaabV^
?bVTg\ba
BYYFgbeXj\WX
@bag[fbYAb<agXeXfg
;bhef+T` ,c`
YTf
Fb
Y
Y
B
&
$
$&
PLEASE CALL TO RSVP OR IF YOU HAVE ANY
QUESTIONS
CONTACTS: DONNA MCGRATH OR REBECCA MILLER
PHONE: 804.435.0223
EMAIL: RMILLER@PENINSULAYMCA.ORG
ef
\aX
_
V
X
E
BYY
Starting at
$313
4__?:GIf$&BYY
7baºg9beZXg7TW
Twin set
$173
Queen set $263
King set
$513
50” Plasma HDTV $1513
$&BYYF\``baf
FlÙb_5XWW\aZ
@=DG7CA69
4562 Richmond Road
Warsaw
804.333.5599
Furniture
TV & Appliance
1644 Tappahannock Blvd
Tappahannock
804.443.5090
*With approved credit purchase $999. See store for details.
2 N. Main Street
Kilmarnock
804.435.1900
A10
Sports
Luray smokes Red Devils
in state quarterfinals, 17-4
by Lisa Hinton-Valdrighi
Lancaster’s varsity baseball squad spent its last three
weeks travelling, and the
road-wear started to show
early in last Tuesday’s Group
A quarterfinal.
Luray scored five runs in its
first at-bat and went on to beat
the Devils, 17-4, and end the
season for Lancaster.
It was the Devils’ second
appearance in the state tournament in two years. They
made it to the semifinal last
year after winning both the
Northern Neck District and
Region A tournament. Lancaster finished as the district
and regional tournament runner-up this year after losing
both to Essex. The Trojans and
Devils had tied for the regular
season title with identical 6-2
Northern Neck records.
“We told this group [after
the Luray game], they’re
probably the most successful
baseball team in school history,” said LHS coach Welby
Saunders. “They’ve won the
district championship, the
region championship and
they’ve been to the state tournament two years in a row, so
they have a lot to be proud
of.
“What they’ve done is earn
the right to be mentioned in
the same category as teams
like Essex and Rappahannock, teams that have dominated the region for years,”
added Saunders. “Now we’re
mentioned right along with
them as one of the top teams
in Region A, which is a goal
for the next group of kids to
try to continue.”
Lancaster (17-8 for the
season) got to the state tournament by way of wins over
Windsor and Arcadia in the
regional tournament. The
Devils were forced to play
their first Group A game on
the road after losing in the
Region A final to Essex.
“In a seven-day period, we
drove over 1,200 miles to play
four games and it seems like
we hit a wall,” said Saunders.
“I’m not making excuses, but
if you’re going to be one of
the top eight teams, you have
to be at the top of your game
and we weren’t.”
Lancaster went through
three pitchers against Luray
with ace Jonathan Somers
getting the start. Somers, who
was named to the all-region
first team as pitcher with a
7-2 record, 1.06 ERA and 94
strikeouts in the regular season,
put in two innings of work
Eight-run rally
lifts J.J. Kelly
over Essex in
state final, 14-9
J.J. Kelly High School
(24-4) scored eight runs
in one inning early Saturday morning to beat Essex,
14-9, in the Group A state
championship game at
Radford.
The Trojans had beaten
James River, 13-1, in the
state semifinals on Friday
and got by Strasburg, 5-1,
in the quarterfinals. J.J.
Kelly had wins over Glenvar and Luray to reach the
title game.
En route to the state tournament, Essex (22-4) won
both the Northern Neck
District and Region A tournament championships.
The Trojans were leading Kelly, 9-5, after four
innings, but committed
eight errors in Saturday’s
championship game.
before Luke Saunders took the
mound. Saunders pitched one
and two-third innings and Ryan
Reynolds went two and a third
innings to close.
L. Saunders, as shortstop,
and Adam Benson, as third
baseman, were both named to
the all-region second team.
L. Saunders hit a solo homer
in last week’s state game. The
sixth inning shot came too late
for LHS to overcome an early
deficit.
Luray batted around to score
five runs in the first inning and
another four in the second.
Already down 5-0, Lancaster
rallied for two runs in the top of
the second when Somers hit a
no-out, two-run homer to score
Chris Buzzell. Ryan Reynolds
drew a walk and Lee Kuykendall hit a single to put runners on
first and second with no outs,
but Luray then turned a double
play.
The Devils scored one more
in the top of the seventh after
Seth Christman and Nat Coleman drew walks and Adam
Benson doubled to drive in
Christman.
Luray (26-2) was led at the
plate by Jeremy Leak, who
went 3-for-5 with a home run
and four RBI, and Ryan Carroll, who batted 2-for-3 with a
homer and four RBI.
Coaches Saunders and Scotty
George will lose eight seniors
from this year’s team, including seven starters. They are
Somers, L. Saunders, Reynolds, Benson, Kuykendall,
Christman, Jack Jackson and
Matthew Smith.
“These seniors have a 36-13
two-year record, which is quite
an accomplishment,” said
Saunders. “It was a tough year
because our one goal was to
win the state tournament and
that goal didn’t leave a lot of
room for error.”
Gretna wins softball title
Gretna defeated Glenvar,
2-0, to win the State Group
A Softball Championship
game at Radford University’s
Dedmon Center Field last Saturday.
Gretna (20-4) eliminated
Middlesex, 5-4, in the state
quarterfinals June 3 by scoring
four runs in the bottom of the
seventh inning.
Glenvar (21-6) defeated
Mathews, 8-3, Friday in a
semifinal game at Radford.
It was the first state softball championship for Gretna,
which was making its first
championship game appearance since 1981.
Glenvar, of Salem, was the
Region C runner-up this season
and the 2007 State Group A
runner-up.
Chesapeake Academy holds awards banquet
Chesapeake Academy athletes were honored at an awards
banquet last Friday. Students
were recognized for excellence
on the playing field and in the
classroom for participation in
soccer, golf, basketball, track
and tennis.
Coach Cynthia Walker
presented plaques for most
valuable player (MVP); most
improved
player
(MIP);
coaches award (CA) and
scholar athlete (SA).
SA awards were presented
to Lexi Hayden and Teddy
Szyperski. The SA award is
given to a male and a female
athlete who have shown great
leadership in the classroom
and on the court and field.
SAs must maintain Honor Roll
or Head of School List status
while playing at least two varsity sports.
Fall sports
• JV soccer: MVP, Brent
Altaffer; MIP, Lauren James;
and CA, Max Massaro.
• Varsity soccer: MVP, (tie)
Sam Somers and Zachary
Kahler; MIP, Carter Clark; and
CA, Nathan Altaffer.
• Girls golf: MVP, Lexi
Hayden; MIP, Emily Moore;
and CA, Andi Mayer.
• Boys golf: MVP, Jonathan
Keilhauer; MIP, Cyrus Jett;
and CA, Somers.
Winter sports
• JV girls basketball: MVP,
Anna Moore; MIP, Madison
Scott; and CA, Jen Radcliffe.
• JV boys basketball: MVP,
Jonathan Keilhauer; MIP,
Graham Shivers; and CA,
Brent Altaffer.
• Varsity girls basketball:
MVP, Lexi Hayden; MIP,
THE RECORD ONLINE
Spring sports
• Varsity soccer: MVP,
Nathan Altaffer; MIP, Ricky
Callis; and CA, (tie) Griffin
Campbell and Will Perkins.
• Boys track: MVP, Nathan
Altaffer; MIP, Nick Neal; and
CA, Colton Hayden.
• Girls track: MVP, Andi
Mayer; MIP, Jen Radcliffe;
and CA, Nikki Stump.
• Boys tennis: MVP, Jonathan Keilhauer; MIP, David
Treakle; and CA, Teddy
Szyperski.
• Girls tennis: MVP, Emily
Moore; MIP, Haley Dull, and
CA, Madison Scott.
www.rrecord.com
RAPPAHANNOCK
Fri
Liz Rogers; and CA, Emily
Szyperski.
• Varsity boys basketball:
MVP, Nathan Altaffer; MIP,
Max Massaro; and CA, Teddy
Szyperski.
ALMANAC
White Stone/Grey’s Point Tides, Sun, & Moon – June, 2008
2:13 Low 2:46 0.2’
4:26 Low
6/13 Moonset
Tue 6/17 Moonset
Sunrise
5:43 High 8:26 1.2’
Sunrise
5:44 High
^ 6/13^
k
Sat
6/14
Sun
6/15
l
m
Mon 6/16
n
^ 6/13^
Moonrise
Sunset
4:10
8:28
Moonset
Sunrise
Moonrise
Sunset
^ 6/15^
^ 6/17^
o
Low
High
2:42
8:57
0.2’
1.5’
2:40
5:44
5:10
8:29
Low
High
Low
High
^ 6/15^
3:39
9:17
3:29
9:45
0.2’
1.2’
0.2’
1.5’
Wed 6/18
Moonset
Sunrise
Moonrise
Sunset
^ 6/16^
3:10
5:44
6:11
8:29
Low 4:28
High 10:04
Low 4:15
High 10:30
^ 6/16^
0.2’
1.2’
0.2’
1.6’
Thu
Moonset
Sunrise
Moonrise
Sunset
3:45
5:44
7:10
8:29
Low 5:13
High 10:48
Low 5:00
High 11:13
0.2’
1.2’
0.1’
1.6’
Fri
^ 6/14^
Corrections
Piankatank River, Cherry Pt.
Great Wicomico River Light
Smith Point Light
High
-1:42
0:30
1:01
^ 6/14^
Low Height
-1:44
86%
0:20
76%
0:44
86%
4HE2ECORD/NLINE
3ERVINGTHE.ORTHERN.ECK
WWWRRECORDCOM
9OURONLINEAVENUEFORLOCALNEWS
Full - 1:30
O
6/19
p
6/20
Solstice 8:00
q
^ 6/17^
5:56
11:30
8:06 Low 5:43
8:30 ^ 6/18^
High 11:54
0.2’
1.2’
0.1’
1.6’
Moonset
Sunrise
Sunset
Moonrise
^ 6/19^
5:14
5:44
8:30
8:56
0.1’
1.2’
0.1’
Sunrise
Moonset
Sunset
Moonrise
^ 6/20^
5:44
6:09
8:30
9:41
Moonrise
Sunset
^ 6/18^
Sunrise
5:44
Moonset
7:08
Sunset
8:30
Moonrise 10:19
Low 6:37
High 12:10
Low 6:24
^ 6/19^
High 12:34
Low 7:16
High 12:50
Low 7:05
^ 6/20^
High
Low
High
Low
1:12
7:54
1:28
7:44
1.6’
0.1’
1.3’
0.1’
1.6’
0.1’
1.3’
0.2’
PM times are in boldface type.
Unusually high & low tides are also in boldface.
© Panbo 2008 (tides@panbo.com)
Visit us at: www.chesapeakeboatbasin.com
Toll Free 877-482-4287- Local 804-435-3110
1686 Waverly Ave. Kilmarnock, VA
Jeremy Lux of White Stone practices his jumps for a BMX freestyle competition.
Teen cycles airborne
by Lisa Hinton-Valdrighi
Jeremy Lux is extreme.
It’s not necessarily how the rising Lancaster High School senior lives his life, but
it’s how he rides.
Whether he’s catching air or simply trail
riding, Lux is the happiest when he’s practicing the sport of BMX, or bicycle motocross.
For those who don’t know, BMX is a form
of cycling on specially designed bicycles
which usually have 16- to 24-inch wheels
and includes racing on earthen tracks (BMX
racing) as well as the performance of tricks
(freestyle).
Like most sports, BMX has its own lingo
and slang, so expressions such as X-up,
superman, bunny hop and gnarly dude are
likely part of Lux’s conversation while hanging out with riding buddies.
He started riding BMX when he was only
9 and got totally hooked after his father,
Kevin Lux, took him to the XGames in
Philadelphia and Los Angeles when he was
10 and 11 years old.
After eight years of practicing and playing
at the sport, the 17-year-old White Stone
resident entered his first BMX freestyle
competition May 25 in Hackettstown, N.J.
Entered in the expert class, Lux finished
12th out of a field of 21 freestylers. Most
of his competition hailed from New Jersey,
Pennsylvania, New York and Massachusetts.
Lux leaves Saturday, June 14, for a twoweek BMX camp in Woodward, Pa. This
will be his third year at the camp, which
includes training sessions and visits by several BMX pros. His prized possession is a
framed, autographed picture of BMX legend
Dave Mirra, who Lux calls his role model.
Lux, who plans to compete in the AmJam
at Woodward in September, travels to Virginia Beach’s Mt. Trashmore every week-
end to train. His dad, who’s also his coach,
trainer and manager, takes him.
“He’s really supportive,” said Lux. “He
does a lot. I owe him more credit than I give
him.” The same, he says, goes for his mom,
Kim Lux.
Watching their son fly high into the air,
wearing nothing but a helmet as safety
equipment, can’t be easy on a parent. In
fact, BMX can be a dangerous sport. Luckily, said Lux, he’s only sprained his ankle a
few times, suffered a minor concussion and
scraped his face.
BMX first appeared during the early
1970s in California when teenagers started
imitating motocross racers on their bicycles,
which were usually standard road bikes. By
1977, the American Bicycle Association
(ABA) was organized as a national sanctioning body for the growing sport. Today,
professional BMX riders can make millions
based on competition earnings and sponsorships.
“I’d like to get into pro competition or
have some type of sponsorship,” said Lux,
who is an honor roll student and brown
belt in karate. If that doesn’t pan out, after
college, he’d like to open a business that
involves engineering bikes.
But for now, or at least for the summer,
he’s planning to keep doing his tricks at the
amateur competition level.
Judged on skill and use of the park,
Lux was told that he’d be freestyling with
three other riders during his competition at
Hackettstown last month. He found out just
before his ride that it would be a one-person,
one-minute run.
“One minute is a long time to be out there
by yourself,” he said. “It feels like forever
when you’re out there and everybody’s
watching you.”
4HE&ISHING,INE
by Capt. Billy Pipkin
Last week concluded with
both good fishing and torrid
weather. With the sun cooking
us relentlessly through midweek, we are now celebrating
temperatures dropping to the
mere 80s.
This week will be exciting
as anglers from throughout
the region will come together
in Reedville to compete in the
annual Reedville BluefishRockfish Derby. This tournament offers an opportunity
for anglers to compete for the
largest specimen in three categories: rockfish, bluefish and
croaker. The two-day tourney
runs this weekend and benefits
the Smith Point Sea Rescue, a
volunteer organization dedicated to assisting boaters in
the area.
Rockfish
have
been very abundant
this week with fish
averaging around 20
inches in length. For
the patient angler who
practices careful catch
and release, samples
up to 28 inches and
greater are attainable.
Larger specimens, although
sparse, continue to roam along
the channel edges and are
available to anglers trolling.
The key is to find schools of
menhaden that are migrating
along the channel and you will
find their predators nearby.
The cooler water temperature
this year raises the odds of a
tournament-winning rockfish
being landed while trolling.
Please remember to respect
other anglers and use good
etiquette, particularly during a
busy tournament weekend. Do
not anchor or pass behind a
boat that is chumming within
150 feet of that boat. The chum
line, which attracts fish to the
boat, draws from that distance
away. When trolling, you
should allow an even greater
distance to avoid the possibility of running over another
angler’s lines, which may be
as far back as 300 feet.
Bluefish have been picking up nicely as the migration continues to go well. The
smaller taylor-size blues have
made a strong showing in the
chum lines over the past two
weeks; yet, to my knowledge
there haven’t been any sizable
fish landed in the middle bay.
There have been some 6- to
10-pound fish caught in commercial nets on the lower bay
this week and a few stray 3- to
5-pound fish caught between
Reedville and the lower Potomac River. It will be interesting to see what is landed this
weekend with such heavy fishing efforts.
Croaker fishing remains
very good during the evening
hours with 12- to 14-inch fish
aggressively feeding at and
after sunset. Daytime hours
find these fish in 50 to 60 feet
of water along the channel
edges from the Cut Channel
up to Smith Point. On the eastern side of the bay, anglers are
having good luck in the Silver
Beach area. Up the Rappahannock River there are abundant
numbers of large croaker from
the power lines down to Belle
Isle State Park.
Speckled trout action has
been hot during the past two
weeks with the majority being
landed in the Mobjack Bay
and Piankatank River areas.
The largest this week was a
7-pound 13-ounce speck measuring over 28 inches, landed
by Chris Newsome of Gloucester.
Live offerings such as a bull
minnow, tiny bunker or other
similarly sized fish will
surely produce the largest specimens.
Spade fishing has
come alive with a few
large specimens coming
off of the Cell and Wolftrap areas. Chumming
with clam is the ticket
to success. Crowds have
been known to exceed
12 boats at Wolftrap Light on
the weekends, so be prepared
to share the fish booty.
Have fun fishing this week
and if you are competing in
the tournament, I wish you
good luck.
“Lord, suffer me to catch a
fish so large that even I in talking of it afterward shall have
no need to lie.” Suggested
motto: Herbert Hoover’s fishing lodge.
Until next week…Fair
winds.
Junior Rangers
program offers
three workshops
Road trip
Approximately 30 players, coaches and parents from the
Lancaster and Northumberland girls Little League softball
teams traveled to Hampton June 8 for the Virginia Classic
Softball Tournament Championship game. The peninsula All
Star men’s fast pitch team beat Keatings of Wilkesboro, Pa.,
11 to 10. The girls above were among those making the road
trip.
Park friends group
holds annual picnic
Members of the Friends of
Belle Isle State Park held their
annual picnic on June 8 at the
park’s new visitor center. Members enjoyed a meal of fried
chicken and a large assortment
of desserts.
Mick Micklem entertained
the group with his keyboard
and his repertoire of songs
including hits by Ray Stevens.
Another highlight was the
unveiling of The Schooner
Belle Isle IV built by Mike
Lambert. The schooner will be
raffled at the Seafood Festival
in September. Tickets are $5
each, or 6 for $25, and can be
purchased at the Music By The
River concerts and by calling
the park office at 462-5030,
or John Pierce at 462-7055.
Belle Isle State Park still
has openings in three Junior
Ranger programs, according
to chief of interpretation and
education Charlene Talcott.
Tree-mendous Times is all
about trees and held in partnership with the Virginia Department of Forestry. Participants
who attend all three days will
become Junior Rangers and
Junior Foresters.
Participants will learn about
trees, the animals and birds
that depend on them, and how
to be safe in the woods, said
Talcott. Recommended ages
are 5 to 8, but others may
attend. Dates are June 23 to
25 from 9 a.m. to noon.
Arts in the Park urges children to use nature as an inspiration for crafts, writing, music
and other creative endeavors,
said Talcott. This program is
held in partnership with Vir-
ginia Cooperative Extension
4-H program. Recommended
ages are 9 to 12, but others
may attend. Dates are July 7
to 10 from 9 a.m. to noon.
New World Explorers will
learn about John Smith’s
explorations of the Rappahannock River and the people he
met, said Talcott.
Participants will create
crafts similar to the ones used
by the native Rappahannock
and Moroughtacand people
who lived in the Northern
Neck, she said.
Recommended ages are 9 to 12, but
others may attend. Dates are
July 21 to 23 from 9 a.m. to
noon.
The fee is $5 per day, and
each child who attends all
three days will receive a patch.
Pre-registration is required;
call Belle Isle State Park at
566-4030.
Bike, truck and car
show winners listed
Mick Micklem
Proceeds will support Friends
activities of the park.
The third annual Northern gram. Over the past three
To join the Friends of Belle
Isle State Park, call Susie Neck Boat, Bike, Truck and years, this event has raised
Car show was held last Sat- over $12,000.
Pierce at 462-7055.
urday at Naylor’s Beach near
Show winners included:
Warsaw. Hundreds mingled
• Bikes, Domestic/Open
at the campground enjoying Division: first, Dave Elliott
the muscle, the chrome and of Warsaw; second, David
and tractor classes will be excitement of the local and Weedon of Warsaw; and third,
intermingled. Tractor classes statewide toys.
Jimmy Nash of Montross.
will include 6500-pound farm
“The show was a big hit, Harley-Davidson
Division:
stock, 7,000-pound modi- drawing participants from first, Bill Knight of Warsaw;
fied turbo, 6,000-pound non Fredericksburg,
Richmond second, Robert Vaughn of
turbo, 7,500-pound light lim- and the tidewater area. It was Ruther Glenn; and third, Bob
ited; 8,000-pound open and great to offer a truck and car Harris of Farnham. Foreign
11,000-pound pro farm.
show this year. That addition division: first, Dana Noel of
Trucks will run in several really added to the enthusiasm Burgess; second, Wayne Eastclasses including a 6,300-pound of the day,” said organizer wood of Chester; and third,
modified street; 6,400-pound Philip Belfield.
Ricky Brooks or Dunnsville.
pro street; and open class for
Whelan’s Marina, Mid• People’s Choice Award:
wreckers, dump trucks and Atlantic Marine, Jett’s Marine, Jimmy Nash of Montross.
other trucks. Mechanical road Garrett’s Marina, James River
• Best In Show - Bikes:
tractor and electronic road trac- Marine and Rugged Marine Nash.
tor and super stock semi class participated.
• Best In Show – Trucks:
also will run.
The show was created three Kevin Harrison.
Gas and diesel street pick- years ago to help raise funds
• Best In Show – Cars: M.C.
ups must have a 3-inch ring or for the YMCA Guardian Pro- Warren.
clevis to pull in this class.
Classes will be added or
changed as necessary. For
those who want to take part in
the pulling, registration will
begin at noon and you must be
registered by 2 p.m. Hitch fees
will vary.
ÜÜÜ°,,iVÀ`°V
Major truck and tractor pull set
Down on the track a tractor
rumbles to life. Another belches
black smoke in response to the
challenge. It’s time for The
Spring Thing, an Interstate
Truck and Tractor Pullers sanctioned event, sponsored each
year by the Rockville-Centerville Steam and Gas Historical
Association.
The Spring Thing is scheduled for June 14. The rain date
is June 15. Gates will open at
noon and the action starts at
2 p.m. Admission is $10 for
adults; free for children ages
12 and younger.
Tickets are available at
fielddayofthepast.net or at the
gate. Food is available on the
grounds and parking is free. No
alcoholic beverages are permitted. The Spring Thing will take
place on the Field Day of the
Past show grounds off Interstate I-64, Exit #173 in Goochland County. For directions,
call 741-8468.
Tractors and trucks will
compete in 14 classes. Truck
A Great Source
for local sports
ReArrangements
Room makeovers.
Your things.
Your space.
A11
Irvington Office
Post Office Box 733
Irvington, Virginia 22480
Richmond Office
505 North Boulevard
Number 13
Richmond, Virginia 23220
ANN CARPENTER
Cell 804.436.3169
Greenpoint
Nursery
‘an eclectic collection for
aesthetic reflection’
462-0220
-ARY"ALL2Ds2OUTEs,IVELY
email: greenpoint@isp.com fax: 462-5518
BOOTH’S
LANDSCAPING CO.
LAWN & GARDEN WORLD
25% off all
Trees & Shrubs
Check Out
Scratch-n-Dent up to 90%off!
4OTALLANDSCAPEINSTALLATIONANDMAINTENANCEAVAILABLE
7ESELLANDINSTALLmAGPOLES)NSTALLATIONOFBLOCK
RETAININGWALLSAREOURSPECIALITY
7EALSOINSTALLSIDEWALKANDPATIOPAVERS
★CELEBRITY FENCE★
6ISITTHEDISPLAYAREAATOUR'ARDEN#ENTERTOSEETHE
LARGESTSELECTIONOFFENCINGINTHEAREA
★7OOD&ENCINGOFALLTYPES
★6INYLRAILPICKETANDPRIVACYFENCES
★/RNAMENTALALUMINUMFENCING
'IFTCERTIlCATESAVAILABLE
/PEN-ON3ATss
.-AIN3T+ILMARNOCK
0LENTYOFPARKINGON"RENT3TREETANDINTHEREAR
Cadillac Cup set
for September 14
The Commonwealth Polo
and Carriage Club will present
the 23rd annual Cadillac Cup
Polo Match September 14 at
South Ceres Farm in Goochland
County. The Commonwealth
Polo team will again face the
British Foundation Forces Polo
team for a rousing and competitive match. Graciously hosted
by Jeni and Bill DeRusha,
owners of South Ceres Farm,
the Cadillac Cup is chaired by
Angela Abassi, Dennis Pryor
and Wayne Dementi. Moore
Cadillac serves as the signature
sponsor.
Gates open at 11 a.m. The
match will begin at 2 p.m.
Entry is $25 in advance or $30
at the gate. Information about
tickets, sponsorships, tailgates,
program ads or vendor spaces
is available at 556-6565, or by
visiting www.cadillaccup.com.
What
goes up
must come
down.
"RIDGE
2ESULTS
Seven tables of bridge were
in play June 4 at Rappahannock
Westminster-Canterbury.
Winners north/south were
first, Mary Andrews and Carolyn Reed; second, Arden
Durham and Ginger Klapp;
and third, Babs Murphy and
Beverly Oren.
Winners east/west were first,
Helen Blackwell and Helen
Kinne; second, (tie) Margaret
Livesay and Charlie Miller, and
Reta Stover and Jane Tims.
The next bridge for this
group is July 2 at 1 p.m.
Bridge was in play June 5 at
Indian Creek Yacht and Country Club.
Winners north/south were
first, Arden Durham and Virginia Adair; second,
Nan and Bill Summers; and
third , Ilva Doggett and Carolyn Reed.
Winners east/west were first,
Cynthia Birdsall and Ronnie
Gerster; second,
Suzi Winters and Marilyn
Burkholder; and third, Helen
Kinne and Joy Straughan.
Save $25 to $2000 on HunterDouglas window fashions.
Place your order for window fashions from HunterDouglas by August 30 and save
$25 to $200 per window on stylish, energy-saving window fashions. Shutters. Sheers.
Shades. Free measuring and installation. Offer limited to 10 windows per customer.
4445 Richmond Road Warsaw, Virginia 22572 (804)333-3210 www.nunnallys.com
08-NUN-280.hdsalesad_rr-6-3.indd 1
6/5/08 10:53:50 AM
A12 •
49 attend sailing camps
The Indian Creek Yacht
and Country Club sailing
camps finished their 13th
year in summer 2007 with 49
sailors attending 10, weeklong sailing camps, including three beginning classes,
four intermediate classes,
one keel boat class and two
racing classes.
The sailors ranged in age
from 7 to 15. Totals for the
summer were 26 beginners,
10 intermediate sailors, 4
keel boat sailors and 9 racing
sailors, with several students
increasing their skills by
taking more than one class.
The club’s junior sailing
program, certified by US
Sailing, provided each sailor
with 30 hours of instruction during the week, rain or
shine. Training was provided
by instructors Bill Johnson of
Laurel Point, who has been the
head instructor since the program began and Matt Guthrie
of Weems, in his seventh year
as an instructor. The other
certified instructors included
Michelle Burch, Peter Raine,
Justin Guthrie, Tyler Grogan
and assistant Beatrice Bronner.
In the beginner classes, the
sailors learned to sail using
International Optimist Dinghies, 420s and Lasers.
New to the schedule this
year was a Young Beginner
with Parent sailing class,
which was offered to sailors as young as age 7. This
class was very successful,
so successful that the parents wanted to learn to sail
as well, said director Anne
Reisner.
The intermediate sailing classes, for sailors who
had completed at least one
previous sailing class, also
used the Optimists, 420s
and Lasers. They learned
numerous racing skills to
include starts, racing tactics
and advanced boat handling,
said Reisner. Additionally,
the sailors using the 420s got
experience using the trapeze
and spinnakers.
The racing sailing classes,
for sailors who had completed
at least two previous sailing
classes, used the Optimists,
420s and Lasers to learn the
disciplines of tactics, rules,
timing, and to master basic
and advanced racing sailing
skills, she said.
ICYCC hosted a regatta
on August 10 at the end of
the racing/intermediate sailing class week. Numerous
yacht club members donated
their time, energy, skills and
even their boats and cooking
skills to make the regatta and
cook-out lunch a well-run
and much enjoyed event, said
Reisner.
In addition to camp tee
shirts made by Bay Window,
each sailor received a US
Sailing certificate and completion card, a certification
record book documenting
their accomplishments, a
picture of their class and
individual sailing pictures of
themselves at the helm. Box
lunches were provided by the
club each day.
All the sailors were children and/or grandchildren of
club members and came from
all over the United States as
well as Canada, Italy and
Switzerland.
Club members interested
in this summer’s sailing camp
schedule can visit icycc.com,
or call Reisner at 580-8114 .
TYDAMAR
Sail 1, intermediate campers from left are Matt Guthrie,
Chris Piller, Melanie Piller, Graham Shivers and Bill Johnson.
U.S. Coast Guard Auxiliary
Flotilla 62 in Deltaville will hold
a “Free Life Jacket Exchange”
from 9 a.m. to 2 p.m. July 5 at
the Heritage Day celebration
in Deltaville. The flotilla will
exchange a child’s worn out or
outgrown life jacket. Bring the
child and unusable life jacket
to the USCG Auxiliary booth.
Life jackets also will be
exchanged July 10 at 4 p.m. at
the Camp Rescue Program at
the Deltaville Rescue Squad
building on General Puller
Highway in Deltaville. The
child must be present to receive
an exchange life jacket.
Light Snacks, Ice & Mixers Provided - B.Y.O.B (bring your own bottle)
Min. 4 people / Max. 6 people
$240 for Tydamar / $500 for Earth Angel
Call by 3pm for Reservations - 804.438-5510
Sail 3, intermediate campers from left are (front row) Charlie Holman, Clark Ross and Justin Pierce; (next row) Bryson
Holman, Matt Guthrie, Justin Guthrie and Bill Johnson.
Summer is finally here and the warm, humid
days call us out on the water to relax and
enjoy this fabulous time of the year. A safe
boating experience is the goal of all enthusiasts.
Check that your VHF, flares, fire extinguisher
and life vests are easily accessible and in good
repair. Always let someone know your float
plan and keep your cell phone handy.
Sail 5, beginning campers from left are (front row) Gabriel
Aaron, India Kmetyk, Harper Jensen, Karen Mumma, Chris
Way, Kai Jensen and Teddy Sherer; (next row) Matt Guthrie, Elizabeth Norman, Michelle Burch, Peter Raine, Tyler
Grogan, Justin Guthrie and Bill Johnson.
Stormy Pearson-Dock Master
I invite you to The Marinas at the Tides Inn for a memorable getaway. Stay for several days to experience all we have to offer. From a relaxing day at the pool, a spa
treatment or a round on our complimentary Par 3 course. Dining venues range from
elegant to casual-set your own rules. Take a short trip to our marina and save on that
expensive fuel bill. Stay two nights and receive ½ off the third night’s dockage rate if
you mention this ad. Give us a call at 804.438.4418 and we’ll take care of your needs.
Marina Hours: 8:00am to 6:00pm
Fuel Dock Hours 8:00am to 5:00pm
480 King Carter Drive Irvington, VA 22480
www.tidesinn.com
Sail 7, keel boat campers from left are (front row) Buck Kirtland, Scott Heller, Grayson Kirtland and Nick Heller; (next
row) Justin Guthrie and Matt Guthrie.
Northern Neck State Bank
to Hold a
Historical Story Contest for
100th Anniversary
NORTHERN NECK
Sail 2, beginning campers from left are (ront row) Grant
Jewell, Devin MacKintosh Liner, Darden Purrington, William Clarke, Catherine Lamb, Hunter Brady, Samuel Tobio
and JJ Greene; (next row) Matt Guthrie, Tyler Grogan, Peter
Raine, Justin Guthrie and Bill Johnson.
Sail 4, racing campers from left are Bill Johnson, Paul M.
Connor, Virginia Margaret Connor, Ronnie Calkins, Wyatt
Henke, Matthew Keane, Matt Guthrie and Justin Guthrie.
STATE BANK
Serving the Community Since 1909
Throughout 2008, Northern Neck State Bank will be preparing for its 100th
anniversary to take place in May 2009. Residents, organizations and businesses
are encouraged to send us historical stories about your experiences with
Northern Neck State Bank that detail our 100-year history. All submissions will be
included in a drawing for a $100 savings bond.
The deadline to submit stories and photographs for Northern Neck State Bank’s
100th anniversary is June 20, 2008. Entries may include one photograph and a
narrative of up to 300 words. All photographs will be scanned and returned as
long as a return address is provided.
Mail submissions to:
Northern Neck State Bank
5839 Richmond Road, Warsaw, VA 22572
Attention: Gloria Smith
We were here
for you then...
Sail 6, beginning campers from left are (front row) Kevin
Cox, Garrett Gauntt, Andrew Desantis, Mike Ribich and
Soren Jespersen; (next row) Peter Raine, Charlie Waring, Kai
Engle, Tommy Lipscomb, Katie Cox, Justin Guthrie, Kate
Banchoff and Michelle Burch.
n Golf classic
The eighth annual Middlesex
Charger Golf Classic Tournament will be Friday, June 20, at
1 p.m. at the Piankatank River
Golf Club in Hartfield. The
tournament will benefit Middlesex High School athletics.
Individual, team and hole
sponsorships are available from
$50 to $2,500. The registration
fee includes a barbecue dinner,
gift bag, awards and prizes. The
deadline is June 4. To register,
call Brad Norris at 758-2132.
COCKTAIL CRUISES
departing daily
(7 Days a week) at 5:00pm
Tydamar departs from The Tides Inn
Earth Angel departs from Carter's Cove Marina
3PORT
3HORTS
n Life jacket exchange
EARTH ANGEL
We are
here for you
now.
1959
2008
9 LOCATIONS TO BETTER SERVE YOU
Sail 8, racing and intermediate campers from left are
Matt Guthrie, Rosemary Hall, Matt Tyson, Julia Tyson, Jake
Townes, Eric Siegel, Taylor Jones, Soren Jespersen, Michelle
Burch and Bill Johnson.
Burgess • Kilmarnock • Reedville • Montross • Tappahannock
Warsaw • White Stone • Wal-Mart, Tappahannock
Member
FDIC
www.nnsbva.com
#LUB'OLF
ICYCC 18-holers
The Indian Creek Yacht and
Country Club 18-holers on
June 3 played a low net tournament. Winners were first, Dana
Smith; second, Betty Reid; and
third (tie) Ellie Davis, Barbara
Hope and Lynn Georgiadis.
Carol Johnson, Audrey
Saunders, Lori Richardson,
Meredith Townes, Rachel
Jackson and Maria Schreyer
had chip-ins.
ICYCC 9-holers
The Indian Creek Yacht and
Country Club 9-holers on June
5 played blind partners. Winners were first, Robin Perks
and Jean Ehlman (64); second,
Elaine Bentley and Fran Sulick
(68); and third, Marilyn Reed
and Nancy Jarrel (69). Ehlman
had a chip in on hole 5.
Piankatank ladies
Piankatank River Ladies
Golf Association on June 5
played tee to green. First flight
winners were first, Jeanne
Rodgers (47); second, Kim
Walthall (49); and third, Isabell
Bunch (53).
Second flight winners were
first, Christy Pitts (59); second,
Sally Parkinson (64); and third,
Kay Uhler (69).
Third flight winners were
first, Marny Richardson (71);
second, Ann Powell (76); and
third, Bev Hudgins (79).
Quinton Oaks ladies
The Quinton Oaks Ladies
Golf Association on June 4
held a best ball of four tournament and a “June Bug” competition. Winners were Maggie
Dennett, Cheryl Rembisz,
Carol Uhlfelder and Susie
Sellman. Dennett had a birdie.
Harriet Baggett had a chip-in.
Carol Reese won low putts
with 30.
On June 7, the ladies held
a member-guest tournament.
The theme was “Rock Around
the Course.”
Winners of the Elvis flight
were first, Terri Sartori and
Faith McDermott; and second,
Linda Dennis and Judy English. Winners of the Eagles
flight were first, Carol Reese
and Janet Williams; and
second, Betty Lou Dunn and
Darlene Bean. Winners of the
Rolling Stones flight were first,
Harriet Baggett and Jean Lee;
and second, Carol Uhlfelder
and Juanita Miles.
Closest to the pin prizes went
to Sartori on hole 3, Alice Rawlings on hole 17, Faith Kauders
on hole 8 and Anna McCauley
on hole 12. Closest to the line
prizes went to Dunn and Janet
Williams. Longest drive prizes
went to Dennett and English.
Tartan Golf Club
Monday Play Day ladies’
winners for June 9 were low
gross, Isabelle Bunch; and low
net, Susan Troubetzkoy.
Men’s winners were first,
(tie) Bill Hanes and Herb Hancock; and third, Larry Shubnell.
Lancaster Lions Club
holds annual golf tourney
The Lancaster County Lions
Club Golf Tournament, dedicated this year to the memory
of recently deceased longtime
Lion Otis Davis, was held
May 14 at the Tartan Course in
Weems.
Some 40 golfers participated in the tourney. Prizes
were awarded in two flights.
First place in the first flight
went to the Chesapeake Homes
team of Ryan Holbrook, Tim
Blake, Craig Smith and Cody
Crabill. Second place went
to the Alley Café team of
Jae George, Debbie Dodson,
David George and Rich Ford.
First place in the second
flight went to the MICG team
of Clayton Jones, Wayne Mullins, Jim Georgiadis and Frank
Lewis. Second place went to
the team of Chuck Rowell,
George
Saunders, Donnie
Saunders and Monroe Belfield.
A number of individual
prizes were awarded, including straightest drive on hole 8
to Patty Rosenberg, straightest drive on hole 15 to Dixon
Foster, closest to the pin on
hole 5 by Jeff Haydon, closest to the pin on hole 9 by Mac
Conway, closest to the pin on
hole 13 by Craig Smith and
closest to the pin on hole 17
by Belfield.
The Lancaster County Lions
Club thanks all of the golfers
and hole sponsors for their participation and support in again
making this a memorable and
successful tournament, said
Lion Edward Kidwell.
-!((-'-+
+'(%))-%
)("-+",-
+0"%%"&0'
)("-+",-
.EW.ON3URGICAL4REATMENTFOR#ORNS#ALLUSES
From left, participants in the inaugural Chris Desch Foundation Golf Tournament in Richmond included Dudley Patteson, Jimmie Carter, Roxanne Cherry, Dr. Jim Hamilton,
Tom Baker and Dr. Dickie Carpenter.
Holton gift, golf tourney
launch Desch Foundation
The Chris Desch Foundation
recently was launched with a
$100,000 charitable gift annuity from former Gov. Linwood
Holton and his wife, Jinks, of
Weems.
Meanwhile, the inaugural
Chris Desch Golf Tournament
May 16 at the Country Club
of Virginia raised more than
$35,000.
“Dr. Christopher E. ‘Chris’
Desch was a dedicated, talented oncologist and a wonderful man,” said Rappahannock
General Hospital Foundation
vice president for development
Tom Baker.
Board certified in internal
medicine, hematology and
oncology, Dr. Desch practiced
academic medicine at Virginia
Commonwealth
University
Health Systems from 1988 to
1998 and was in private practice at Virginia Cancer Institute
from 1998 to 2006.
“He had a tremendous effect
on countless lives in this area
through his 16-year affiliation with the Cancer Center at
Rappahannock General Hospi-
tal,” said Baker.
Dr. Desch died in December
2006 when the private plane
he was piloting crashed near
Charlottesville. There was an
outpouring of affection from
people who wanted to honor
his memory, said Baker.
His widow, Roxanne Cherry,
and their son, Toby Desch,
established the Chris Desch
Foundation, with a board of
directors including Cherry,
Dr. David Trent, Dr. Thomas
Smith and Elizabeth Davenport Wright.
The RGH Foundation is
assisting the Desch Foundation.
“Our hope is that Chris’s
former patients and friends
from this area will follow the
Holtons’ lead and show their
appreciation by giving generously,” Baker said.
Endowment income generated by gifts from the area will
be used to support the RGH
Cancer Center.
To make a gift, call Baker at
435-8638, or visit thechrisdeschfoundation.org.
A Great Source for local sports
ÜÜÜ°,,iVÀ`°V
s"UNIONSs)NGROWN.AILS7ARTS
s(AMMERTOESs(EEL!RCH0AIN
s#IRCULATORY0ROBLEMS
s.EUROMASs&OOT5LCERS
s$IABETIC&OOT#ARE
2OUTEs'RAVATT-EDICAL#ENTER
+),-!2./#+
/0%.
-ONDAYTHRU&RIDAY
EVENINGHOURSAVAILABLE
A Buddy for Life
My foster parents call me adorable and lovable and
sweet and irresistable but I like the name “Chloe” the
best. I am a five pound, female, Chihuahua, housetrained and obedient and just love to be around
people. Sit in a chair and I’ll warm your lap for as
long as you want. I am
middle-aged so I like
to take naps in the sun
whenever I can. But if
you want to take a walk,
I am more than happy
to go along with you.
When I was younger,
I dislocated my shoulder so I have learned to
walk without using that
leg; it hasn’t slowed me
down at all. I am just
fine with cats and other
dogs and would make
a great companion for
someone who spends a
lot of time at home. In
fact, I am the ultimate companion dog!
Please call Chris at 462-3122 for further information.
This ad is sponsored by Terry & Donnie Elbourn in
memory of “Macie” through the Animal Welfare League
804-435-0822.
The Green Solution!
First Commonwealth Disposal
Boat Removal & Disposal
Servicing the Northern Neck
(804) 642-6461 • Gloucester Point
804.580.8425
Porch Rockers • Gliders
Windmills • Adirondack
Chairs • Wishing Wells
Lighthouses • Mailboxes
Wagon Wheels • Arbors
Wheelbarrows • Swings
Water Pumps • Bridges
Victorian Swings • Tables
Water troughs • A-Frames
!"#$#%&'(')#*'+,-'./'!,*/0'0'0
3AVE4IMEAND&UEL
Is this your dog?
!"#$%&'&()#$*+%#,%*+(&*-#.*/&%%$
!"#/%-0-/1%*2%&34,%*5*2)66(&0
!7(6*8)-140.*6&($),09,(:6%04043%*6&4,%
!;(,-1*$%-1%&9#(*2-1%2:-#
Joe Noland – 757-268-8296
Joe@DogGuardLLC.com – www.DogGuardLLC.com
From left, Julie Tritz accepts a donation from Jay Wallin.
Bank and trust company
offer 4-H camp support
Bay Trust Company president and chief executive officer
Jay Wallin recently presented a
contribution on behalf of Bay
Trust and Bank of Lancaster to
Virginia Cooperative Extension
Agent Julie Tritz to assist with
the 2008 summer 4-H camp
program.
The funds will be used to
send youth to the summer camp
at the Jamestown 4-H Education Center in Williamsburg.
Wallin said the 4-H programs walk hand-in-hand with
the commitment of Bank of
Lancaster and Bay Trust Com-
pany to General Colin Powell’s
“America’s Promise” program
to invest in the future by investing in children.
“The mission of America’s
Promise is to provide youth
with the fundamental resources
they need to become happy,
healthy and productive adults,”
said Wallin. “The 4-H program
is an ideal partnership for our
Bank and our Trust Company
in our efforts to provide opportunities to young people for
personal growth.”
To send a child to camp, call
Tritz at 462-5780.
Aeronautical Society to meet
The Northern Neck/Middle
Peninsula Chapter of the Virginia Aeronautical Historical
Society will meet at noon June
19 at the Pilot House Restaurant in Topping. The speaker
will be retired U.S. Navy Capt.
John Miles.
His subject will be experiences flying the A-45, from
the carrier Oriskany during
the Vietnam conflict, 1966-67.
He will present a movie made
of the carrier Oriskany operations during that time. He
was a quardrant mate of John
McCain’s on the Oriskany.
For the July annual dinner
meeting, the subject will be
“Homeland Security” with Col.
Scott Robinson. In August, Don
Watrous will present a program
on unmanned aircraft. Subjects
of future programs will include
the B-52 over North Vietnam,
1972, and also a presentation
on the Stealth Fighter, F-117.
The annual dinner, a gala
indoor picnic, will be held at
Rappahannock WestminsterCanterbury July 18. Send reservations to Bob Schneider at
114 Club View Drive, Lancaster, VA 22503 by Friday,
July 11. Include $18 per
person. The menu will include
grilled chicken, hamburgers,
baked beans, cole slaw, potato
or fruit salad, assorted freshly
baked pies and strawberry
short cake. A cash bar will be
available.
A13
#LOSEST-ARINATOTHE"AY
A14 •
From left are Bob Berry, Larry Taylor, Charlie Austin and Jim
Hughes
Nance wins rifle match
Tom Nance out-shot 13 competitors in a June 7 bench-rest
match at the Rappahannock
Pistol and Rifle Club.
Nance attained a perfect
score of 200 with 19 x-shots. Jim Hughes took second, scoring 199 with 12 x-shots. Bob
Berry, Larry Taylor and Charlie
Austin came in third at 199 and
10 x’s each. The match required five shots
at each of four targets over a
distance of 100 yards. A time
limit of 23 minutes was allowed
each shooter. At the outset, an
additional five minutes was permitted for sight-in shots taken
at a separate target to get rifles
adjusted to their best performance. Each of the 20 record shots
had a 10 point potential score,
with lower amounts for shots
landing outside the 1.75-inchdiameter 10 ring. A score of 200
is the best possible. Ties are settled by the number of x-shots
achieved. The x-ring is a
.75-inch-diameter ring within
the 10 ring.
Center-fire rifles were featured. Calibers employed ranged
from .204 to .308 with .223 and
.308 the most common at four
each. All but one made use of
optic sights.
A variety of manufacturer’s
brands was represented including Springfield, Ruger, New
England Firearms, Savage, Bushmaster and Remington. There were custom built Mauser- and Remington-based
rifles, one of which was used by
Nance to win.
!$OCTOR3PEAKS
BY'EORGE-OORE-$
Please don’t forget the pap test
Gardisil is the new vaccine that can prevent cervical cancer. The
cause of most cases of cervical malignancy is the human papilloma
virus (HPV), and the vaccine works against two of the viral strains
that promote this cancer, as well as two strains that cause genital
warts.
Unfortunately, the vaccine is far from perfect. It prevents only
70 percent of cervical cancers. There appear to be other strains of
papilloma virus that also promote cervical cancer.
The vaccine represents a good beginning in developing a vaccine
that prevents cancer. The introduction of this vaccine has led to
some confusion, however.
If there is a vaccine against cervical cancer, can women just
forget the Pap test? The answer is “NO.” The vaccine will not make
the Pap test obsolete for many generations, and even for those who
are vaccinated with Gardisil, the Pap test will pick up all cervical
cancers, even those that the vaccine does not prevent.
These are the guidelines for Pap testing:
• Women should have their first Pap test within three years of
becoming sexually active, or no later than age 21.
• They should be tested annually until age 30; after that, if three
consecutive tests have been normal, screening can be done every
two or three years.
• Women who have multiple sexual partners or who smoke (big
risk factors for cervical cancer) should continue to be screened
annually.
• Women 70 or older who have had regular screenings with
normal results and who are not at high risk can discontinue Pap
tests. Women without an intact cervix (because of surgery) need
not be tested.
• Pap testing is 99 percent effective and will be useful for decades
to come. Cervical cancer continues to remain a major killer of
women in poor countries that do not use the Pap test.
Turkey Shoot Regatta
slated October 10 -12
Volunteers are on the phones
and sail boaters are mending jibs,
painting hulls and plotting strategies to participate in the 13th
annual Turkey Shoot Regatta
October 10 to 12.
The regatta benefits the Northern Neck and Middle Peninsula
hospices. Yankee Point Sailboat
Marina on the Corrotoman River
serves as the headquarters. Racing
is under sail on the Rappahannock River.
Businesses, organizations and
individuals support the regatta.
Last year a record of $46,000 was
raised. Organizers hope to exceed
that total in 2008, according to
regatta chairman Allan Young of
Weems. Some 200 people benefited from hospice volunteer
services in the Northern Neck
and Middle Peninsula in 2007, he
said.
The schedule includes the initial
meeting of sailors and remarks by
the principal race officer October
10 and races on the 11th and 12th,
with a happy hour Friday evening
and a dinner Saturday.
Boats designed before 1983 will
be eligible to race and this year, a
special trophy will be awarded to
the fastest wooden boat designed
or built before 1965.
“A goal of the regatta is to
sponsor an attractive venue for the
3PORT
3HORTS
n Prime Tyme
Registration is now being
accepted for the Prime Tyme
Developmental
Basketball
Camp 2008 at Northumberland
High and Elementary schools
June 16-20. The coed camp is
open to girls and boys ages 5 to
18. The camp, directed by Northumberland coaches Michael
Stevenson and Darrel Long,
includes classroom and handson instruction for both beginners and experienced players.
The fee is $75 for registration
before June 1 and $85 after that
date. A $5 discount per child
is given to families with more
than one camper. To register,
send payment to Prime Tyme,
P.O. Box 696, Heathsville, VA
22473.
Ladies ONLY Introductory Shooting Clinic
June 28, 2008
WHERE:
Hosted by the Rappahannock Pistol
& Rifle Club
640 Blueberry Point Road
White Stone, VA
Handgun, Rifle and Shotgun Intro-Programs
Beginners especially welcome!
Space is limited so sign up early!!
Handguns, rifles, shotguns, ammunition provided
DATE:
Saturday, June, 28, 2008 Rain or
Shine
TIME:
8:30 - 9:00 AM Sign In
Safety Class 9:00 AM sharpEveryone must attend!!
COST:
$10.00 for lunch
Peggy Cathey (804) 438-6069 (office)
(804) 462-7521 (home)
PLEASE DO NOT BRING YOUR OWN FIREARM
WE MUST HAVE YOUR REGISTRATION BY
JUNE 25, 2008
CONTACT:
Detach and send Registration Form to:
Peggy Cathey, RP&RC, 340 Smith Lane, Lancaster, VA 22503
Name:
Address:
❐ Pistol ❐ Rifle ❐ Shotgun
Phone#:
(Choose two)
E-mail:
Please submit your check for $10 with form payable to RPRC
Virginia Motor Speedway
June 7 results:
Monster Trucks
Racing - Batman/Bobby Parr
Freestyle - Stone Crusher
Quad Wars -Team Virginia
June 14 races:
(VMS is on Route 17 in
Jamaica, eight miles north of
Saluda. Pit gates open at 3
p.m.; spectator gates open at
4 p.m. Track activities begin at
6 p.m.)
MACS late models (50 laps),
sportsmen (25 laps), modifieds (25 laps).
The yacht Ritual, in the foreground, skippered by Jeff
Seed, moved up in the fleet
passing Russ Seltzer aboard
Joie de Vie in the 2007 Turkey
Shoot. Seed was setting a
course to catch Whistler,
skippered by Warren Ryan.
skippers of some very beautiful,
truly classic sail boats. We want
the Regatta to be a fun day for
skippers and crew whether they
sail a fast J24 or a pre-World War
II classic beauty,” said Young.
To register, visit hospiceturkeyshootregatta.com.
JEWELL’S BUILDINGS
Celebrating 11 Years
of Quality Buildings and Service
LLLLLLLLLLLLLLLLL
Standard & Custom Built
Old Fashioned Quality
Located between Haynesville & Village
New England Cape Cod
13410 Richmond Road
7ARSAW6IRGINIAs
105.5
72!2
n Cross country camp
Reebok’s Mountain High
Running Camp in Mars Hill,
N.C., is accepting applications
for the July 14 to 19 middle
and high school crosscountry
sessions. The camp features
trails, free Reebok shoes and
a staff of U.S. and Kenyan
runners and coaches. For an
application, visit mountainhighrunning.com, or contact
Scott Simmons at coach@
mountainhighrunning.com, or
call 704-688-2814.
5PEBZ²T)JUT:FTUFSEBZ²T'BWPSJUFT
This Father's Day, Give Dad
More Time For Fishing.
n $10,000 raffle
Third Annual
0IT3TOP
Time and tickets are running
out for a $10,000 shopping
spree at Chesapeake and Crescent. Tickets are $50 and the
proceeds from this raffle benefit the Northern Neck Family
YMCA’s Guardian program.
Tickets are available at the
YMCA and Chesapeake Bank
in Kilmarnock, Net Cruisers Cafe in Lancaster, Northern Neck State Bank in White
Stone and The Dandelion in
Irvington. A drawing will be
held at the Ball in the Halls
June 28.
n $10,000 raffle
Time and tickets are running
out for a $10,000 shopping
spree at Chesapeake and Crescent. Tickets are $50 and the
proceeds from this raffle benefit the Northern Neck Family
YMCA’s Guardian program.
Tickets are available at the
YMCA and Chesapeake Bank
in Kilmarnock, Net Cruisers Cafe in Lancaster, Northern Neck State Bank in White
Stone and The Dandelion in
Irvington. A drawing will be
John Deere
Z225 EZtrak™
Mower Specialty Price
- $2899«
With a new John Deere ZeroTurn Mower, Dad will have
more time to spend at his
favorite fishing hole. With a
18.5 horsepower engine, 7
mph ground speed and 42"
Edge™ Cutting system, yard
work is done quick and with
no mess. This Father's Day
give the big guy a John Deere,
because with it he gets the
yard and leisure time he
deserves.
n Boating class
An About Boating Safely
class will be offered by USCG
Auxiliary 62 June 20 and 21
at Christ Church parish hall in
Christchurch. The class will
meet from 7 to 9 p.m. June 20
and 8 a.m. to 12:30 p.m. June
21.
The fee is $20. To register,
call 758-2122, or email dragonflyte5@netscape.net for all
matters concerning the course
offered.
A Great
Source
for
local sports
Z520A Z-Trak Estate Series
LA115 Lawn Tractor
Ride Free For A Year!
‡
• 25hp* Kohler V-twin, OHV aircooled engine
• 54- or 60-inch 7-Iron™ mower
deck
• The "Turn Key + 1" Sysyem
Specialty Price $1,499
†
• 19.5-hp* Briggs & Stratton engine
• 42" Edge™ Cutting System
• Limited Quantity - Visit Today!
www.JohnDeere.com
��
��
��
�
�
�
ÜÜÜ°,,iVÀ`°V
D74BUBD0802-RAP3x100612RR-BW-00246533
t Work session . . . .
From left, Flotilla 33 crew members Brian McArdle operates a manual pump, Amy Thomas tends the pump hose and
David Pope handles the mooring lines.
Flotilla 33 rescues
sinking boat, crew
IRVINGTON—On a safety
sweep of the Rappahannock
River at dusk on June 8, an
Auxiliary Flotilla 33 Patrol
Boat came upon a boat in distress near the mouth of Carter’s
Creek. The captain of the distressed boat noticed something
was wrong and was trying to
get back to port.
“Although the boat was under
power when we came along, we
decided to escort it in to port
since it was obvious the operator was having difficulty,” said
coxwsain Jim Thomas. “When
the operator could not safely
maneuver his boat, the crew of
the Coast Guard Auxiliary boat
quickly put the disabled boat
under a side-tow to take it back
to port. After getting underway with the tow, the operator
opened the engine hatch and
discovered that the boat was
taking on water.”
While maintaining contact
with Coast Guard Station Milford Haven, the crew of the
Coast Guard Auxiliary boat put
the disabled boat under a sidetow to Irvington Marina.
“We quickly learned that the
boat was taking on more water
then the bilge pump could
handle,” said Thomas. “One
of the things we always carry
aboard is a manual de-watering
pump for a situation just like
this. With the boat’s bilge pump
and the manual pump we were
able to slow it down enough to
get the boat to a marina for further assistance.”
Due to the heat and the time
it took to get additional pumps
set up at the marina, auxiliary
crew members continued operating the manual pump to keep
the boat afloat until the situation
was stabilized, said Thomas.
On this night, the “safety
sweep” of the Rappahannock
River really helped a local
boater, he said. What started as
a routine escort to safety, turned
into a towing situation and then
rapidly became a dewatering
event.
“Had assistance not been
rendered timely, the boat could
have sunk and the boater put in
the water after dark. This would
have caused a more difficult
night search and rescue for a
person in the water, as well as
a marine pollution problem,”
said Thomas. “We continually
communicated with the Coast
Guard Station at Milford Haven
to keep the officer of the day and
the officer in charge apprised of
the situation.”
“Members of Flotilla 33
have volunteered on many busy
summer weekends and give up
their own time to do a patrol of
our area of responsibility,” said
Flotilla 33 commander John
Mill,“Our safety sweep patrols
cover an area and the patrol
comes within hailing distance
of all boats not underway to
make sure there are no problems. We just want to make sure
all our friends and neighbors
get home safely. Today, one of
our crews did a super job and
saved a boat from sinking and
having the captain of the boat in
the water in the dark.”
“Our training with other
auxiliary boats and with the
Coast Guard Station at Milford
Haven really paid off in this
situation,” said auxiliary crew
member Amy Thomas. “We
were quickly able to stabilize
a situation where every minute
counted.”
t Lancaster . . . .
t Curb attack . . . .
from $786,365 to $686,905,
saving $99,460.
Increases in spending are
noted in all other categories:
• Courts, from $631,318 to
652,871, up $21,553;
• Public safety, from
$3,192,633 to $3,526,656, up
$334,023;
• Public works, from
$1,109,583 to $1,139,924, up
$30,341; and
• Health and welfare, from
$2,451,408 to $2,700,274, up
$248,866. The
school
operating budget increased from
$15,162,262 to $15,494,208,
up
$331,946.
Non-public school education from
$5,576 to $5,700, up $124;
community
development
from $380,397 to $389,812,
up $9,415; non-departmental
from $42,425 to $49,925, up
$7,500; and debt service went
from $501,636 to $669,478
up $167,482.
the grate recently, she also was
unable to get any satisfaction
from town hall.
While waiting for help, however, she learned that the grate in
front of the bookstore wasn’t the
only one popping tires.
Across the street at Dawson’s,
Shannon Smith said one of her
customers was so irate after it
happened in front of the clothing
store, the woman refused to shop
that day and said she would never
park out front again.
“It’s a shame the town has
known about this for two years
and hasn’t done anything about
it,” Smith said.
Town manager Lara Burleson
said she was sympathetic to the
problem, but there was nothing
the town could do since the curb
construction passed inspections
and met VDOT standards. She
added that if repairs could be
made, they would probably be the
responsibility of the town since
they had signed off with the contractors. However, one call to Sean Trapani, resident administrator for
VDOT, was all it took to get some
action.
“It’s the first I’ve heard about
it,” he said. Traponi noted that
VDOT has responsibility for the
curbs and that complaints should
come to his office.
He ordered an immediate
inspection of all the rain water
grates along Main Street and
found that they all had the potential of damaging a tire if drivers
hit the curb at just the right angle.
He also confirmed that the construction met VDOT standards
and that the grates were installed
exactly the same way across the
state.
However, Traponi was also
willing to try to fix the problem.
While he said repairs to concrete
usually don’t hold for long, VDOT
supervisor Robert Harber will
experiment on the grate in front
of the bookstore using rubber
expansion and epoxy concrete.
Traponi noted that the bump
outs may be causing some parallel parking problems and suggested drivers try to leave plenty
of space between their tires and
the curb when parking on the
street.
Taxes
Based on new real estate
assessments, the current tax
rate of 53 cents per $100
of assessed value could be
adjusted down to a revenue
neutral rate of 36 cents in
order to produce the same
revenue. However, county
officials are proposing an
increase of 6 cents for 2009
that will bring the property
tax rate to 42 cents.
The new rate is expected
to generate about $1,800,000
in additional income which
will be used mostly to cover
increases in the school
budget, including a loss of
$1,200,000 from the state
composite index adjustment.
The personal property tax
rate for motor vehicles is
proposed at $2.04 per $100
of assessed value and the rate
for other personal property
along with machinery and
tools is proposed at $1.52 per
$100.
A copy of the complete
proposed budget is available for inspection during
regular office hours in the
county administration office
at 8311 Mary Ball Road in
Lancaster.
the 2009 budget cut.”
2009, from $12,500 in 2008.
Nunn also took issue with the This amount could be reduced to
proposed purchase of radiom- $15,500 saving a total of $5,000
eters for gauging water usage. and still allowing a $3,000
The proposed budget allots increase, said Straughan.
$660,000 over the next three
Another $100,000 is budgeted
years for the implementation for parking lot improvements in
of the meters. The radiometers 2009, he noted.
are not required by the state and
“Much of this can be elimithe cost of manual readings is nated or deferred. Spending no
$69,000 annually, according to more than $50,000 for these
Nunn.
purposes results in a savings of
“In these economic times, $50,000,” said Straughan.
council should exercise fiduCitizens also voiced conciary responsibility and put off cern about the new town center
buying radiometers, deleting a project. Straughan urged countotal of $660,000 from the pro- cil to explore temporary alterposed budgets for the next three natives to the construction of
years,” said Nunn.
a new town hall, a project for
“I ask the committee and the which $216,250 is proposed in
council to remember that in 2009. Straughan said he and
addition to acting as the execu- town manager Lara Burelson
tive board of the town, you are had determined that renting
also supposed to represent the or buying an existing buildcitizens,” said Nunn, amidst a ing that could meet the counsmattering of applause.
cil’s growing needs would cost
Also at issue was the effective approximately $75,000 annuproperty tax rate increase. Ray- ally.
mond Booth called the increase
Grace Goodman said the
excessive, saying it is “the wrong project itself is unnecessary.
tax at the wrong time.”
“How can we outgrow a
Howard Straughan proposed space when we don’t need the
decreasing the real estate tax new employees?” said Goodrate from 14 cents to 9 cents man.
per $100 of assessed value. This
At the conclusion of the
would reduce the related rev- formal input session, members
enue from $129,000 to $16,000. of the audience voiced a desire
This translates to an 8.5 percent to hear responses from council,
effective tax increase.
and displeasure at the threeStraughan proposed sev- minute limit given to speakers.
eral reductions in general fund
Councilman Frank Tomlinexpenses, which would allow son said there will be another
council to adopt a more “reason- budget meeting next week,
able” tax increase.
allowing the council members
Proposed salaries for council an additional week to “digest”
members and the mayor have suggestions before making
80632701.Z
10:46
Page
1
been
increased 6/5/08
to $20,500
for AM final
decisions
June 16.
A15
THE RECORD ONLINE
www.rrecord.com
A VERY COOL WAY TO
SAVE!!!
SAVE UP TO $1,100
ON OUR COOLEST
SYSTEM.
(OFFER VALID MARCH 2ND - JUNE 30TH)
YOUR MIDDLE-PENINSULA CARRIER EXPERT
RYMANS, INC.
ING
CELBRAT
40 YEARS
MER
OF CUSTO
E!
IC
V
R
SE
AIR CONDITIONING & HEATING
804-758-2978
FAMILY OWNED & OPERATED SINCE 1968
GIVE DAD OUR GIFT CARD...
THE PERFECT PRESENT!
Order at www.peebles.com
In all stores, or order toll-free 1-800-743-8730
SALE 19.99
VAN HEUSEN DRESS SHIRTS
Basic and fashion colors and stripes.
Reg. 34.00 & 37.50.
®
SALE 29.99
DOCKERS ORIGINAL KHAKIS
Individual Fit waistband. Pleated or
flat-front. Waists 32-44. Reg. 48.00.
®
®
SALE 39.99
SALE 24.99
ROLFS DIGITAL PHOTO WALLET
Digital album slides out of wallet.
Stores up to 60 photos. Reg. 60.00.
INSULATED ROLLING COOLER
By Traveler’s Club . With retractable
handle. Reg. 42.00.
®
®
I DAD SALE
’s Day
Father nday
is Su 15
June
30%-50% Off Great Gifts for Dad & More!
40%
30%
40%
OFF
OFF
OFF
KIDS
PLAYWEAR
Boys 2T-20
and girls
2T-16 tops,
shorts and
dresses.
Reg. 8.00-60.00,
Sale 4.80-36.00
ENTIRE STOCK
HANNAH
Knit tops,
bermudas,
skirts and
dresses.
Misses
S-XL; 6-16.
Reg. 20.00-36.00,
Sale 14.00-25.20
®
IZOD SPORT
SHIRTS &
SHORTS
Men’s polos, woven
shirts; madras and
cargo twill shorts.
Reg. 38.00-55.00,
Sale 22.80-33.00
®
SALE 21.99
30% OFF
50% OFF
50% OFF
DOCKERS TWILL SHORTS
Cargo and pleated front styles.
Men’s waists 32-42. Reg. 40.00.
NORTH RIVER & COLUMBIA
Men’s tees and sport shirts. M-XXL.
Reg. 22.00-38.00, Sale 14.99-26.60
PETITES SEPARATES
By Baxter & Wells . Tees and capris.
Reg. 16.00-26.00, Sale 8.00-13.00
MISSES BAXTER & WELLS
Tees, shorts and capris. S-XL.
Reg. 16.00-26.00, Sale 8.00-13.00
50% OFF
SALE 17.99
SALE 3/$20
40% OFF
®
MEN’S SPORT SHIRTS
By Van Heusen and Sun River . M-XXL.
Reg./orig. 20.00-38.00, Sale 9.99-19.00
®
®
®
®
NIKE & GRAPHITE SANDALS
Men’s leather and fabric styles.
Reg. 22.00-30.00.
®
®
®
JUNIORS TEES, TUBES & TANKS
ENTIRE STOCK MISSES IZOD
By Derek Heart , Love by Design , Energie .
Polos and capris. S-XL; 4-16.
Reg. 10.00 ea. Must buy 3 to receive discount.
Reg. 36.00-44.00, Sale 21.60-26.40
®
®
®
®
Plus, Save Even More with your Bonus Coupons!
BONUS COUPON VALID NOW THRU JUNE 15
BONUS COUPON VALID NOW THRU JUNE 15
% Off
Extra
15
Any Single Item
% Off
Extra
15
Any Single Item
*
*
REGULAR PRICE, SALE OR CLEARANCE
REGULAR PRICE, SALE OR CLEARANCE
*Excludes cosmetics, fragrances, formalwear rental, gift cards and
previous purchases. Cannot be combined with any other coupon or
private savings offer. Must relinquish coupon at time of purchase.
*Excludes cosmetics, fragrances, formalwear rental, gift cards and
previous purchases. Cannot be combined with any other coupon or
private savings offer. Must relinquish coupon at time of purchase.
Prices effective through Sunday, June 15, 2008. Interim markdowns may have been taken. Entire stock only where indicated. Selection may vary by store.
80632701.Z
6/13/08
PB FATHER'S DAY SALE ROP
4 Col x 14"
B&W ROP
MN
3 PEEBLES
K.Boyd / L.Grant / J.Schwalen
A16
From the front
Irvington sets $141,750
budget for public hearing
IRVINGTON—Town council will hold a public hearing tonight
(June 12) at 7:30 p.m. in the Irvington town hall on a proposed
$141,750 budget for the coming year.
Council also will address improvements at the town commons,
including repairs to the tennis courts and the painting of the
gazebo.
Also on the agenda, council will address contributions made
during fiscal year 2007-08, including $1,000 for a concert featuring the Air Force Band, and $250 to the White Stone Fire Department and the Kilmarnock-Lancaster Rescue Squad.
THE RECORD ONLINE
www.rrecord.com
Northumberland Red Cross
seeks new executive director
by Reid Pierce Armstrong
Northumberland
County
Chapter of the American
Red Cross may lose its charter if the organization cannot
find a new executive director before the beginning of
July, when long-time director Joan Clements retires.
Clements headed the organization as a volunteer for 11
years, and finding sombody
to replace her is proving difficult, said volunteer Shirley
Grant.
None of the current volunteers seem to want the
job, which requires about
20 hours a week when there
isn’t a disaster at hand.
“Our current volunteers
have been doing this for
years,” Grant explained. “We
are looking for new blood.”
The job involves manning
the Heathsville office for
several hours three days a
week and coordinating with
county leaders and school
officials.
“It’s quite a responsibility, but it’s very rewarding,”
Grant said.
When there is a disaster –
storms, tornadoes, hurricanes,
fires – the director is the first
contact person, Grant said.
The director coordinates the
chapter’s volunteers, secures
lodging for victims, provides
clothing for those who need it
and points victims in the right
direction for help.
“We are looking for somebody who has time to be our
leader,” Grant said. Computer skills and people skills
are a must, she added.
In addition to responding
to natural disasters and fires,
the Red Cross also teaches
First Aid and CPR classes,
holds bloods drives and acts
as liaison for local soldiers
deployed overseas.
To apply, call 580-4933.
Northumberland supervisors meet today
Northumberland board of
supervisors will meet at 5
p.m. today (June 12) to conduct regular monthly business.
The board will hear from
Capt. Matt Scassero, Naval
Air Warfare Center Aircraft
Division Vice Commander
of the Patuxent River Naval
Air Station, at 5:10 p.m.;
Allyn Gemerek, president of
Bay Aging, at 5:25 p.m.; and
Joe Madej, executive director of the county’s Economic
Development Commission,
at 5:45 p.m. The county
administrator’s report will
follow.
Among public hearings
set for 7 p.m., the board will
accept comment on requests
from:
• John H. Lee for a permit
to locate a dwelling unit in
a building zoned B-1 (general business) at 5125 Jessie
DuPont Memorial Highway
in Wicomico Church.
• Mitchell Jett, owner, and
Phyllis Swift, applicant, for
a permit to operate a commercial boarding/breeding
kennel at 38 Blundons Road
near Burgess.
• Richard and Louise
Czwartacki for a permit to
construct a private storage
building on an undeveloped
lot off Whays Creek Cove
Lane near Haynie Point.
• Mary Alice Eubank,
owner, and Living Water
Lutheran Church, applicant,
for a permit to establish a
church in the Eubank Building at 83 Bluff Point Road
near Kilmarnock.
• James L. Dunn for a
change in zoning district
classification to rezone his
Glebe Point property from
business (B-1) to waterfront
residential (R-2) for the purpose of constructing 28 condominiums.
The board also will consider an amendment to the
zoning ordinance to include
provisions for “Adult Businesses.”
$
Legendary blues and roots rock artists, The Nighthawks (above),
capped the Steptoe’s First Friday Walkabout in Kilmarnock June
6. The concert at Savannah Joe’s attracted folks of all ages. Fans
came from as far as Richmond to hear the blues. At left, Iris
Smith of Kilmarnock welcomes band leader Mark Wenner to the
Northern Neck. One of the original members, Wenner has been
playing harmonica and singing with The Nighthawks for more
than 30 years. Other band members (from left) are Paul Bell on
guitar and vocals, original band member Pete Ragusa on drums
and Johnny Castle on bass. The Nighthawks will return to the
Savannah Joe’s stage September 26. Itchy Dog returns this Friday
night; Sweet Justice on Saturday night and William Kyle Sunday
afternon. (Photos by Robert Mason Jr.)
!
The Nighthawks soar into Kilmarnock
3
4!.$
.
!
#
)
2
%
- ).352!.#% !2
!'%.#9).#
!,,,).%3/&
).352!.#%
See Steptoe’s First
Friday Walkabout
video at rrecord.com
%34!",)3(%$
).
+),-!2./#+
Father’s Day Special
Half a chicken $5
Open Saturdays from 12 noon
till the last rib is sold!
$BSMTPO3PBEGPSNFSMZ%FMBOP´TTUPSF
-PDBUFECFUXFFO,JMNBSOPDL8JDPNJDP$IVSDI
t Northumberland budget . . . .
vices Board and the Department of Social Services were
rescinded on motions made
by Tommy Tomlin, amounting
to a total of $25,000 for social
services and $2,050 for the
community services board.
The motions passed 3-2
with Tomlin, Jim Long and
Richard Haynie voting in
favor of leaving the money
in the budget and Ronnie Jett
and Joe Self voting against.
Jett argued that fully funding those departments was
coming at the expense of the
schools.
He added that social services employees are driving around in vehicles with
leather interiors and compact
disc players, a sign, he said,
of poor money management
in that department.
Tomlin countered that, with
tough economic times at hand,
the community will rely more
heavily on social services.
The board unanimously
agreed to leave $4,000 in the
budget for the Jamestown 4-H
Center.
The
supervisors
cut
$417,857 from the school
board budget request, level
funding the schools.
As a result, the school board
voted Monday night to cut
teacher raises, offering only a
step increase but not a cost of
living raise.
The school board also cut
out a debt service payment,
two new school buses and
funding to cover higher fuel
costs from the budget.
The board of supervisors
made a public promise to
superintendent Clint Stables
last Thursday to help with
additional funding if fuel
costs continue to rise. Stables
had projected a $225,000
increase in fuel costs for
next year, but reduced that
increase to $178,355 to meet
his budget.
Level funding the schools
still required a $936,168
increase in local dollars due
to a dramatic reduction in
state aid to Northumberland
County this year.
Northumberland County’s
total budget for 2008-2009
amounts to $49,200,155.
The
budget
anticipates
$45,977,307 in expenditures
and predicts an ending fund
balance of $3.2 million.
The supervisors approved
the budget 4-1, with Tomlin
voting against it on the
grounds that it includes
long term debt payment not
approved by voter referendum.
Photography by Michael Neff
A Classic Community in the Heart of Historic Lancaster County, Virginia
Introducing GRACE HILL, a new single-family, maintenance-free, village-type community, situated in the most vibrant
region of the Northern Neck of Virginia—an exciting and convenient place to live.
Buy a GRACE HILL home site today—attractively priced from $98,500 and at any time during the
next 36 months, commence construction of your selected model.
LAWLER
Models, including home site, are currently priced in the mid $300s.
REAL ESTATE
804.438.4364
www.gracehillvirginia.com
www.lawlerrealestate.com
804.435.1000