View 2015-2016 Course Catalog - Yakima Valley Community College
Transcription
View 2015-2016 Course Catalog - Yakima Valley Community College
Yakima Valley Community College Catalog 2015-2016 Yakima Campus South Sixteenth Avenue and West Nob Hill Boulevard, Yakima, Washington PO Box 22520 Yakima, WA 98907-2520 509.574.4600 Videophone: 509.574.4973; IP Address: 134.39.160.70 Grandview Campus 500 West Main Street, Grandview, Washington 98930-1284 509.882.7000 www.yvcc.edu 2 TABLE OF CONTENTS Part I: Academic Information 3-62 Message from the President 3 Academic Calendar 4 College Directory 5-6 The College 7-10 Admissions 11-15 Registration 16-17 Tuition, Fees and Expenses 18-20,50 Financial Aid 21-25 College Resources 26-33 Policies 34-35 Student Rights and Responsibilities 36-37 Academic Rules 38-46 Degrees 47-48 Bachelor Degrees 49 Transfer Degree Information 51-54 DTA Distribution List 55-57 Restricted Subject Areas for Transfer 58 Special Degrees 59 Professional/Technical Degrees 60 Professional/TechnicalCertificates 61 Courses 62 Part II: Programs & Courses 63-179 Accounting 63 Adult Basic Education 63-66 Aerospace Machining Technology 66-68 Agriculture 69-74 Allied Health Technology 74-82 Anthropology 83 Art 84-85 Astronomy 86 Automotive Service Technology, Master 86-88 Biology 89-90 Business Administration 91-95 Business Technology 95-100 Chemical Dependency Studies 100-102 Chemistry 102-104 Chican@Studies 104-105 College Academic Skills 105-106 Communication Studies 106-108 Criminal Justice 108-110 Dental Assisting 110-111 Dental Hygiene 111-115 Yakima Valley Community College, 2015-2016 Drama Economics Education Engineering/CADD English Ethnic Studies Geography Geology History Humanities Information Technology Mathematics Medical Assisting, Allied Health Medical Billing & Coding, Allied Health Medical Interpreter, Allied Health Modern Languages Music Nursing Nutrition Patient Navigation, Allied Health Pharmacy Technician, Allied Health Phlebotomy, Allied Health Philosophy Photography Physical Education Physical Science Physics Political Science Professional/Technical Education Psychology Radiologic Sciences Reading Social Science Sociology Student Development Surgical Technology, Allied Health TV/Video Production Veterinary Technology Part III: General Information YVCC Foundation Scholarship Personnel Maps Awards Index 116-117 117-118 118-127 127-131 132-135 135-136 136 137 138-139 139-140 140-144 144-146 74 75 75 147-150 150-153 153-157 157 79 76 76 158 159 159-162 163 163-164 164-165 165 166 167-170 171 171 171-172 172-173 76 173-174 174-179 180-200 180-185 186-193 194-195 196 197-198 MESSAGE FROM THE PRESIDENT Choosing a college in which to pursue higher education is a very important decision. This catalog provides information to assist you in determining how the mission, programs, and services provided by Yakima Valley Community College can best prepare you to achieve your educational and career goals. This catalog is a very important tool for your success. It contains valuable information such as policies and procedures, program requirements, and course descriptions. Since it began in 1928, Yakima Valley Community College has focused continually on student success. We value our role in building the future of the Yakima Valley. Our part in that future is tied to the success of every student who enters our doors. You may be enrolled in Yakima, Grandview, one of our many learning centers, or through web-based classes. However and wherever you learn, know that we are committed to providing access, instructional and technologicalquality,andthesupportservicesthatwillensureyoursuccess.Theinfluence of our college reverberates throughout our community and state in the contributions and accomplishments of our graduates. WhetheryouhavecometousforahighschooldiplomaorGED,languageproficiency,job skills, transfer programs, or to earn a bachelor's degree, meeting your needs is our primary mission.YVCC’sexcellentfacultyandstaff,aswellasourcommunitypartnersoftheYakima Valley, will assist you in acquiring the knowledge needed to be a skilled professional or continue your educational journey toward a baccalaureate degree. Sincerely, Linda Kaminski, Ed.D. President Board of Trustees Dr. Sara Cate, Ms. Rosalinda Mendoza, Ms. Lisa Parker, Mr. Robert Ozuna, Ms. Patricia Whitefoot Yakima Valley Community College, 2015-2016 3 4 Calendar* ACADEMIC CALENDAR Fall Quarter 2015 September 7, 2015 (Monday) September 14-16, 2015 (Monday-Wednesday) September 17, 2015 (Thursday) September 17-18, 2015 (Thursday-Friday) September 21, 2015 (Monday) October 19, 2015 (Monday) November 3, 2015 (Tuesday) November 11, 2015 (Wednesday) November 26-27, 2015 (Thursday-Friday) December 4, 2015 (Friday) December 7-9, 2015 (Monday-Wednesday) December 10, 2015 (Thursday) December 10-11, 2015 (Thursday-Friday) December 11, 2015 (Friday) December 14, 2015 - January 3, 2016 December 25, 2015 (Friday) Winter Quarter 2016 January 1, 2016 (Friday) January 4, 2016 (Monday) January 18, 2016 (Monday) February 15, 2016 (Monday) March 11, 2016 (Friday) March 14-16, 2016 (Monday-Wednesday) March 17, 2016 (Thursday) March 17-18, 2016 (Thursday-Friday) March 18, 2016 (Friday) March 21-25, 2016 (Monday-Friday) Labor Day - Holiday Faculty Return/Convocation/Institutional Planning Days New Student Orientation Faculty Preparation Days First Day of Classes Assessment Work Day - No day Classes Advising Day - No day Classes Veterans’ Day - Holiday Observed Thanksgiving - Holidays Last Day of Classes Final Exams New Student Orientation Faculty Preparation Days Grades Due by 4:00 PM Christmas Vacation Christmas Day - Holiday New Year’s Day - Holiday Classes Begin Martin Luther King Day - Holiday President’s Day - Holiday Last Day of Classes Final Exams New Student Orientation Faculty Preparation Days Grades Due by 4:00 PM Spring Vacation Spring Quarter 2016 March 28, 2016 (Monday) April 29, 2016 (Friday) May 30, 2016 (Monday) June 3, 2016 (Friday) June 6-8, 2016 (Monday-Wednesday) June 9-10, 2016 (Thursday- Friday) June 9, 2016 (Thursday) June 10, 2016 (Friday) *Dates are subject to change. Important dates can be found online at www.YVCC.edu/Calendar Yakima Valley Community College, 2015-2016 Classes Begin Spring Holiday (No Classes) Memorial Day - Holiday Last Day of Classes Final Exams Faculty Preparation Days Commencement Grades Due by 4:00 p.m. Yakima Campus COLLEGE DIRECTORY All phone numbers are in area code 509 unless otherwise noted. Admissions 574.4712 admissions@YVCC.edu Adult Basic Skills, Ellensburg 925.4011 Adult Basic Skills, Grandview 882.7028 Adult Basic Skills, Sunnyside 836.8407 Adult Basic Skills, Toppenish 865.4550 Adult Basic Skills, Yakima 574.6850 Aerospace Machining Technology 574.4752 Agriculture 882.7007 www.YVCC.edu/Agriculture Allied Health Technology 574.4913 www.YVCC.edu/AlliedHealthTech Alumni Association 574.1932 American Sign Language 574.4810 Anthropology 574.4808 www.YVCC.edu/Anthropology Art 574.4844 www.YVCC.edu/Art Arts & Sciences Division 574.4871 Associated Students of YVCC 574.4891 Astronomy 574.4869 Athletics 574.4720 www.GoYaks.com Automotive Service Technology 574.6869 www.YVCC.edu/Auto Biology 574.4869 Bookstore 574.4625 www.YVCCBookstore.com BoxOffice 574.4750 Business Administration 574.4796 www.YVCC.edu/BA BusinessOffice 574.4664 Business Technology 574.4796 www.YVCC.edu/BT Career Connection Center 574.4911 Cashier 574.4660 Center of Excellence 574.6863 or 574.3280 coe@YVCC.edu / www.YVCC.edu/CoE CertifiedTraining 574.4911 Chemical Dependency 574.4741 www.YVCC.edu/ChemicalDependency Chemistry 574.4869 Chican@ Studies 574.6800 www.YVCC.edu/Chican@Studies Child Care Services 574.4762 dmgunderson@wa.Easterseals.com Communications 574.4686 Community Relations 574.6870 Computer Labs, Student Tech Center North 574.4981 Coordinator of Special Populations 574.4973 ajaramillo@YVCC.edu Counseling & Advising Center 574.4956 Criminal Justice 574.4794 www.YVCC.edu/CriminalJustice Degree Application Procedures 574.4703 Dental Assisting 574.4956 or 573.5566 Dental Clinic 574.4917 Dental Hygiene 574.4916 www.YVCC.edu/DentalHygiene Disability Support Services 574.4961 dss@YVCC.edu DSS Video Phone 574.4973 DSS IP Address 134.39.160.70 Drama 574.4837 Early Childhood Education 574.4787 or 574.4932 gorgill@YVCC.edu Economics 574.6800 x3226 www.YVCC.edu/Economics Education 574.4997 or 574.4932 eLearning 574.4827 elearning@YVCC.edu Outside Yakima area 1.877.217.9822 Engineering / CADD 574.4752 www.YVCC.edu/Engineering English 574.4834 English as a Second Language (ABE) 574.6850 Enrollment Services 574.4700 Ethnic Studies 574.4807 www.YVCC.edu/EthnicStudies Financial Aid 574.6855 yvccfaid@YVCC.edu Fitness Center 574.4720 Foundation, YVCC 574.4645 www.YVCC.edu/Foundation GED Exam 1-877-EXAM-GED www.YVCC.edu/TestingServices GED Preparation 574.6850 Geography 574.4813 www.YVCC.edu/Geography Geology 574.4817 History 574.4882 www.YVCC.edu/History Housing (Student Residence Center) 574.4885 www.YVCC.edu/Housing Humanities 574.4834 Human Resources 574.4670 yvcchr@YVCC.edu Information 574.4600 Fax: 574-6879 Information Technology 574.4954 www.YVCC.edu/IT International Students 574.4885 www.YVCC.edu/International Jane’s House Early Learning Center 574.4762 dmgunderson@wa.Easterseals.com Larson Gallery 574.4875 www.LarsonGallery.org Learning Centers Ellensburg, Basic Skills/ABE 925.4011 Sunnyside, Basic Skills/ABE 837.9623 Toppenish, Basic Skills/ABE 865.4550 Learning Communities 574.4828 gkoestler@YVCC.edu Library 574.4991 YVCCLibrary.us/Yakima Math Center 574.4862 Mathematics 574.4869 Media Services 574.4982 Medical Assisting 574.4913 Medical Billing and Coding 574.4913 Modern Languages 574.4810 Music 574.4839 www.YVCC.edu/Music Music, Performing Ensembles 574.4839 Nursing 574.4902 www.YVCC.edu/Nursing Nutrition 574.4946 Perry Technical Institute/ YVCC Combined Degree 574.4956 or 453.0374 Pharmacy Technology 574.4913 Philosophy 574.4933 Phlebotomy 574.4913 Physical Education 574.4720 Yakima Valley Community College, 2015-2016 5 6 COLLEGE DIRECTORY Physical Science 574.4869 Physics 574.4869 Political Science 574.4809 www.YVCC.edu/PoliticalScience Professional/Technical Education 574.4755 Psychology 574.4962 www.YVCC.edu/Psychology Radiologic Sciences 574.4932 www.YVCC.edu/RadiologicSciences Registration & Records 574.4700 registration@YVCC.edu Retired & Senior Volunteer 574.1933 Running Start 574.4970 or 574.4971 www.YVCC.edu/RunningStart Security/Parking 574.4610 Social Sciences 574.4834 Sociology 574.6800x3151 or 574.4806 www.YVCC.edu/Sociology Spanish 574.4826 or 574.4814 Speech 574.4686 Speech Lab 574.4816 Student Activities/Programming 574.4775 Student Life 574.4775 Student Residence Center 574.4885 www.YVCC.edu/Housing Surgical Technology 574.4913 Tech Prep 574.6806 Television/Video Production 574.4956 or 573.5520 Testing Services 574.4738 www.YVCC.edu/Placement Theater 574.4837 Transcripts 574.4601 TRiO Student Support Services 574.4995 Tutoring Center 574.4995 www.YVCC.edu/Tutoring Upward Bound 574.6886 www.YVCC.edu/UpwardBound Veterans 574.4715 Veterinary Technology 574.4759 or 574.4758 www.YVCC.edu/VetTech Videophone 574.4973 IP Address 134.39.160.70 Vineyard & Winery Technology 882.7007 www.YVCC.edu/Wine Wellness and Recreation (Fitness Center) 574.4720 WorkFirst 574.4911 Worker Retraining 574.4743 Workforce Education 574.4755 Writing Center 574.4829 www.YVCC.edu/Owl Grandview Campus All phone numbers are in area code 509 unless otherwise noted. Admissions 882.7015 Adult Basic Education 882.7000 Agriculture 882.7007 Allied Health Technology 882.7031 Bookstore 882.7023 Cashier 882.7013 Chican@ Studies 882.7006 Computer Labs 882.7039 or 882.7054 Coordinator Student Services 882.7008 Counseling 882.7042 Disability Support Services 882.7041 English as a Second Language 882.7000 Financial Aid 882.7008 GED Exam 882.7010 GED Preparation 882.7000 General Information 882.7000 FAX 882.7012 Grandview Library 882.7034 www.Grandview.wa.us/Departments/Library Información en español 882.7000 Math Center 882.7008 Registration 882.7015 Running Start 882.7008 Sociology 882.7006 TRiO Student Support Services 882.7041 Tutoring Services 574.7008 Winery & Vineyard Technology 882.7007 Writing Center 882.7073 Mailing Addresses Yakima Campus Correspondence should be addressed to the appropriateofficeat: Yakima Valley Community College, PO Box 22520, Yakima, WA 98907-2520. Grandview Campus Correspondence should be addressed to the appropriateofficeat: 500 West Main Street, Grandview, WA 98930-1284. Learning Centers Ellensburg Learning Center: PO Box 1174, Ellensburg WA, 98926 Sunnyside Learning Center: 2590 Yakima Valley Highway, Sunnyside WA, 98944 Toppenish Learning Center: 516 West 1st Avenue, Toppenish WA, 98948 Español Para mayores informes en español sobre clases de educación, favor de llamar al centro de enseñanza al Yakima Campus: 574.4600 Grandview Campus: 882.7000 Yakima Valley Community College, 2015-2016 THE COLLEGE 7 Yakima Valley Community College (YVCC) is located in south central Washington State and is the third oldest community college in the state. The college has a long tradition of quality in teaching and in its commitment to students. Founded in 1928 as a private two-year college, YVCC became a public junior college under the auspices of the Yakima School District in 1948. In 1967, the Washington State legislature passed the Community College Act, and YVCC became a state community college under the jurisdiction of the State Board for Community and Technical Colleges, one of the best community college systems in the nation. The college’s service district is centered in Yakima County, with outreach programs in Kittitas County to the north and Klickitat County in the south. The main campus is located in the city of Yakima and a branch campus is situated 45 miles southeast in the community of Grandview. YVCC is one of the largest providers of postsecondary education in south central Washington, offeringacomprehensivecurriculumforbachelorofappliedsciencedegrees,associatetransfer degrees to four-year colleges and universities, as well as professional and technical degrees, and basicskillsinstruction.Thecollege’scapablefaculty,supportstaff,andadministrationfocuson maintaining an environment conductive to student success. General Information Mission YVCC enriches and enhances individuals and communities by delivering accessible, student-centered education. YVCC addresses the needs of it's diverse communities by providing learning opportunities in basic literacy; academic, professional, and technical education; and lifelong learning. (Approved Board of Trustees, August 2008) Core Themes Community: YVCC embraces its role as both a provider of higher education and an employer and actively seeks partnerships to provide opportunities for the economic, social, and cultural development of our external and internal communities. Access: YVCC increases access through programs and services that address diverse challenges, learning styles, goals, and schedules of students in the district. Success: YVCC provides learner-centered environments with a focus on its diverse students, providing a foundation for lifelong learning resulting in student achievement of educational goals throughcompletionofcourses,certificates,anddegrees. (Approved Board of Trustees, March 2010) Accreditation and Affiliations The college is accredited by the Northwest Commission on Colleges and Universities, having been reviewed and reaccredited in 2012. Credits earned in many courses numbered 100 or higher are transferable to other colleges and universities nationwide. In addition to the institution being accredited, several Workforce Education Division programs haveearnedspecialaccreditationorrecognitionintheirfieldofspecialty.Additionalinformation on this accreditation or recognition may be found in this catalog in the introductory comments foreachofthefollowingfieldsofstudy:thealliedhealthtechnologiesofmedicalassistingand surgical technology, automotive service technology, dental hygiene, nursing, radiologic sciences, and veterinary technology. YakimaValleyCommunityCollegeisaffiliatedwiththeAmericanAssociationofCommunity Colleges. Further information on YVCC’s accreditation can be obtained by contacting the President’sOffice. Governance YakimaValleyCommunityCollegeisgovernedbyafive-memberboardoftrusteesconsistingof citizens who reside throughout Community College District 16. Board members are appointed by the Governor. Yakima Valley Community College, 2015-2016 THE COLLEGE 8 Faculty and Staff There are 114 full-time members of the faculty plus many part-time instructors. The faculty is well qualifiedbyvirtueofadvancededucation,training, and experience. The faculty take pride in teaching, its primary duty, and has distinguished itself by dedicated and capable leadership in education and in the community. In addition to our faculty, there areapproximately24administrators,143classified staff,and36exemptprofessionalstaff. Students In Fall quarter 2014, YVCC Yakima Campus served over 4,550 students. Of these, 69% were full-time; 35% male; 30% were under 20 years of age, 46% were 20-29, 14% 30-39, and 10% were 40 and over. The average age was 26. Fifty-seven percent were students of color with 48% Hispanic and less than 1% international students. In Fall quarter 2014, YVCC Grandview Campus served over 770 students. Of these, 47% were fulltime; 32% were male; 24% were under 20 years of age, 42% were 20-29, 16% were 30-39, and 18% were 40 and over. The average age was 29. Eighty-four percent were students of color with 81% Hispanic and less than 1% international students. Source:OfficeofInstitutionalEffectiveness. For Grandview Campus student data, reference page 10. Advisory Committees YVCC’s advisory committees, comprised of business leaders and community members, are established to advise, assist, and provide support and advocacy for quality professional/technical education. It is through these roles that advisory committees work with instructors and administrators to initiate policies, procedures, and methods that help plan and strengthen educational programs. Agriculture Allied Health Technologies Automotive Service Technology Business Administration Business Technology Chemical Dependency Criminal Justice Dental Assisting Dental Hygiene Early Childhood Education Engineering/CADD Information Technology Institutional Animal Care/Use Nursing Radiologic Sciences Tech Prep Veterinary Technology Vineyard & Winery Technology Financial Aid Worker Retraining/Worker Retraining Yakima Valley Community College, 2015-2016 Learning Options YVCCoffersfourquartersofclassesthroughout the academic year including fall, winter, spring, and summer on the Yakima and Grandview campuses.Thecollegeoffersavarietyofacademic, professional/technical, and community service classes during the day and evening. Courses are alsoofferedindifferentmodesofdeliveryincluding face-to-face, online, and hybrid. Community input on course sections that represent the greatest community need is welcomed. Please contact the Arts & Sciences Division or the Workforce Education division for further information. eLearning (online classes via the internet) www.YVCC.edu/eLearning YakimaValleyCommunityCollegeofferscredit courses through various modes of learning. These coursesaredesignedtoallowflexibilityforstudents. Thedifferentmodesofonlinedeliveryare: • Completely online classes: Classes do not meet face-to-face at any time. However, the instructor may request students to attend an orientation session. These sessions are rare and in most cases can be delivered in a recorded format for far distance or time restricted students. These courses may require proctored exams. • Hybrid: These courses are a combination of online content and face-to-face contact. When looking at the online schedule if there are weekly days listed, these will be the meeting days for the hybrid class. • Caution! When using the online schedule, please be aware if you see days listed these are required face-to-face contact day(s) for the class. Enhanced: Face-to-face classes can be enhanced with online content. No class time can be replaced with online time. These classes will often contain syllabus, course materials, notices from your instructor, and possibly grades. You may be required to upload work to your instructor using the LMS or take tests online in this mode. The current Learning Management System (LMS), is Canvas and can be reached by typing: yvcc.Instructure.com into the address bar of your internet browser. The hardware/software recommendations for a successful online learning experience are: Computer Specifications: Canvas and its hosting infrastructure are designed for maximum compatibility and minimal requirements. Screen Size • Computer or notebook with a minimum screen resolution of 1024x600. That is the average size of a notebook (most brands). Viewing Canvas on a smaller screen is not recommended. THE COLLEGE 9 Operating Systems • Windows XP or newer • Mac OSX 10.6 and newer • Linux - ChromeOS Mobile OS Native App Support • iOS 5 and newer • Android 2.3 and newer Computer Speed and Processor • Use a computer 5 years old or newer when possible • 1GB of RAM • 2 GHz processor Internet Speed • Along with compatibility and web standards, Canvas has been carefully crafted to accommodate low bandwidth environments. • Minimum of 512 kbps • Online courses require access to the internet, either at home or in one of the open computer labs on campus. Dial-up connections are not recommended. If this is the only access available, plan to spend time in the college’s computer lab. • Screen Readers: The latest versions of JAWS and VoiceOver Communityserviceclasses,offeredasnoncredit, and activities which pertain to special interests and communityneedsareofferedandarefinancedona self-support basis. Course Fees: eLearing courses may have lab fees. Check the course schedule for a list of any fees associated with each class. Advantages: • Students in learning communities tend to stay in school. National and local statistics indicate that students in learning communities tend to stay in school. College canbeintimidating,especiallyforfirst-time, first-generationcollegestudents;however, instructors — such as the ones students will meet and get to know well in learning communities — are familiar with how the campus community works and so are able to better answer questions about degree or certificateadvising,financialaid,orothercollege questions. • Get to know your instructors. Depending on the number of classes linked, students will have more contact with their instructors, as many learning communities have both or all instructors and students in the room during both or all classes. And, because most teachers were themselves good college students, learning community instructors can help students learn what it takes to survive a new class, pick a major, or launch a career. • More time with like-minded, supportive students. Very often, the students in learning communities have the same degree goals — nursing, information technology, four-year transfer degrees — in mind when they register. So students will meet like-minded friends who can support each other as long as they take classes at YVCC. They may be in the same classes and may study together quarter after quarter. Exams & Testing: Most online instructors will require proctored exams or tests. Local Yakima and Grandview students are required to use the campus testing labs for any proctored tests. Students outside thelocalareacanpetitiontouseanoff-campus proctor.Theformtorequestanoff-campusproctor can be found on the eLearning Web page at: www.YVCC.edu/Academics/eLearning/Pages/ TestProctoring.aspx Off-campusproctorscannotberelatedtothe student in any way. Acceptable proctor sites are: other college testing labs, formal testing/tutor companies, and local libraries. All proctors will be contacted and unacceptable proctors will be denied. eLearningcourseofferingsvaryeachquarter.Check the class schedule. Students can search by online only or by campus, Yakima or Grandview. For more information on eLearning, please call the eLearning Officeatthephonenumberlistedinthefrontofthis catalog or visit: www.YVCC.edu/eLearning Evening Courses YakimaValleyCommunityCollegeoffersthe opportunity for individuals with commitments during the daytime hours to participate in extended degreeandcertificationprogramsintheevening. Additionally,eveningcoursesoffertheopportunity to update or acquire new skills in a variety of employmentfields. Learning Communities and Integrated Learning A learning community is a collection of students, instructors, and classes linked by a common idea, theme, or public issue. Such themes could include “Matters of Life and Death” (Biology and English), “Magellan to Mozart” (History and Music), “Crimewriters, Ink” (Criminal Justice and Composition), “Climate and Calculations” (Mathematics and Geography), or “Reading, Writing, Ready for College” (Reading and Developmental Writing). The issues could include euthanasia, global warming, or fear of mathematics. “Integrated Learning” may be the result of a learning community assignment, but it also can take place between two disciplines with a common goal, outcome, or experience, such as a case study review (Biology and Nursing), not linked by a formal “community.” Some say that “reality is integrated,” so our learning should reflectthatreality. Yakima Valley Community College, 2015-2016 10 Grandview Campus THE COLLEGE The Grandview Campus provides comprehensive educational services that are accessible to students in the southern portion of YVCC’s service district. Students from Grandview, Granger, Mabton, Prosser, and Sunnyside take developmental, professional/ technical, and college transfer courses here. The campus serves approximately 1,600 unduplicated students a year. Approximately 100 of these students are high school students in the Running Start program and 40 percent are in Adult Basic Education/English as a Second Language programs. Of students enrolled, 69 percent are female and 80 percent are ethnic minorities. TheGrandviewCampusofferscoursesthat support a variety of student goals. Students can earn transferable associate in arts and associate in business degrees at the campus. Additionally, thecampusoffersprofessional/technicaldegrees including associate of applied science degrees in vineyard technology, winery technology, medical assisting, and medical billing and coding. Students canalsocompleteacertificateinphlebotomyaswell asoneofseveralinformationtechnologycertificates. Courses are also available that apply to various vocational and transferable degrees on the Yakima Campus in areas such as agriculture, early childhood education, elementary education, allied health, business, criminal justice, and natural sciences. Finally, individuals may enroll in English as a Second Language classes, while others can pursue a General EducationalDevelopment(GED)certificateoradult high school diploma. To facilitate the learning of students,theGrandviewCampusoffersacomplete arrayofstudentservicesincludingadvising,financial aid, admission, registration, cashiering, disability support, bookstore, GED Testing, and placement testing services. The campus is also equipped with an open-access computer lab, textual reference materials, online research databases, and tutoring centers. YVCC and the city of Grandview jointly operate a city/college library on the Grandview Campus. Recognizing the obstacles of time and location, the GrandviewCampusoffersclassesduringthedayand evening to make learning opportunities accessible to working students. Moreover, students may take eLearning courses via interactive television (ITV) and the Internet so they do not have to travel to the Yakima Campus. Please contact Grandview Campus at 509.882.7000 for the most up-to-date information regardingcourseofferingsandservicesprovided. Source:OfficeofInstitutionalEffectiveness Yakima Valley Community College, 2015-2016 Hispanic-serving Institution Yakima Valley Community College is designated by the US Department of Education as a Hispanicserving Institution. A Hispanic-serving Institution (HSI)isdefinedasanon-profitinstitutionthathas at least 25% Hispanic full-time equivalent (FTE) enrollment. Beginning in 2002, Yakima Valley Community College received the designation along with a Title V grant allowing the college to strengthen the institution for all students and faculty. The college has received additional Title V grants in subsequent years and the funds allow YVCC to focus on projects that range from student support programs to classroom technology. Additional information can be found at www.YVCC.edu. Non-Discrimination Statement Yakima Valley Community College is an Equal Opportunity Employer and operates under an AffirmativeActionPlaninaccordancewithapplicable federal and state laws and regulations. It is the policy of Yakima Valley Community College to provide a working and learning environment free from discrimination, harassment, and retaliation. This policy prohibits conduct that discriminates against individuals based on their race, color, creed, religion, national origin, sex, sexual orientation and/ or gender identity, age, marital status, disability, honorably discharged veteran, or military status. This policy also prohibits retaliation as a result ofanindividualfilingareportofdiscriminationor harassment or participating in an investigation of a claim of discrimination or harassment. This policy applies to all programs and facilities, including, but not limited to, admissions, educational programs, and employment. Yakima Valley Community College complies with all Washington State anti-discrimination laws (RCW 49.60) and the following federal laws relating to equal opportunity: Title VI and VII of the Civil Rights Act of 1964, Title IX of the Educational Amendments of 1972, Section 504 of the Rehabilitation Act of 1973, the Age Discrimination Act of 1975, and the Americans with Disabilities Act (ADA) of 1990. Yakima Valley Community College is committed to providing access, equal opportunity, and reasonable accommodation in its services, program, activities, education, and employment for individuals with disabilities. The College will take steps to ensure that the lack of English language skills will not be a barrier to admission and participation in vocational education programs. Coordinationofthecomplianceeffortsof Yakima Valley Community College with respect to equal opportunity and disability accommodation regulations is under the direction of the Director of Human Resources, Yakima Valley Community College, 1015 South 16th Avenue, Yakima, Washington, 98902; telephone 509.574.4670. Updated: September 2013 ADMISSION 11 Yakima Valley Community College is committed to an open-door policy and encourages the use of its postsecondary educational opportunities and services by all U.S. citizens or residents, 18 yearsofageorolder,whoareinterestedinandcanprofitfromcollegeprograms.Adults,whether or not they possess a high school diploma, may enroll at the college without regard for their past educationalrecord.Thechiefcriterionisthatapplicantscanbenefitfromcollegeprograms. General Admission Alldegreeandcertificateseekingstudents,bothfull-timeandpart-timeenrollingincredit-bearing classes, must complete a general admission application except for Adult Basic Education, English as a Second Language, International Students, Running Start, and Gold Card/space available enrollment. Please note: There are admission application deadlines prior to the start of each quarter.PleasecontacttheAdmissionsOfficeconcerningthesedeadlines.Whenapplying,the following steps should be followed: 1. Complete a Community and Technical College Application for Admission, available online at the YVCC website (www.YVCC.edu), then mail the required nonrefundable application fee to the CashiersOfficeorpayinpersonattheCashiersOfficeintheDeccioHigherEducationCenter. 2. Prepare for the placement test. Placement scores are used to place students into appropriate level courses with the ultimate goal of improving student success in the classroom. Preparation guides for the placement tests can be found on the Testing Center website. 3. Complete the placement test. Students with concerns about their placement scores should see their assigned advisor or a counselor. Placement test fees are nonrefundable. 4. SubmitanofficialcopyofallpreviouscollegetranscriptstotheYVCCAdmissionsOffice. Transcriptsmustbemaileddirectlytothecollegeorpresentedbythestudentinanofficially sealed envelope. 5. Oncetheabovestepshavebeencompleted,thestudentwillreceivenotificationand information, when appropriate, about new student orientation and registration. The application for admission is valid for four consecutive quarters (excluding summer quarter). 6. Certain professional /technical programs have Selective Admission processes. There are also special admission processes for Basic Skills, International Student, Running Start, Underage Student Admissions, and Bachelor of Applied Sciences Programs. Please refer to the Selective and Special Admission sections of the catalog. Additional information may also be found on the website (www.YVCC.edu). Former Students Former students who have not attended YVCC for the preceding four quarters (excluding summer quarter) are required to reapply for admission to the college. Part-Time Students Students enrolling in fewer than 12 credits are required to follow the general admission guidelines if they are pursing a transfer degree or wishing to enroll in a professional/technical program. Students wishing to enroll in English, math, or any course with a placement test score requirement must take the placement test. Students enrolling in 12 or more credits are considered full-time. Selective Admissions in Professional/Technical Programs Certain professional/technical programs in the Workforce Education Division have additional admission requirements. Admission to YVCC does not guarantee entrance to the following programs. Students must meet the application deadlines and entrance requirements prescribed by the program. DentalAssisting Nursing NursingAssistantCertified(NAC) Pharmacy Technology Dental Hygiene Surgical Technology Phlebotomy Medical Assisting Veterinary Technology Radiologic Sciences Medical Billing and Coding To be considered for programs with selective admissions, please: • Refertospecificprogramrequirementsinthiscatalogand/orwebsite. • Contact the department directly for an application packet. • Submit all required paperwork by the program deadlines. • Complete all required prerequisites. Yakima Valley Community College, 2015-2016 12 Basic Skills ADMISSION All persons 16 and over are eligible for Basic Skills instruction. All students must complete the registration process to be enrolled. Basic Skills students pay $25.00 tuition each quarter. The primary emphases in Basic Skills are basic reading, writing, math, and English as a Second Language (ESL). Students may learn to understand, speak, read, and write English; prepare for the GED; upgrade skills for success in college; or prepare for entrance into occupational programs or employment. Day and evening Adult Basic Education and ESL classesareofferedinmanylocationsthroughoutthe YVCC service district. Questions regarding admission to Basic Skills classes should be directed to the Ellensburg Learning Center, Grandview Campus, Sunnyside Learning Center, Toppenish Learning Center, or the Yakima Campus. For additional informaiton, reference "Adult Basic Education" in the course section of this catalog. International Student Program YakimaValleyCommunityCollegeoffersafriendly International Student Program, which gives personal attention from the moment of application all the way through to transfer or graduation. We will do what we can to make the student’s time in the United States enjoyable and rewarding; however, we will challenge students to do the best they can and to succeed. Acceptance and admission into the college is based on a thorough review and evaluation of thestudent’sentireapplicationfile.Pleaseallowa minimum of eight weeks to process the application. Oncestudentshavefulfilledalladmission requirements, they will receive a letter of acceptance and Form I-20 that they must take to the American Embassy or Consulate in order to apply for an F-1 visa. The I-20 cannot be sent until all documentation and a $30.00 application fee are received and the student is formally admitted to college. Application Requirements 1. AnofficialInternationalStudentApplication Form. 2. A nonrefundable application fee of $30.00. Current fees are subject to change. 3. Officialcopiesoftranscriptsfromhighschools, national exams, intensive English-language programs, and all colleges or universities attended (translated into English). These must be sent directly to YVCC from the issuing institution or testing center. Students who wish to transfer credit from international institutions must have their international transcripts evaluated through the American Association of Collegiate RegistrarsandAdmissionOfficers(AACRAO)or the Foundation for International Services (FIS). Yakima Valley Community College, 2015-2016 ContacttheInternationalStudentProgramOfficeor theAdmissionsOfficeformoreinformation. 4. Evidence of English competency which will allow successful completion of course of study. Please submit at least one of the following (minimum scores or better): • TOEFL (Test of English as a Foreign Language) with minimum scores or 487 (paper-based), or 163 (computer-based) or 57 (Internetbased), or • IELTS (International English Language Test System). A minimum scored of 5.0 is required, or • TOEIC (Test of English for International Communications). A minimum score of 850 is required, or • STEP/EIKEN (Society for Testing English Proficiency).AminimumscoreofPre-1is required, or • Officialverificationofsuccessfulcompletion of another nationally-recognized test of English competency, or • Proof of successful completion of an advanced level of English at an approved English language center in the United States with a grade point average of 2.0 or above, or • Successful completion of Central Washington University’s English as a Second Language Program (UESL) program, or • Three (3) credits of college-level English composition from an accredited U.S. college or university with a grade of C (2.0) or better, or • Proof of successful completion of at least 3 years of high school English in the United States. 5. *TOEFL, IELTS, TOEIC, and STEP tests must have been taken within two years immediately preceding the requested quarter of admission. Prospective students applying from abroad must submit official test score reports to the college. Please note that all new students are required to complete a placement test (COMPASS) in English and math after arriving and before they enroll in their first quarter at YVCC. Washington State law requires full-time students to show proof of immunization against measles, mumps, and rubella. 6. Thefinancialstatementmustbecompletedbya bankofficialand/orsponsorandsubmittedwith proofoffinancialability.Youmustshowassured supportforthefirstyearandprojectedsupport for the total years needed to complete your degree. Documents should not be more than three months old. Faxed or scanned copies of bank statements are initially accepted, but YVCC requires an original copy of the document for additionalverification. 7. ADMISSION International Students are required to purchase or show proof of health insurance for a minimum of nine months (one-academic year). Once accepted to Yakima Valley Community College, students cannot register for classes until they have purchased or provided proof of medical coverage. Please contact the International Student Program for more details. The college does not have grants, scholarships, loans,orotherformsoffinancialassistance available to international students. On-campus employment is limited, so international students cannot expect to work after arrival. While not required to live on campus, international studentsareencouragedtodosoforthefirst year in order to share cultures and ideas in a safe, inexpensive, friendly, and informal atmosphere. For further information, please visit our website at www.YVCC.edu/International. Placement Reciprocity Students may use the placement given from another Washington State Community or Technical College’s testing center instead of YVCC’s recommended placement. Students that qualify for placement test reciprocity should complete the Placement Reciprocity Request Form. The form is available on the YVCC website. The form should be submitted totheAdmissionsOfficeoncetheofficialscores from the previous Washington State Community or Technical College have been received by YVCC. Running Start The Running Start Program is a partnership between YVCC and Washington State public high schools. Theprogramofferseligiblehighschooljuniorsand seniors the opportunity to take classes that satisfy both high school and college credit requirements, get a head start on earning college credits, seek a greater academic challenge, or take courses that arenotofferedinhighschool.Studentsmayenroll simultaneously in high school and college classes or solely in college classes. To participate in this program, students must place into college-level English and MATH 085 on the YVCC placement test. Students are responsible for their own transportation, college fees, and textbooks. For more information or an application, visit our website www.YVCC.edu/RunningStart or talk with a high school counselor. 13 Tech Prep Yakima Valley Community College and the Yakima ValleyTechPrepconsortiumarepleasedtooffer direct transcription. We are one of 28 community and technical colleges across the state that has entered into this arrangement with local high schools. Tech Prep students remain enrolled in their high school. When enrolled in a Tech Prep articulated class, students in the class meet the same requirements as students who take the class at the college. At the end of the course, the high schoolteachernotifiestheTechPrepcoordinator at the college of all students who passed the class with a grade of B or higher. Credit is not available to students who earn below a B. In order to receive direct transcription credit for Tech Prep coursework, students must submit a registration form for the classes they have successfully completed. There is no charge for direct transcription credits. For more information, including a current list of articulated classes, please call the Tech Prep coordinator at the phone number listed in the front of this catalog. Underage Student Admission Yakima Valley Community College does not desire to replace or duplicate the functions of the local public schools in regard to providing instruction to students under the age of eighteen. For applicants under the age of 16, academic as well as emotional maturity are of particular concern; however, the college does recognize that there are certain circumstances when anunderageapplicantwouldbenefitfromcollegelevel coursework. To respond to the needs of those students, the college has established the following special admissions policy. Students are responsible for tuition, class fees, books, and class supplies. 1. Any applicant not qualifying for admission through regular admissions procedures or qualifying for an established program must request consideration of admittance under the special admissions procedure. 2. Before students can attend class the request for admittance must be reviewed and approved by the Admissions Committee. 3. If the student is accepted they will receive a welcome/email with instructions on how to proceed with the registration process. 4. A personal interview with the Admissions Committee may be requested at the discretion of the committee. 5. Students admitted under the special admission procedure: • Will be admitted on a course-by-course basis. Yakima Valley Community College, 2015-2016 14 • 6. ADMISSION Will be allowed to register for class if space is available after the class has met at least once or after the third day of the quarter, whichever is later. • Must have the underage special admissions advisor’s approval before adding or dropping a course. Any student who received probation, suspension, or dismissal status on YVCC transcripts will not be admitted under special admissions. Determine your application track and follow instructions: Audition Based Music or Drama Performance Course 1. After audition, complete Underage Special Admissions application 2. Complete Walk-in Registration Form 3. Complete Supplemental Application/Registration Form 4. Attach instructor permission/entry code (usually an email) 5. Send all documents together to: Yakima Valley Community College Attn: Underage Special Admissions PO BOX 22520 Yakima, WA 98907 or DropthemoffatRegistrationintheDeccio Higher Education Center 1000 S. 12th Ave. Yakima, WA Academic Based College-level courses such as History, Science, Math, English etc. 1. Complete Underage Special Admissions application no later than two weeks before the start of the quarter 2. Complete Walk-in Registration Form 3. Complete Supplemental Application/Registration Form 4. Submit a signed release from a school or school districtofficial-(Ifthestudentwillbeleaving high school during the regular school day.) 5. Submit a letter of recommendation from a school representative (teacher, counselor etc.) addressing the student’s ability to participate successfully in an adult learning environment 6. Send all documents together to: Yakima Valley Community College Attn: Underage Special Admissions PO BOX 22520 Yakima, WA 98907 or DropthemoffatRegistrationintheDeccio Higher Education Center 1000 S. 12th Ave. Yakima, WA Yakima Valley Community College, 2015-2016 7. Dependent upon the courses requested, students may be required to complete the COMPASS test to demonstrate competency and the ability to benefitfromcollegelevelcoursework.Once the application has been reviewed the student will be contacted if the COMPASS test is required. Veteran Status Selected programs of study at Yakima Valley Community College are approved by the Workforce Training and Education Coordinating Board's State Approving Agency (WTECB/SAA) for enrollment of thoseeligibletoreceivebenefitsunderTitle38and Title 10, USC. Yakima Valley Community College does not and will not provide any commision, bonus, or other incentive payment based directly or indirectly on successinsecuringenrollmentorfinancialaidtoany persons or entities engaged in any student recruiting or admissions activities or in making decisions regardingtheawardofstudentfinancialassistance. TheU.S.DepartmentofVeteransAffairswillpay educationalbenefitstoeligiblestudentsenrolledin approved programs. Students should contact the VeteransOfficetocompletetheapplicationprocess. Copies of all transcripts from previous colleges must beonfilewhenapplying,oronlytwoquarterswill becertified.VeteransshouldalsosendYVCCacopy of their Joint Services Transcript when they apply for admission. This can help prevent an overpayment of VAbenefits. YVCC grants academic credit for prior military training for training that is applicable to a student's certificateordegreerequirements.Inorderto grant credit for documented military training or experience, the student must submit their Joint ServicesTranscript(JST)totheAdmissionsOfficeand thecorrespondingcoursemustbeofferedbyYVCC. Military programs and classes will be evaluated by each department at YVCC to determine if a course equivalency exists. For a list of military training programs and classes that qualify for academic credit, please visit the Transfer Credit page on the Admissions website. An advance payment, which is sent to the school, mayberequested.Benefitsfortheprecedingmonth are paid directly to the student. The monthly amount is based upon the enrolled credits that count toward the approved program. If enrollment status is: • Full time: 12 credits or more • 3/4 time: 9 to 11 credits • 1/2 time: 6 to 8 credits • Lessthanhalftime:contacttheVeteransOffice ADMISSION 15 Allstudentsreceivingveteransbenefitsmust maintain adequate progress toward their degree. To verify satisfactory progress, monthly reports of attendance and progress are requested from instructors. VA recipients who fail to maintain minimum standards (2.0 GPA) are subject to academic probation or suspension. This could result inthereductionorcancellationofbenefits. Students are responsible for providing necessary information and changes, such as program, credit load, address correction, or any other change that mayaffecttheirVAstatus.Studentsmustcontactthe VeteransOfficeafterregisteringeachquarter. Deployed veterans returning to YVCC within one year after returning from deployment do not need to reapply for admissions. Students must provide the VeteransAffairsOfficewithacopyoftheirorders. Catalogcertifiedastrueandcorrectforcontent and policy. For additional information and assistance, contacttheVeteransAffairsOffice. Yakima Valley Community College, 2015-2016 REGISTRATION 16 Newstudentsworkingtowardadegreeorcertificatearegivenadatefororientationand registration after completing the college admission placement testing process. When students areplacedincourseswhichreflecttheiracademicskilllevel,theyaremorelikelytosucceedin college.Studentsmayberequiredtoregisterforaspecificsetofclassesbaseduponplacement resultsandintendeddegreeorcertificate.Studentsreceivenoticeofspecificdatesonwhichthey may register prior to the start of the quarter for which they applied. All student registrants must pay tuition and fees in accordance with published tuition deadlines. During the regular academic year, all students are given an opportunity to confer with their advisors, plan their programs for the upcoming quarter, and register in advance. This usually occursduringtheeighthorninthweekofthequarter,withtuitionandfeesdueonaspecified date prior to the beginning of classes. How to Register Evening YVCCoffersavarietyofon-campuseveningopportunitiesforclasses,activities,andservicesto persons who may not be able to pursue day studies. Registration for these classes, activities, or services is conducted by mail, on the web, or in person during assigned registration dates. Registration dates are listed in the important dates. Late registration is discouraged and an instructor signature is required to add a class once the quarter has started. The Registration & RecordsOfficewillbeopenuntil6:00pmonthefirsttwonightsofthequartertoaccommodate evening students. Full payment must accompany all registrations. Summer Therearenoapplicationsorappointmentsneededforsummerquarter.Registrationisonafirstcome,first-servedbasis.Summerquarterattendancedoesnotensureadmittancetofallquarter. Website All full-time and part-time students who have attended YVCC within the last year may register for classes by using the YVCC website. (Go to www.YVCC.edu, click “Student Portal,” then “Registration”, then “Add or Drop, Register classes.”) Thismethodoffersstudentstheconvenienceofregisteringinthecomfortoftheirhomesor anywhere they have access to a computer connected to the internet. Students may use a home computer to access the YVCC website. Access to the YVCC website is also available in designated computer labs on campus and at kiosks on the Grandview and Yakima campuses. The Student Portal allows students to conduct business concerning registration, schedule changes,viewingtheclassschedule,grades,financialaid,admissionapplicationstatus,and registration appointments. Academic Blocks Students who have been placed on academic suspension/dismissal or who have outstanding debtstothecollege,e.g.,parkingfines,libraryfines,dormitorycharges,orinstructionalmaterials due,willnotbeallowedtoregisteroradd/dropuntilthesehavebeencleared.Norwillofficial transcriptsordiplomasbereleaseduntildebtsarecleared.TheRegistrationandRecordsOffice requires 24 hours to process the release of a block on student records. Yakima Valley Community College, 2015-2016 REGISTRATION Changes to Registration Add/Drop Beginningonthefirstdayofthequarter,students must obtain permission from the instructor (the instructor’s signature) to add a class. Students may addorchangeenrollmentsectionsduringthefirst fivedaysofthequarter;however,permissionofthe instructor is also required. Forthefirstfivedaysofthequarter,students may drop classes from their schedules from the YVCCwebsiteorinperson.Afterthefirstfivedays, students may only drop classes in person. Courses dropped through the 10th day of classes do not appear on the transcript. Courses dropped from the eleventh day to threeweekspriortofinals(seventhweekofthe quarter) will appear on the student’s transcript as a “W”. Students who stop attending classes without officiallydroppingmayreceivean“F”ora“V”grade at the discretion of the instructor. Classes concentrated within shorter than tenweek sessions are given deadlines proportionate to the standard length of a quarter. For summer quarter deadlines, consult the class schedule forspecificdates.Schedulechangesarethe responsibility of the student. Failure to change enrollmentorwithdrawofficiallyconstitutes sufficientcausetoreceivewhatevergradethe instructor deems appropriate. Withdrawal from College All students wishing to withdraw from college (dropallcourses)duringthefirstfivedaysofthe quarter may do so by using the YVCC website or by completing an add/drop/withdrawal form which they musttaketotheRegistrationandRecordsOffice for processing. Students who stop attending classes withoutofficiallywithdrawingmayreceivean“F”ora “V”gradeontheirtranscripts.Forofficialwithdrawals completed during days one through ten, no record will appear on the transcript. The last day for withdrawal from college is the same as that for dropping a course: three weeks priortothebeginningoffinalexamsorasspecified for summer quarter or shorter sessions. Withdrawals processed during this period result in “W” grades being entered on the permanent transcript. For additional information, please contact the RegistrationandRecordsOffice. Students must not assume they will be dropped from a class if they stop attending. Failure to drop a class may result in a “F” grade. 17 Waitlist When a class has reached maximum enrollment limit, students may place themselves on a waitlist for the class. This won’t guarantee a spot, but if one becomesopenthefirstpersononthewaitlistwill be automatically registered into classes according to their placement on the waitlist. On the Sunday before the quarter begins, the automatic registration of students on the waitlist will stop. Once the waitlist isnolongeractive,studentsmustattendthefirstday of class and the faculty member will decide whether or not to sign in students regardless of their status on the waitlist. Placing yourself on a waitlist does not count as registered credit. Students receiving funding based onaspecificnumberofcreditsmustpaytheirtuition to meet their funding requirements or they will be dropped from their classes. Due to high enrollment, students cannot register fordifferentsectionsofthesamecourseinthe same quarter or be on more than four waitlists. The RegistrationOfficeeditsfortheseoccurrencesand will remove students from second class selection. Helpful Hints • Use the Student Portal at www.YVCC.edu to check your waitlist status. Remove yourself from waitlistsonlineorwithregistrationstafffrom Yakima/Grandview campuses. • Remove yourself from classes you no longer want on the waitlist otherwise you may be automatically enrolled. • Check the status of your waitlist position on a daily basis. • Place yourself on a maximum of four waitlists, don’t register for one section and add yourself to adifferentsectionofthesameclass. • If you choose to seek a signature to enroll, you mustbeintheclassthefirstdayitmeets.There is no guarantee the instructor will sign you into the class. Yakima Valley Community College, 2015-2016 18 Fees & Rates TUITION, FEES & EXPENSES Thefollowingratesareineffectfor2015-2016andaresubjecttochangewithoutnotice: • Applicationfee:YVCChasa$30applicationfee,and,inaddition,somespecificprofessional/ technical programs may require an application fee. • Placement test fee is $20.00 and is nonrefundable. Fees are to be paid at the time of the test. • Audit fees are paid at the same rate as regular tuition. • International Student Application fee is $30.00 and is required for new international students and those returning after an absence of one or more years. • Lab fees vary. • Combined service fees are $4.50 per credit with a maximum of $45.00 per quarter. • Technology use fee is $4.50 per credit. • ELearning fee is $3.00 per credit. • Graduation Application fee is $10.00, charged no more than once per academic year for processingastudent’sdegreeandcertificateapplication. • YVCC/Yakima Valley Technical Skills Center (YV-Tech) fees are required for all collaborative programs: $715.00 plus additional applicable fees per quarter. YVCC classes are charged regular YVCC per-credit fees. Registration fees and tuition are to be paid in accordance with tuition deadlines. Students who havenotpaidbythespecifieddeadlinewillbedroppedfromclasses. Note: All tuition and fee rates are subject to change without notice. Tuition Waivers The State Board for Community and Technical Colleges authorizes and the YVCC Board of Trusteesapproveswaiversoftuitionandfeesforstate-supportedclassestospecificstudent populations, listed below. These waivers do not apply to contract or self-support courses. The availability of these waivers is determined on an annual basis. Please contact the Enrollment ServicesOfficesatthephonenumberlistedinthefrontofthiscatalogforspecificinformation. • Senior citizen/Gold Card/60+ years of age • State employee/permanent full- or half-time (20+ hours a week) • Veterans, veterans’ dependents and spouses, National Guard, and selected Reservists Veterans Some veterans may be eligible for government funding or reduced tuition rates. Please contacttheVeterans’Officeatthephonenumberlistedinthefrontofthiscatalogforspecific information. Debts & Student Financial Obligations Registration is not complete until all tuition and fees have been paid in full and the payment has cleared. Tuition and fees can be paid online using e-check, Visa, and MasterCard (www.YVCC. edu>Student Portal), in person at the cashier’s counter, or by mail. Checks issued to the college for tuition, fees, or any debt and returned unpaid for any reason will constitute nonpayment. A $25.00 fee is assessed on all returned checks. Students will be administratively blocked from making changes to their existing class schedule, registering for or droppingclasses,receivingdisbursementsorrequestingofficialtranscriptsuntilthecheckandfee is paid in full. YakimaValleyCommunityCollegereservestherighttowithholdofficialtranscriptsorblock futureregistrationforanystudentwhohasdelinquentfinancialobligationstothecollege.All outstanding amounts resulting from nonpayment of tuition and fees are the responsibility of the student. Withdrawal from school, officially or unofficially, or non-attendance will not cancel any financial obligation already incurred.Additionally,failuretopayallfinancialobligations may result in debts being turned over to a collection agency. A $25 fee is assessed on all accounts sent to collection. Collection costs, including attorney fees and other charges necessary for the collection of any amount due, will be added to the students account balance. Refer to YVCC Policy and Procedure Manual, section 1.33. Yakima Valley Community College, 2015-2016 TUITION, FEES & EXPENSES Washington State Residency Residency status for tuition and fee purposes is determined by RCW 28B.15.012 et seq. Aresidentstudentisonewhois(a)financially independentandhasatwelve-monthbonafide domicile in the state of Washington for other than educationalpurposesor(b)financiallydependent upon parents or legal guardians, one or both of whommaintainabonafidedomicileinthestateof Washington. The term “domicile” denotes a person’s true,fixed,andpermanenthomeandplaceof habitation. Financial dependence or independence shall bedeterminedbytheamountandkindoffinancial assistance given to a student and whether or not the student has been claimed as a deduction on income tax forms in the year immediately preceding the quarter for which residency is sought. An independent student who comes to Washington and immediately enrolls at an institution of higher education for more than six credit-hours is assumed to be in the state primarily for educational purposes and cannot establish residency until clear proof is provided showing that she has established apermanent,bonafidedomicilewithconcurrent relinquishment of the prior legal residence. Note: A student cannot qualify as a legal resident of Washington for tuition calculation purposes if they possess a valid out-of-state driver’s license, an outof-state vehicle registration, or other documents that give evidence of legal residency in another state. Onceastudenthasbeenclassifieda nonresident,theclassificationwillremainuntil the student completes a residency questionnaire and supplies evidence that supports a change in residency status. Application for a change in residency status and all supporting evidence must besubmittedtotheAdmissionsOfficebythe30th calendardayfollowingthefirstdayofthequarter for which the change is requested. Any questions regarding residency should be directed to the AdmissionsOffice. Persons who have completed three full years in a Washington State high school and those who have earned a GED after three full years of living inWashingtonStatebutwhodonothaveofficial residence in Washington may contact the Admissions Officetodetermineeligibilityforresidenttuition. Active Duty Military and National Guard Active duty military personnel stationed in Washington and their spouses and dependents are considered residents for tuition and fee-paying purposes. Active duty Washington National Guard members are considered residents for tuition and fee-paying purposes; their spouses and dependents are considered residents only if they reside in Washington. Refund Policy Refundsaremadeforofficialwithdrawalsonly, and no refund will be given for an amount of less than $10. No refunds will be given if an instructor withdrawsastudentafterthefirstweekofthe quarter. All refunds are determined by a formula based upon when the withdrawal is made relative to the beginning of the class. Attendance or nonattendance is not considered when granting refunds. Complete withdrawal fees are assessed whether or not students actually attend class. There is a fee of $5 for a complete withdrawal of 11 or fewer credits (part-time), and a fee of $10 for a complete withdrawal of 12 or more credits (full-time). Students who withdraw from college in accordance with withdrawal regulations are entitled to the following refund: • One hundred percent refund for classes canceled or changed by the college. • One hundred percent refund (less complete withdrawal fee) for complete withdrawal prior to, and through, the 5th day of classes (4th day of classes for summer quarter). • Fifty percent refund (less complete withdrawal fee) for complete withdrawal after the 5th day of classes and through the 20th calendar day after the start of classes (5th through the 14th day for summer quarter). • No refund is granted after the 20th calendar day following the start of the quarter (after the 14th day for summer quarter). Refunds for classes which do not follow the regular college calendar are applied on a timetable (as established above) proportionate to the standard length of a quarter. Also, refunds for lab fees will be in proportion to the regular tuition refund schedule. Refunds for tuition and fees not paid by Financial Aid will be applied to outstanding charges. Any remaining funds will be processed and refunded withinfourtosixweeksfromthedateofofficial withdrawal. If the original form of payment was a debit or credit card, the refund will be credited to the original card that was charged. If the original form of payment was cash, check or online payment, a check will be issued in the student’s name and mailed to theaddressonfileinregistration.Anystudent, receivingfederalorstatefinancialaid,whoofficially orunofficiallywithdrawsfromYVCCandqualifiesfor a refund, will have funds returned to the appropriate financialaidprogrambasedontheregulations governing the program. Contact the Financial Aid Officeatthephonenumberinthefrontofthis catalog for details. Yakima Valley Community College, 2015-2016 19 TUITION, FEES & EXPENSES 20 YAKIMA VALLEY COMMUNITY COLLEGE TUITION AND FEES - 200 level or lower 2015 - 2016 Academic Year Tuition is set by the State Board for Community and Technical Colleges which acts upon legislative authority. Rates are subject to change. Washington Resident Washington Nonresident Waiver International Nonresident Per Credit Charges: State Tuition-Operating Fee 85.68 85.68 244.68 State Tuition-Building Fee 10.58 23.58 23.58 Student Activity Fee 10.58 10.58 10.58 YVCC Technology Fee 4.50 4.50 4.50 YVCC ELearning Fee 3.00 3.00 3.00 YVCC Combined Service Fee 4.50 4.50 4.50 Per Credit 118.84 131.84 290.84 Total Charges per Credit 1 118.84 131.84 290.84 2 237.68 263.68 581.68 3 356.52 395.52 872.52 4 475.36 527.36 1163.36 5 594.20 659.20 1454.20 6 713.04 791.04 1745.04 7 831.88 922.88 2035.88 8 950.72 1054.72 2326.72 9 1069.56 1186.56 2614.56 10 1188.40 1318.40 2908.14 11 1248.89 1379.58 2973.90 12 1309.38 1440.76 3039.40 13 1369.87 1501.94 3104.90 14 1430.36 1563.12 3170.70 15 1490.85 1624.30 3235.90 16 1551.34 1685.48 3301.40 17 1611.83 1746.66 3366.90 18 1672.32 1807.84 3432.40 Per credit over 18 103.76 103.76 275.76 * Total cost includes state tuition and fees, combined service fees of $4.50 per credit up to a maximum of $45.00, a $4.50 per credit technology fee, and a $3.00 per credit eLearning fee. Special course or laboratory fees may apply to certain courses and will result in additional charges. See course materials for more information. A processing fee is deducted from all college withdrawal refunds $5.00 for part-time, $10.00 for full-time. Note: Veterans may be entitled to reducedtuition.ContacttheVeterans’Officeforqualifyinginformation. Yakima Valley Community College, 2015-2016 FINANCIAL AID 21 Financingacollegeeducationisaninvestmentinthefuture.Federalandstatefinancialaid programs, as well as privately funded scholarships, are designed to provide the additional financialresourcesrequiredbystudentswhoarepursuinganeducationalprogramatYakima Valley Community College but do not have adequate resources to meet the full cost of attendance. Assistance Programs Need-Based Programs Therearethreemaintypesoffinancialaidthatmaybeincludedinastudent’sfinancialaidaward duringtheyearthatarebaseduponfinancialneed: • Grants, which are usually not repaid. • Loans, which are usually deferred while the student is in school, but which must be repaid. • Student employment, for which the student is paid monthly. Yakima Valley Community College participates in the following need-based programs: • Federal Pell Grant, a federal grant program. The student must enroll for at least one credit per quarter. • Federal Supplemental Educational Opportunity Grant, a federal grant program. The student must enroll for at least one credit per quarter. • Washington State Need Grant, a state grant program. The student must be a Washington Stateresident,qualifytopayresidenttuitionunderHB1079ormeetspecificeligibility requirements and be enrolled in at least three credits per quarter. • Washington State College Bound Scholarship for state residents meeting eligibility requirements. • Washington State Passport for Foster Youth Promise Scholarship serving youth in the state foster care system since 2007. • YVCC Tuition Waiver, a state authorized waiver of tuition, and YVCC Grant, a state authorized grant. This waiver is intended for Washington State residents and be enrolled in at least three credits per quarter. • William D. Ford Federal Direct Subsidized Loan, which is funded by the U.S. Treasury. Subsidized loans generally do not accrue interest while the student is enrolled in school. The student must be enrolled in at least six credits. • Work-study, federal or state-funded student employment programs. Jobs will be on campus with payment on a monthly basis. During the summer, a limited number of positions may be available for continuing students who are not attending summer classes. • Other need-based tuition assistance programs may be available to eligible students who are unemployed or moving from public assistance to work. Please call the Career Connection CenterortheFinancialAidOfficeatthephonenumbersinthefrontofthiscatalogforcurrent programs and requirements. Financial aid grant and loan funds must be used to pay college educational expenses. Financial aid recipients who receive their award after the beginning of the academic term receive their funds withinapproximatelyoneweekofreceivingtheirawardletter.First-year,first-timerecipientsof federalloansdonotreceivetheirfirstloancheckuntilthirtydaysafterthestartoftheacademic quarter. Programs That Are Not Need-Based • WilliamD.FordFederalDirectUnsubsidizedStaffordLoan,whichisaloannotbasedon financialneed.Unsubsidizedloansaccrueinterestwhilethestudentisinschool;borrowers have the option to pay the interest as it accrues. The student must be enrolled in at least six credits. Eligibility Requirements Tobeeligibletoapplyforthefederalandstatefinancialaidprograms,thestudentapplicantmust meet the following requirements: • Be a U.S. citizen, national, or a permanent resident. (International students are not eligible.) • Have a high school diploma or the recognized equivalent (GED). • For State Need Grant only, eligible to pay in-state tuition under HB 1079. • Be in an approved college program which is at least one year in length and leads to a degree orcertificate. Yakima Valley Community College, 2015-2016 FINANCIAL AID 22 Application Procedure Toapplyforthefederalandstatefinancialaid programs available at the college, the student applicant must: 1. Complete the Free Application for Federal Student Aid (FAFSA) at www.FAFSA.gov or, for HB1079 students without social security numbers, complete the Washington Application for State Financial Aid (WASFA) at www.ReadySetGrad.org/WASFA 2. Apply for admission to the college. 3. Provide any other required documents as requestedbytheYVCCFinancialAidOffice. Documents are due after the request date. Financial aid applicants must reapply each year. A supplemental request form is available every spring quarter for students who wish to request aid for summer quarter. Need Determination AllfinancialaidatYVCCisadministeredin accordance with nationally established policies. Financial need is determined by comparing the student applicant’s resources (parents’ contribution, if applicable; student earnings, assets, and other incomesources),asreflectedonthestudent’s financialaidapplicationforms,withstandard costs for attending YVCC. If the standard costs are greater than the student’s available resources, an awardpackagetocoverallorpartofthedifference isofferedaslongasprogramfundspermit.The financialaidawardmaybecomprisedofgrants, student employment, and/or loans. YVCCawardsgrantsfirstandthenstudent employment and loans based on remaining need. Students interested in work study/student employment attend an orientation to learn about the requirements and request an award and referral form. Students may submit loan request forms after determination of eligibility for need-based grant funding and registering for classes. MostYVCCfinancialaidapplicantsdonothave theirfullneedsmetbecauseofthelackofsufficient funds from federal and state funding sources. Additional Requirements Onceastudentreceivesfinancialaidfunding,there are several additional requirements: • Useallfinancialaidfundsonlyforexpenses related to attendance at YVCC. • StudentsmustkeeptheFinancialAidOffice advised of any changes in enrollment status and changes in their programs of study. • Financial aid funding is limited to 150% of credits required for the academic program including prerequisites. Extension of programs due to changing majors may result in loss of eligibility before completion of the program. Yakima Valley Community College, 2015-2016 • • • • • • • Studentsreceivingfinancialaidmustenrollin courses that apply directly to their course of study. Students who are considering a 100% withdrawal from classes should speak to someone in the FinancialAidOfficebeforewithdrawinginorder to be advised of potential repayment of aid, cancellation of future disbursements, and loss of future eligibility. Students must maintain satisfactory academic progress in their programs or majors. Each quarter, all the courses for which a student is funded must be completed, and the student must earn at least a 2.0 (C) grade point average to maintain satisfactory progress. Failure to do so will result in the student being placed on financialaidwarningorexperiencingfinancial aid cancellation. Direct Loan Program originations are based on 1 to 45 credits (freshman) and 46 credits or more (sophomore) that apply directly to the student’s course of study, or 90-135 credit for juniors in BAS programs, or 136 or more credits for seniors in BAS program. Developmental classes are not counted. Students receiving a Federal Direct Loan must complete both entrance and exit counseling online sessions in order to participate in this loan program. Students pursuing a second or subsequent associate degree maybe eligible for State Need Grantafterfiveyearshaveelapsed. Students receiving aid at YVCC may not accept aid from another institution for the same quarterwithoutapprovalofthefinancialaid office. FINANCIAL AID Satisfactory Academic Progress Conditions Satisfactory Progress To maintain satisfactory academic progress, a student must complete all attempted credits,* earn at least a 2.0 quarterly GPA (C average) on any graded credits, be capable of completing program without taking more than 150% of the credits required for the program, and maintain a 67% pace of progression (credits passed/credits attempted) and meet YVCC’s college-wide academic progress standards. *Thenumberofcreditsyouhadonthefirstdayofthe quarter or on the day your aid was processed, whichever was later. Students who successfully completed less than 100% of attempted credits, but at least 12 credits, are considered to havemetsatisfactoryprogressforfinancialaidpurposes. If you do not complete all attempted credits or earn less than a 2.0 quarterly and cumulative GPA, you risk losing your eligibility. Complete details of the current YVCC satisfactory academic progress policy, including definitionsofwarning,suspension,anddismissal status; examples of the policy; and how to regain eligibility if your aid is suspended are available online at: www.YVCC.edu/FinancialAid or in printed format at theYVCCFinancialAidOffice. Unacceptable Grades These grades are unacceptable: F, I, N, NC, V, W, and any academic renewal notations. Noncompletion You may be required to repay a portion of grant funds if you earn only unacceptable grades and/or complete zero credits. A federal formula (or a state formula for state grants) is used to determine if the aid received must be returned or repaid for the period of enrollment. Students who complete at least 60% of the quarter are not required to repay grants received. Student Loan Applicants A student loan request cannot be processed for you if you are on suspension or dismissal. Degree Completion Time Limits • You must complete your program of study within 150% of the normal time frame for federal programs and within 125% of the normal time frame for state programs. For example, continuation of federal aid requires that a 90 credit program of study be completed in no more than 135 credits. • Additional time is granted for developmental classes. Up to 45 additional credits may be added for a 90-credit program. • 23 You must have a cumulative GPA of 2.0 and must demonstrate that you are making progress toward your degree or you lose eligibility for financialaid. Washington State Need Grant Program Conditions of Award Ifyoureceivethisgrant,therearefivespecial conditions, listed below, with which you must comply.Ifyouhavequestionsorfindthatyou cannot comply with these conditions, please see the financialaidadministratorattheinstitutionyouare attending. • You do not owe a refund or repayment on a State Need Grant, a Pell Grant, or a Supplemental Education Opportunity Grant, nor are you in default on a loan made, insured, or guaranteed under the Perkins, Federal Direct, or Federal Family Education Loan programs. In addition, you are not in default on a loan made through a state conditional loan or conditional scholarship program. • This grant is awarded to assist in meeting your educational expenses and should you withdraw from classes, repayment of all or a part of the grant may be required. • Youcanchoosetovoluntarilymakefinancial contributions to the Washington Student Achievement Council in recognition of this State Need Grant. All voluntary contributions will be usedtoprovidefinancialassistancetoother students. • TheofferofaStateNeedGrantissubjectto and conditioned upon the availability of funds. The Washington Student Achievement Council and the institution through which the grant is awarded reserve the right to withdraw, reduce, or modify the grant due to funding limitations orduetochangesincircumstanceswhichaffect your eligibility for the State Need Grant. • You are not pursuing a degree in theology. Refunds Anystudentreceivingfederalorstatefinancial aid,whoofficiallyorunofficiallywithdrawsfrom YVCCandqualifiesforarefund,willhavefunds returnedtotheappropriatefinancialaidprogram based on the regulations governing that program. Studentsreceivingonlyinstitutionalfinancialaidwill have tuition and fees refunded to the aid program accordingtotheofficialcollegerefundpolicy. Additional information may be found on the college website, look for “Repayment If You Withdraw or Stop Attending” . Yakima Valley Community College, 2015-2016 FINANCIAL AID 24 Additional Sources of Assistance Department of Vocational Rehabilitation Persons who are physically handicapped or those who are unemployable for reasons other than disabilitymaybeeligibletoreceivebenefitsunder this program. Information is available in the Financial AidOfficeorthroughtheDepartmentofPublic Assistance. Early Achievers Opportunity Grant Early Achievers Opportunity Grant provides assistancewithtuition,feesandbookstoqualified students who are enrolled in Early Childhood Education(ECE)stackablecertificates:Initial Certificate,ShortCertificateofSpecialization,State ECECertificateoranAAdegreeinECE.Eligible students must be currently working in an Early Achievers child care facility (minimum of 10 hours per week or 40 hours per month for at least 3 months). Must be a Washington State resident to qualify. Opportunity Grant Opportunity Grant provides assistance with tuition fees and books to low-income students who are enrolledinspecific,high-demandcareerpathway programs at Yakima Valley Community College. The approved programs at YVCC include I-Best (Integrated Basic Education and Skills Training) programs:NursingAssistantCertificateandBusiness TechnologyOfficeSkills1&2certificates.Additional eligible programs include Allied Health, Nursing AAS, Business Technology and Early Childhood Education. Priority funding goes to students who are enrolled in one of the I-BEST programs. Must be a Washington State resident to qualify. Veterans YVCCofferscertificationforeducationalbenefits, benefitscounseling,vocationalrehabilitation,tutorial services,VAwork-study,andreferrals.Benefits available to veterans and dependents are: • Chapter 30: Montgomery GI Bill for service beginning July 1, 1985. • Chapter 31: Vocational rehabilitation for veteranswithcertifiedservice-related disabilities. • Chapter 33: The Post-9/11 GI Bill is for individuals with at least 90 days of aggregate service on or after September 11, 2001, or individuals discharged with a service-connected disability after 30 days. You must have received an honorable discharge to be eligible for the Post-9/11GIBill.Thebillbecameeffectivefor training on or after August 1, 2009. • Chapter 35: Educational assistance for survivors and dependents of veterans who are either deceased or are 100% disabled due to serviceconnected causes. • Chapter 1606: Selected Reserve or National Yakima Valley Community College, 2015-2016 Guard. A Notice of Basic Eligibility (NOBE-DD Form 2384) from the guard or reserve unit and a six-year commitment are required. • REAPChapter1607:isabenefitthatprovides educational assistance to members of the reserve components - Selected Reserve (Sel. Res.) and Individual Ready Reserve (IRR) who are called or ordered to active service in response to a war or national emergency, as declared by the President or Congress. The “reserve components” consist of Army Reserve, Naval Reserve, Air Force Reserve, Marine Corps Reserve, Coast Guard Reserve, and the Army National Guard, Army IRR, Air Force IRR and Marine Corps IRR. StudentseligibleforVAeducationalbenefitsmust maintain adequate progress toward their degrees. The college’s scholastic standards are used to determine standards of progress. VA recipients who fail to maintain minimum standards are subject to academic probation/termination. In addition, students’ attendance is monitored by the veterans coordinator. WorkFirst WorkFirst Financial Aid assists TANF (Temporary Assistance for Needy Families) parents in gaining the skills needed to become employed. WorkFirst Financial Aid can pay tuition, fees and books toward anapprovedvocationaldegreeorcertificate.Must be currently receiving TANF and meeting all DSHS participation requirements. Additional information can be found in the College Resources section of the catalog or visit the Career Connection Center website at: www.YVCC.edu/CCC FINANCIAL AID Workforce Education & Training Special Funding YVCCoffersspecialfundingoptionsforcurrent and prospective students interested in workforce educationprogramsandtraining.Studentscanfind out if they pre-qualify for special funding options by taking the Start Next Quarter survey: www.YVCC.edu/SNQ Basic Food Employment & Training (BFE&T) YVCC's Basic Food, Employment and Training (BFE&T) provides services to Basic Food (Food Stamp) recipients in Washington State. Services may include establishing or maintaining eligibility for Basic Food while in school, child care subsidy, job search training and other support services. • Eligibility for Working Connections Child Care through the Department of Social and Health Services (DSHS) • EligibilitytoreceiveBasicFoodBenefits(Food Stamps) while enrolled in college • Financial assistance with college related expenses • Support Services Eligibility Requirements: • Receiving or eligible to receive Basic Food Benefits(FoodStamps) • Eligibility is based on household income at or below 200% of the federal poverty rate • You must not be receiving Temporary Assistance for Needy Families (TANF) • You must be a US Citizen or Legal Resident • You must be enrolled in a Professional/Technical program (Transfer degree programs are not eligible) 25 Worker Retraining Worker Retraining provides assistance to individuals who are receiving Washington State Unemployment Insurancebenefitsorhavelosttheirjobdueto economic changes and need to change careers in order to re-enter the workforce. YVCC'sWorkerRetrainingofferstrainingfora widerangeofprofessional-technicalcertificatesand degrees within the Workforce Education Division. Eligible Worker Retraining students may receive tuition assistance and/or funds to cover the cost of books for one quarter at Yakima Valley Community College. Are you eligible for Worker Retraining: • Currently receiving Washington State UnemploymentBenefits • Have exhausted your Washington State UnemploymentBenefitswithinthepast48 months • Have been determined to be a "Dislocated Worker" by WorkSource • Have been self-employed within the past 48 months, operating your own business, and are now unemployed due to economic downturn • Are an unemployed veteran who has been honorably discharged from the US armed services within the past 24 months Pleasenote:FundingforqualifiedWorkerRetraining students is contingent upon availability of Worker Retraining funds. Additional information can be found at: www.YVCC.edu/SpecialFunding Please Note: Enrollment in BFE&T is based on eligibility and availability of funds. Students must reapply each quarter. Additional information can be found online at: www.YVCC.edu/SpecialFunding Yakima Valley Community College, 2015-2016 26 COLLEGE RESOURCES Associated Students of YVCC Student Life seeks interested students to become a part of the Associated Students of YVCC (ASYVCC) community. The ASYVCC Senate, which is composed of a student representative from each recognized club and program, speaks on behalf of students regarding campus policies and procedures.TheASYVCCStudentGovernmenthaseightofficerpositionspaidbytheAssociated StudentsofYVCC.Threeareelected,andfivearehired.TheASYVCCStudentGovernment coordinates programs and activities and facilitates disbursement of student funds, which exceed $500,000 annually. The ASYVCC Student Government represents YVCC students on state and national levels and teaches leadership, management, and planning skills. Grandview Student Council Student Life at the YVCC Grandview Campus seeks interested students to become part of the Grandview Student Council (GSC) while attending YVCC's branch campus. Grandview Student CouncilhasfivepositionspaidbytheAssociatedStudentsofYVCC;Twoareelectedandthree are hired. Student government provides activities and events to enhance students' lives while attending YVCC, learn leadership and organizational skills, and represent YVCC Grandview Campus students at various local, regional, and state levels. Grandview Activity Center Located on the YVCC Grandview Campus, the Activity Center activities focus on creating a sense of community with opportunities for interaction between members of the campus community. Therefactorsaresignificantintheenhancementofstudentdevelopment.TheActivityCenter provides a student lounge, restrooms, and internet access. Clubs and Student Organizations Yakima Valley Community College has many student clubs and organizations that are an important supplement to academic experiences. Clubs address special student interests, providing community service opportunities throughout YVCC and the Yakima Valley. Students are also encouraged to form new clubs if current clubs do not meet the needs of a particular interest.ContacttheStudentLifeOfficeabouttheprocedurestoformanewclub. Hopf Union Building The Hopf Union Building (HUB), located on the Yakima Campus, is an integral part of the educational mission of Yakima Valley Community College and is designed for all members of thecollegecommunity.Locatedatthecenterofthecampus,theHUBoffersfoodservice,an espresso bar, a student lounge, restrooms, internet access, and meeting rooms. The bookstore and HUB information desk are also located here. The HUB activities focus on creating a sense of community with opportunities for interaction between members of the campus community. Thesefactorsaresignificantintheenhancementofstudentdevelopment. Student Activities and Programming StudentsatYakimaValleyCommunityCollegebenefitfrommuchmorethanclassroomlearning throughthevariousprogramsandactivitiesthatofferopportunitiesforactiveparticipationor passiveenjoyment.TheStudentLifeOfficeworkswithstudentsinprovidingfilms,speakers, exhibits, debates, recreational activities, dances, concerts, forums, open microphones, club days,culturalevents,andotherevents.Theseprogramsandactivitiesareacoordinatedeffort to supplement and enhance the curriculum at the college. Yakima Valley Community College, 2015-2016 Athletics COLLEGE RESOURCES Yakima Valley Community College has successfully competed in intercollegiate athletics since 1928. YVCChastraditionallyofferedacomprehensive athletic program to accommodate the special interests and talents of as many students as possible. Women’s and men’s sports programs, providing competitive athletic experiences to coincide with the student’s academic experiences, are a high goal at YVCC. The YVCC Yaks have captured conference team titles in as many as three sports in one year. We are proud of the number of athletes who have gone on to successful careers at four-year schools and to professional sports. YVCC is a member of the NorthWest Athletic Conference (NWAC). Intercollegiate athletic programsareofferedinbaseball,men’sand women’s basketball, softball, volleyball and women’s soccer. Competition primarily comes from schools in Washington and Oregon. Bookstore The Yakima Valley Community College Bookstore is centrally located in the southeast corner of the Hopf Union Building. The bookstore also operates at the Grandview Campus. The bookstore provides required and recommended textbooks, a full selection of school supplies, reference materials, and study aids. In addition, general books, snack items, gifts, greeting cards, and imprinted clothing are available. Students can purchase textbooks online at: www. YVCCBookstore.com Textbook Refund/Buy-back • Refunds on textbooks are processed during thefirsttwoweeksofeachquarterandwitha bookstore receipt. Refunds on textbooks during the second week require an original bookstore receipt and a drop slip. The textbooks must be in the original condition including the shrink wrap and codes unopened. • Textbook buy-back is conducted on the Yakima Campusduringfinalexamweekofeach quarter. No receipt is required. Go to www.YVCCBookStore.com for hours of operation and textbook buy-back dates. Career Connection Center The Career Connection Center at Yakima Valley Community College is committed to connecting individuals interested in improving their job skills through specialized training with resources to help them be successful students. The Career Connection Center provides a single entry point for individuals seeking career guidance, educationalassessment,skillstraining,andfinancial assistance. Through a variety of educational programsandspecialfundingsourcesYVCCoffers opportunities to individuals interested in gaining the skills they need to join today's workforce. For additional information visit www.YVCC.edu/CCC Certified Training Programs Certifiedtrainingprogramsmaybeavailable through the Career Connection Center. Contact the phone numbers listed in the front of this catalog for more information or visit www.YVCC.edu/CCC Child Care Services Easter Seals Jane’s House Early Learning Center At 1101 South 13th Avenue, Jane’s House serves students, YVCC employees, and community members from 7:00 am to 5:30 pm. The YVCC Early Learning Center is an inclusive child development center for children of all abilities, runbyEasterSealsWashington.Thecenteroffers muchmorethanhighqualitychildcare.Ourcertified preschoolteachersofferacarefullyplanned educational experience designed to meet the physical, intellectual, social, and emotional needs of young children. All students receive a reduced student rate. Bilingualstaffmembersareavailable,andthe center is ADA-accessible. Please call the phone number listed in the directory at the front of this catalog or email mgunderson@wa.Easterseals.com for information. Computer Labs Student Technology Centers Student Technology Centers are drop-in, instructional-support computer labs. Students may use the centers to complete word processing assignments and other college-related assignments asspecificallydirectedbytheirinstructors.Students may also have Internet access and restricted email rights.Staffisavailabletoprovidesupportfor technology applications. Students are required to show a current student ID card to use the computer labs. The technology centers located on the Yakima Campus are in the Deccio Higher Education Center, Rooms C208 and C230 (Student Technology Centers North). The Grandview Student Technology Center is located in L116. Open hours for the centers vary. Please check the YVCC website, or contact the lab directly. Phone numbers are listed at the front of this catalog. Hoursmayvaryduringfinalsweekandbyquarter, and may be closed on campus holidays. Yakima Valley Community College, 2015-2016 27 28 COLLEGE RESOURCES Community Service Courses As a service to the communities of the Yakima Valley,YakimaValleyCommunityCollegeoffers a limited selection of self-supported courses and workshops to address special interests. Selfsupported courses do not receive funding from the State of Washington, and depend solely on the fee charged to participating students. Community Service courses and workshops maybeofferedinavarietyoffields,includingbut not limited to recreation, conversational languages, music,businessandfinancialplanning,andother interest areas. The community service courses or workshopsofferedwillvarydependingoninterest, instructor availability, and availability of appropriate facilities. CommunityServicecoursesdonotoffercredit, andmaynotbeusedtosatisfydegreeorcertificate requirements. Community Service courses or workshops are listed in the class schedule, or you maycontactthedivisionofficesforinformation aboutcurrentofferings.Informationoncurrent Community Service courses or workshops can be found in the current class schedule, throughdivisionoffices,oratwww.YVCC.edu/ ContinuingEducation Cooperative Education Program Cooperative education is a form of education which incorporates real work experience into the curriculum. Students contact the head of the department for which they wish to receive co-op credit. The students can apply classroom theory to their related major work experience, thus enhancing career choices, building human relations skills,andincreasingfinancialpotentialwhile earning credits. Counseling & Advising Center TheCounseling&AdvisingCenteroffersvarious resources designed to assist students to achieve academic success, acquire skills for employment, improvepersonalwell-being,anddevelopeffective skills for interacting in a diverse environment. Counseling services are available at no cost to registered YVCC students. Services available through the Counseling & Advising Center include: • Short-term personal counseling • Transfer information • Decision-making regarding career and life goals • Strategies for dealing with the fear of testing and new situations • Academic counseling • College survival and study skills • Student advocacy • Degree audits Yakima Valley Community College, 2015-2016 The Counseling & Advising Center is located in the Deccio Higher Education Center, Room C164. The phone number is located in the front of this catalog. For information about Grandview Campus counseling services, call the number in the directory in the front of this catalog. Advising The purpose of advising at Yakima Valley Community College is to assist students in making appropriate choices that will help them reach their academic and career goals. Advising is the shared responsibility of the student and the academic advisor. All students are assigned a faculty advisor based on their academic pathway. Students should meet with their advisor each quarter to develop a plan for their education and to ensure that they are on the right track for graduation. Mandatory Advising for New Students All new students will be advised until they have successfully completed 30 college level credits. They are assigned an advisor based on their academic pathway. Transfer and Returning Students Transfer and returning students will be advised theirfirstquarteranduntiltheyhavemetthe 30 credit criteria for new students. Once the requirement has been met they can be released from mandatory advising by their academic advisor. Changing your Major or Program Students who choose to change their major or programmustfillouta“ChangeinMajorform”. These forms are located in Registration or the Counseling&AdvisingOffice. Disability Support Services Yakima Valley Community College is committed to providing access for all students wishing to attend its campuses and complies with Section 504 of the Vocational Rehabilitation Act of 1973 and the Americans with Disabilities Act (ADA). As part of this commitment, the college’s Disability Support Services (DSS) program works on an individual basis with qualifying students by providing appropriate classroom accommodations, access to adaptive equipment, and barrier-free facilities. Videophone YVCCoffersdeafandhardofhearingstudentsVp technology to replace TTY services. The Vp connects users to an interpreter relay service that enables them to call any phone number and communicate effectively.YakimaCampushasaVpintheDeccio Higher Education Center, Room C138, that deaf and hard-of-hearing students can access. There will be a Vp at Grandview Campus in the near future. For COLLEGE RESOURCES more information, call the coordinator for special populations at the number listed in the front of this catalog. High School Equivalency Exam YVCCoffershighschoolequivalencysuchasGED (General Education Development) Exam at both the Yakima and Grandview campuses. For additional information visit YVCC's website (see directory) forspecificinformation.Individualswhowishto prepare for the exam can take GED preparation classes through YVCC's Adult Basic Education programs. Learn more by referencing "High School Equivalency Preparation" in the course section of this catalog. High School Diploma High School 21+ Students who are 21 years of age or older can earn high school credit from Adult Basic Education courses and earn an adult high school diploma. All courses lead directly into YVCC credit bearing college courses. For additional information reference "Adult Basic Education" in the course section of this catalog. Requesting a High School Diploma SHB 1758 was approved by the legislature and tookeffectJuly2009inordertoexpandoptionsfor students to earn high school diplomas. A community or technical college may issue a high schooldiplomaorcertificateasprovidedunderthis section: 1. An individual 21 years or older, who earns any type of associate degree from a Washington State Community and Technical College shall be awarded a state high school diploma from the college upon written request from the student. 2. An individual enrolled through Running Start who satisfactorily completes any type of associate degree from a Washington State Community and Technical College shall be awarded a state high school diploma from the college upon written request from the student. Formoreinformation,pleasecontactYVCC'sOffice of Registration & Records at registration@YVCC. edu or reference the phone directory at the front of the catalog. Honors Program YVCC’s Honors Program creates opportunities across diverse disciplines for intellectually motivated students to challenge themselves. A wide rangeofclasseswillbeofferedwithhonorsoptions for fall, winter and spring quarters. We anticipate thatatleastonecoursewillbeofferedwithan honors option in each of the following programs during the 2015-2016 school year: • American Sign Language • Anthropology • Art • Biology • Chemistry • Economics • Geography • History • Mathematics • Philosophy • Political Science • Psychology Students wishing to pursue their intellectual and academic passions, work closely with a faculty mentor in guided research opportunities, and participate in a community of scholars. Scholars at YVCC will be asked by the YVCC’s Honors Program to: • Complete an application, which includes eligibility for college-level mathematics and ENGL& 101, current grade point average of 3.3, statement of intent, and letters of recommendation. • Negotiate an honors contract with an honors instructor, which will establish the agreed upon terms for earning honors credit. As a community college, YVCC serves a diverse student body. The Honors Program recognizes this diversity and allows for faculty to sponsor promising students who may not meet all of the eligibility requirements. Note that the program is still in its infancy, so particulars will be revised as new issues arise and participation increases. For more information, contact Dr. Heidi Shaw at hshaw@YVCC.edu or 509.574.4812. Larson Gallery - Art The Larson Gallery opened in September 1949 as a gift from Adelbert and Rose Larson to the community and Yakima Valley Junior College (now YVCC). John D. Maloney was the architect, as he had designed the Art Deco Larson Building in downtown Yakima. Many of the original elements of the Larson Gallery building are intact. Today the Larson Gallery continues as a unique and dynamic space featuring local, regional, and national artists. The gallery works in partnership with the Larson Gallery Guild and YVCC to bring exciting and innovative exhibits and programs to Yakima. Annual and biennial exhibits include the Central Washington Artists’ Exhibition and the National Juried Photo Exhibition. Larson Gallery exhibitions are augmented by educational activities, lectures, workshops, and tours. The mission of the gallery is to inspire students, artists, and the community, and to complement YVCC classes and activities. The gallery furthers cultural enrichment for the Yakima Valley by connecting with other entities such as The Seasons and the Yakima Valley Museum. Admission to the Larson Gallery is free to the public. Gallery hours are Tuesday through Friday Yakima Valley Community College, 2015-2016 29 30 COLLEGE RESOURCES from 10:00 to 5:00 pm, and Saturday from 1:00 pm to 5:00 pm during exhibitions. For more information, visit www.LarsonGallery.org or call 509.574.4875. Library and Media Services Raymond Library and the Media Center are located in Raymond Hall. The library, housed on the firstfloor,providesservicesforstudents,faculty andstaff,includinghelpwithresearchprojects andawidevarietyofprintresourcesspecifically selected to support the college curriculum. The library collection includes over 45,000 books, several newspapers, magazine and journal subscriptions, online access to several thousand full-text periodicals and reference books, and over one hundred thousand e-books and audiobooks. The library and media center collections can be accessed through a web-delivered catalog found on the library homepage, www.YVCCLibrary. us/Yakima. Books and articles not available in the YVCC library may generally be borrowed via interlibrary loan from another library. The library provides reference services and instruction to students and employees. The library also provides Ask a Librarian, a 24-hour service to submit reference questions via email or live chat sessions. During fall, winter and spring quarters, the library presents various workshops designed to help students use the library and its services moreeffectively.Thelibraryhasover45computer workstations, Wi-Fi, wireless printing, color or black and white printing from all the library computers, and both black and white and color photocopiers. Students may also fax documents or scan documents and e-mail or save them to a USB drive. There is a paper punch, stapler, paper cutter and other tools to help complete projects and papers. MediaServices,locatedonthesecondfloorof Raymond Hall in the media center, has a wide range of services designed to support student learning, including the ability to stream any video or DVD owned by the college to any network computer on either the Yakima or Grandview campus. Laptop computers may be borrowed by currently enrolled students.Thesecondflooralsohasalargestudy room, several small group study rooms (keys may be checked out in the media center), wireless access, and the library classroom. Grandview Library Grandview Library, situated on the YVCC Grandview Campus, is a joint partnership of YVCC and the city ofGrandviewservingthecommunity,faculty,staff and currently enrolled students of YVCC. The library contains over 40,000 items for all agesandscholarlyvolumesspecificallyselected to support the college curriculum, online access Yakima Valley Community College, 2015-2016 to several thousand full-text periodicals, print periodicals and four current newspapers. A wide variety of popular and documentary videos and DVDs are available for check out, as are a selection of music CD’s and books on CD. Downloadable popular music, audiobooks and e-books are available through the library’s website at www.Grandview.wa.us/Departments/Library. Staffisavailabletoassistwithquestionsregarding e-media and use of personal e-readers. Use your Grandview Library card/student ID card and password to access the library’s website to check your library account; search the catalog and the databases; download music, audiobooks and e-books; renew your items and place holds. Interlibrary loan may be available for materials not owned by the library. The library has 25 computer workstations available, as well as Wi-Fi capability, 2 study rooms which seat up to 6 and a Program Room which seats 32. A copy machine/ printer is available for black and white printing. The library houses the Blanche McLane Cook Art Library which contains art works and a collection of books that were bequeathed to the library. The collection continues to grow due to monies left in trust. This trust also sponsors an annual art scholarship. Reference help is always available, as are tours andorientationswithsufficientnotice.Organized tours for both students and community groups are availablebyreservationandcanbetailoredtofit the needs of the requester. Due to the unique nature of the library, there are children’s events and activities throughout the year and a monthly adult book discussion group hosted by the Friends of Grandview Library. Mathematics Center Themathcenters,locatedonthefirstfloorofGlenn Anthon Hall in room 101 on the Yakima Campus and in L102 at Grandview Campus, provide drop-in instructional support for classes from arithmetic through calculus. Math Department instructors and instructional technicians provide individualized assistance to address students’ questions about topics from their mathematics courses as well as other mathematics-related courses. Help is also provided through computer/CD instruction focusing on concept development and guided practice. Resources such as calculators, textbooks, manipulatives, math-related materials, and supplemental written materials are available to students in the study areas of the center. Hours are posted at the center each quarter. For further information, check online at www.YVCC. edu/MathCenter or call the phone number in the front of this catalog. COLLEGE RESOURCES Musical Performing Ensembles Performing ensembles are viewed as an essential partofcollegeofferings.TheDepartmentofMusic features both vocal and instrumental groups which perform throughout the academic year. The Concert Choir and the Chamber Singers perform on campus as well as on tours. The YVCC Salsa Band and jazz combos participate in regional festivals and perform throughout the community and state and occasionally tour outside the United States. Themusicdepartmentofferscoursesthatfocuson the use of computer technology for composing and recording original music. Retired & Senior Volunteer Program The Retired and Senior Volunteer Program (RSVP) of Yakima County is part of the National Senior Service Corps administered by the Corporation for National Service. RSVP provides older Americans, age 55+, an opportunity to remain involved in their community through meaningful volunteer activity. At the same time, RSVP seeks to provide vital volunteer services for our community. RSVP volunteers provide hundreds of community servicesthroughparticipatingstations(non-profit agencies, schools and government programs). Volunteersmaycontinueintheirprofessionalfields while volunteering or choose an assignment for thechallengeitoffers.Whateveraperson’sskill, experience, interest or goals, they can be put to gooduseforthebenefitofthecommunity. RSVP of Yakima County has been sponsored by Yakima Valley Community College (YVCC) for almost 15 years. YVCC’s commitment to “community” is demonstrated by providing opportunities for economic, social, and cultural development through this volunteer program. Students may contact RSVP of Yakima County for information on current volunteer opportunities. RSVP is located at 120 South 3rd Street, Suite 200B, Yakima or call 509.574.1933 for more information. Security YVCC Security is responsible for the enforcement of college policy, rules, regulations and local, state and federal laws on the YVCC Campus. This includes tracking, monitoring and providing crime statistics required by the Jeanne Clery Disclosure Act of 1998, which are made available in the campus security officeinPalmerHall.Crimestatisticsarealso available on the security website: www.YVCC.edu/ Security Accidents, Auto, and Personal Injury All accidents occurring on campus must be reported and documented immediately to campus security. Alcohol and Drugs Yakima Valley Community College enforces the Drug-Free Workplace Act of 1988. Campus Closures In the event that YVCC cancels classes due to an emergency situation or weather condition, the college’s Emergency Preparedness Planning Team will take steps to inform the college community. Students and employees can: • Listen to local media outlets including television and radio stations in Yakima and Tri-Cities for information on college closures. Be sure to listenforclarificationonwhethertheclosure is for Yakima or Grandview campuses and whether only day classes or if evening classes arealsoaffected.Eveningstudents,please check the website in the late afternoon, as the status of the closure may change. • View updated information on the college website: www.YVCC.edu/Alerts and Flash Alert Newswire website: www.SchoolReport.org • Receive email/text messages through YVCC’snotificationsystem,RAVE.RAVE will automatically send YVCC students and employeeswhohaveanemailonfilewiththe college an email alert. You have the option to change your preferences and add your cellphone number to receive a text message. The college will active your RAVE account duringyourfirstquarterasaYVCCstudent or employee, you are then responsible to manage the account by updating your contact information. For more details, visit www.YVCC. edu/Alerts Unlessotherwisenotified,thecollegewill resume regular business hours the following day. Information on YVCC’s Emergency Preparedness Planning can be found online at www.YVCC.edu/ Security Lost and Found The campus Lost and Found is located in the SecurityOfficeinPalmerHall. Parking • Student Parking: Student parking lots H and K are "open parking" and do not require a parking permit. All other parking areas on campus are restricted and require permits. The campus map is available on the YVCC Security web site to help you to identify the location of the student parking lots and building locations. Please visit our website for additional information: http://www.YVCC.edu/Security • Paid Parking: Individuals choosing to park in one of the college’s many paid parking lots will be required to pay all parking fees with exact change only. All-Day parking permits are valid in Yakima Valley Community College, 2015-2016 31 COLLEGE RESOURCES 32 • • all YVCC pay lots and must be displayed face-up on the dash to be valid. Visitors and Guests: Campus visitors and guests must receive a visitor permit from their YVCC Host. Visitor permits are valid only in the visitor parking lot located in front of Prior Hall and must be placed face-up on the dash to be valid. Citations: Citations may be paid at the Cashier’sOfficeintheDeccioHigherEducation Center. To appeal a ticket, contact the Security Office. Services Securitystaffcanhelpwithminoremergencies such as jump-starting a car or retrieving keys from non-power locks. Limited service is also available for vehicles with power locks. Lock your car and place anything of value out of sight or locked in the trunk. If you should experience a theft on campus, reportitimmediatelytotheSecurityOffice.Asin any public place, do not leave personal belongings unattended. Speech Lab The speech lab, located in Palmer Martin 202 on the Yakima Campus, provides a non-judgmental environment to help students use various audio and visual media to prepare and practice oral presentations and other communication skills such as American Sign Language. The lab is open Monday through Friday. For more information, call the phone number in the front of this catalog. Student Residence Center/ Housing Mostcollegestudentsfindthatthepositive experience of learning to live with others enriches their lives. Your residence hall experience can prove to be as valuable as your academic experience. The Student Residence Center (SRC) provides a safe living community for students at a competitive price. The residence hall is located on campus and is within a short walking distance to classes, the library, and other campus and recreational facilities. TRiO Programs Upward Bound and Student Support Services (SSS) assistlow-income,first-generationcollegestudents and students with disabilities in overcoming class, social, academic, and cultural barriers to higher education. TRiO programs are funded entirely by the U.S. Department of Education. TRiO Student Support Services TRiO Student Support Services provides a Yakima Valley Community College, 2015-2016 structuredfirst-yearexperiencethatmakes transition into college easier. The program also provides tutoring, counseling, and other support services that help students achieve their degrees. For more information, visit www.YVCC.edu/TRiOSS Upward Bound UpwardBoundisaprecollegeprogramthatoffers counseling, tutoring, and learning skills classes to supporttheeducationaleffortsofstudentsfrom Sunnyside, Granger, Toppenish, and Wapato high schools.UpwardBoundalsooffersasix-week, residential summer college experience. For more information, visit www.YVCC.edu/UpwardBound Tutoring Center Tutoring is available in small group, drop-in, direct one-on-one, and online peer tutoring formats. The tutoring center on the Yakima Campus is located in the Raymond Hall Building, room R202. Tutoring services are also available in Grandview. Part-time employment is available for students who qualify as tutors. Students who are interested are encouraged to visit the tutoring center for information regarding academic help or employment. Hours are posted at the center each quarter. For more information, check online at www.YVCC.edu/Tutoring or call the phone number in the front of this catalog. Wellness and Recreation Fitness Center & Weight Room Students,faculty,andstaffhaveaccesstothe fitnesscenter,weightroom,andgymnasiumin Sherar Gymnasium for recreational and leisure time activity. Lockers are available, an exercise dress code is enforced, and participants have access to professionalstaffinthedevelopmentofapersonal fitness/wellnessprogram.Theresultsofaphysical fitnessscreeningexammayrequireaparticipantto obtainaphysician’spermissiontousethefitness center. Eachpersonusingthefitnesscenterandweight room must register for a credit or noncredit class and pay a quarterly lab fee. The money generated with this fee is used to maintain current equipment, topurchasenewequipment,andforstaffing. Grading for credit classes is based on the total hours of exercise time accumulated during the quarter. Thefitnesscenterincludescircuitworkout equipment as well as cardiovascular machines including treadmills, elliptical machines, recumbent and stationary bicycles. It also has room for stretching and abdominal work. COLLEGE RESOURCES Althoughthefitnesscenteraccommodatesthe workout needs of the physically active, a primary focusofthecenteristotargetfirst-timeexercisers who want to improve their health. The weight room features free weights and contains a variety of equipment, including cable cross over, bench press, leg press, pec/lat machine, barbells, 5 to 75 pound dumbbell sets, squat racks, bench press stations and a Smith machine. In addition, there is universal equipment featuring cable cross over, lateral pull, seated row, and triceps extension. TheYVCCfitnesscenterisopenduringfall, winter, and spring quarters. Hours are posted outsidethefitnesscenter.Formoreinformation, call the athletic director. WorkFirst The WorkFirst team at YVCC believes in the Washington State goal for Temporary Assistance for Needy Families (TANF) recipients “A job, a better job, a better life.” The goal of WorkFirst is to help TANF parents learn skills intended to help them seek jobs, exit welfare, and lift their families out of poverty. For eligibility criteria and further information, visit www.YVCC.edu/CCC or contact WorkFirst at the phone number listed in the front of this catalog. Writing Center Thewritingcenters,locatedonthefirstfloorof Glenn Anthon Hall in room G125 on the Yakima Campus and in L101 at the Grandview Campus, provide YVCC students one-on-one assistance with their writing projects for any course, academic or vocational. Writing consultants meet with students to read, listen, talk about ideas, and help students assess the strengths and weaknesses of their writing. Consultants also can suggest strategies for generating ideas, planning, drafting, revising, and editing. Students who use the writing center should bring a copy of their assignment with them and any corresponding notes, drafts, and portable storage devices. Current hours for both locations are listed on the website at www.YVCC.edu/Owl. For further information, call the phone number in the front of this catalog. YVCC Foundation Scholarships & Awards Since its inception in 1977 the Yakima Valley Community College (YVCC) Foundation’s purpose has been to provide student scholarships and support the college. The Foundation board is made up of alumni, business, civic, and professional leaders. The YVCC Foundation administers and awards scholarshipfundsfromseveraldifferentdonors.A complete list of Scholarships & Awards is available online at www.YVCC.edu/Foundation. The list is also located after the "Courses" section in this catalog. Applications for the YVCC Foundation scholarships are available each year beginning the firstdayofwinterquarterandareduethesecond week of March. The application can be found online at www.YVCC.edu/Scholarships. The Foundation staffwillmatchrecipientstotheappropriate scholarship(s). Scholarships are presented at the annual awards ceremony held in June. To learn more about the YVCC Foundation or to becomeadonor,contacttheFoundationOfficeat 509.574.4645. YVCC Playmasters - Drama YVCC Playmasters produces two or three full-length productions each year. Additionally, Playmasters supports the development and implementation of student-created theatre pieces; provides internship opportunitiesforqualifiedstudentsinareassuch as directing, playwriting, and stage management; participates in a range of community outreach efforts;andsupportstheworkofvisitingtheatre artists. YVCC Playmasters is an active member of the Kennedy Center American College Theatre Festival Northwest Drama Conference and is affiliatedwiththeAmericanTheatreAssociation. Online Writing Center The Online Writing Center allows YVCC students to receive feedback on their writing projects outside the hours of the writing centers. Through the site, students may submit drafts or ask writing-related questions. Consultants will then email students a response, usually within 48 hours. Visit www.YVCC. edu/Owl Yakima Valley Community College, 2015-2016 33 POLICIES 34 Americans with Disabilities Act (ADA) Section 504 of the Vocational Rehabilitation Act of 1973 and the Americans with Disabilities Act (ADA) are designed to eliminate discrimination on the basis of disability in programs and activitiesreceivingfederalfinancialassistance.Asarecipientofsuchfunds,YVCCisboundto ADAguidelines.Specifically,nostudentshall,onthebasisofhis/herdisability,beexcludedfrom participationin,bedeniedthebenefitsof,orotherwisebesubjecttodiscriminationunderany college policies, programs, or activities. Catalog Guidelines: Subject to Change Everyefforthasbeenmadetoassuretheaccuracyoftheinformationcontainedinthiscatalog. Students are advised, however, that such information is subject to change without notice, and advisors should, therefore, be consulted on a regular basis for current information. Catalogs, class schedules, fee schedules, etc., are not to be considered as binding contracts between YVCC and students. The college and its divisions reserve the right at any time to make changes in any regulations or requirements governing instruction in and graduation from the collegeanditsvariousdivisions.Changesshalltakeeffectwhenevertheproperauthorities determine and shall apply not only to prospective students but also to those who are currently enrolled at the college. Except as other conditions permit, the college will make every reasonable efforttoensurethatstudentscurrentlyenrolledinprogramsandmakingnormalprogresstoward completion of any requirements will have the opportunity to complete any program which is to be discontinued. Disclosure Requirements and Campus Security CampuscrimedataandsafetypoliciescanbeobtainedfromtheSecurityOfficeinPalmerHall. Informationonparticipationrates,financing,andgraduationratesforathleticscanbeobtained from the YVCC Athletic Department in Sherar Gym. Data on college graduation and transfer-out ratescanbeobtainedfromtheEnrollmentServicesOfficeintheDeccioHigherEducationCenter. Drug-Free Workplace Act of 1988 and Drug-Free Schools and Communities Act of 1989 Yakima Valley Community College complies with Public Law 100-690, providing information and following policies for the purpose of preventing and addressing alcohol and drug abuse. It is the goal of YVCC to adhere to federal regulations and provide a drug-free environment. YVCC is dedicated to maintaining a drug-free campus for students and employees. The followingsitesareafewofmanywhichdetailthesignificanthealthrisksthatcanresultfromdrug and alcohol abuse: • Washington State DSHS: http://www.DSHD.wa.gov/DBHR • National Institute on Drug Abuse: http://www.DrugAbuse.gov/Students-Young-Adults • The Center for Disease Control and Prevention: http://www.CDC.gov Prohibited Use of Alcohol and Drugs WAC Policy 132P-33440: • • • Alcohol -Theuse,possession,delivery,orsale,orbeingvisiblyundertheinfluenceofany alcoholic beverage, except as permitted by law and applicable college policies. Marijuana-Theuse,possession,delivery,orsaleorbeingvisiblyundertheinfluenceof marijuana or the psychoactive compounds found in marijuana and intended for human consumption, regardless of form. While state law permits the recreational use of marijuana, federal law prohibits such use on college premises or in connection with college activities. Drugs-Theuse,possession,delivery,sale,orbeingundertheinfluenceofanylegenddrug, includinganabolicsteroids,androgens,orhumangrowthhormonesasdefinedinChapter 69.41 RCW, or any other controlled substance under chapter 69.50 RCW, except as prescribed for a student's use by a licensed practitioner. Yakima Valley Community College, 2015-2016 POLICIES Alcohol and Drug Help Line: 1.800.562.1240; Alcoholics Anonymous: 509.453.7680 (Yakima), 509.735.4086 (Grandview). A complete list of community alcohol and drug treatment facilities can be found in the yellow pages of the telephone directory listed under “Alcoholism Information and Treatment” and “Drug Abuse Information and Treatment.” Student Identification Numbers The Washington State Legislature passed a bill that requires Washington State colleges and universities to discontinue the use of Social Security Numbers (SSN) to identify students and their records. The law is intended to add additional protections to student privacy, student identity, and student records. Astudentidentifier(SID)hasbeenassigned to students whose SSN was used as their primary identifier.ThenewSIDisrequiredwhenever students access the YVCC website or when they request services on campus. The SID will also appear on class rosters and other college documents and records. The SSN is not used as the primary student identifier.TheSSNisstoredconfidentiallyinthe student’s records and can only be used for necessary purposessuchasfinancialaid,financialaid-related verifications,HopeScholarships,transcripts, workforce or unemployment data matching, and other legitimate uses as authorized under the Privacy Act of 1974 (Public Law 93-579, Section 7). In response to state Senate Bill 5463, the college hasmodifiedhowSIDsareassignedtonewstudents. The purpose of the change is to move forward a common SID across the system, where students eventually have one single SID regardless of which and how many colleges in the system they attend. 35 Tobacco Use Policy Use of tobacco products is prohibited at Yakima Valley Community College except in designated areas. Reference campus maps. In accordance with state laws and regulations, tobacco products in any form, shall not be permitted except in designated areas. Because there is increasing evidence that use of tobacco creates a danger to public health, and in order to protect the public’s safety and welfare, the declared purpose of this regulation is to prohibit the use of tobacco products in certain places which are used by and open to the public. “Tobacco” as used in this policy shall include products such as chewing tobacco or the smoking or carrying of any kind of lighted pipe, cigar or cigarette. The adjective “public” as used in this policy shall mean any place used by and open to the general public, regardless of whether such place is owned by private persons, the State of Washington, or counties and municipalities of the State of Washington. Social Security Number Disclosure Astudent’ssocialsecuritynumberisconfidential, and, under authority of the federal Family Educational Rights & Privacy Act (FERPA), the college will protect it from unauthorized use and disclosure. In compliance with state and federal requirements, disclosure may be authorized for the purposesofstateandfederalfinancialaid,American Opportunity/Lifetime Learning tax credits, academic transcripts, assessment, or accountability research. Yakima Valley Community College, 2015-2016 STUDENT RIGHT & RESPONSIBILITIES 36 Admission to the college carries with it the expectation that students will conduct themselves as responsible members of the college community, that they will comply with the rules and regulations of the college, maintain high standards of integrity and honesty, respect the rights, privileges, and property of other members of the college community, and will not interfere with legitimatecollegeaffairs. The Code The document, Code of Students Rights and Responsibilities, is available in the Enrollment ServicesOfficeontheYakimaCampusandintheStudentServicesOfficeattheGrandview Campus. It describes student rights and responsibilities and the policies and procedures which governstudentsatYVCC,includinganydisputesinvolvingthecollege,itsfacultyorstaff,and the student. The code also describes violations, procedures, and sanctions. The most current document is available at http://apps.Leg.wa.gov/WAC Academic Dishonesty Plagiarism: Buying, copying, borrowing, or otherwise plagiarizing another’s images, ideas, evidence, examples, opinions, or other original products or documents from published, unpublished, or electronic sources for the purpose of deceiving an instructor as to the product’s origin. Plagiarism is “the wrongful act of taking the product of another person’s mind and presenting it as one’s own” (MLS Handbook for Writers of Research Papers, 4th Edition, p. 26). Plagiarism occurs when an author fails to give credit for someone else’s words, someone else’s examples, someone else’s ideas or opinions, statistics or other facts compiled by someone else, evidence or testimony taken from someone else’s argument, or an image from another artist. YVCC recognizes two types of plagiarism: intentional and unintentional. Intentional plagiarism is the dishonest act of appropriating another’s ideas, words, facts, opinions, or images with the intent to deceive others about the document’s origin. Any student found to have committed intentional plagiarism shall be subject to disciplinary actions provided for in the code for “Procedures and Summary Suspension Rules.” Students may also commit plagiarism without the intent to deceive. A student’s intent to deceive shall be taken into account when instructors evaluate an act of plagiarism. All forms of plagiarism which an instructor determines to be unintentional should be treated as instructional problems to be handled within the student-instructor relationship with the instructor following, but not limited by, the following penalty guidelines: • Student must resubmit the assignment after instruction, but before an agreed-upon due date. • Student can receive a lowered grade on the assignment, including F. • Student can be advised to seek aid from the Writing Center or Tutoring Center as a condition for receiving a grade or resubmitting an assignment. The instructor needs not take formal disciplinary action for unintentional plagiarism. Children in College Activities According to state law, preteen children are not permitted to be on campus, and only registered studentsandauthorizedcollegestaffandvolunteersmayparticipateinfieldtrips,retreats,or other college-authorized travel activities. See WAC 132P-40-001 on http://apps.Leg.wa.gov/WAC Yakima Valley Community College, 2015-2016 STUDENT RIGHT & RESPONSIBILITIES Financial Obligations Thestudentdebtpolicyisineffecttopromotefair treatment of students who are in debt to the college and to provide an accurate and systematic procedure for collecting these debts. The college intends to provide an atmosphere of support while developing a sense of responsibility in students who have incurred debts to the college. Students who have any debt reported to the registrar from any college department or operational unit will have their registration blocked and transcripts withheld until the debt is cleared or arrangements for payment are approved. It is the student’s responsibility to ensure his/her account is kept current. Students may check their balance online through the My Online Services, Class Schedule page for the exact amount of tuition and fees due. YVCC does not mail statements of account. Registration, online or in person, obligates students for payment of all tuition and class fees. Non-attendance does not relieve students of their academic and financial obligations; official withdrawal procedures must be followed. Student Participation in Governance As members of the college community, students will be free, individually and collectively, to express their views on college policy and on matters of general interest to the student body. The ASYVCC Constitution and the college’s administrative procedures provide clear channels for student participation in the formulation and application of institutional policies regarding academic and student affairs.Individualsaffectedbyapolicyshallhavea representative voice in the formulation of that policy. Obtaining Information on Requirements The student has the right to seek academic advice when planning a course of study; however, it is ultimately the student’s responsibility to read the catalog; check the requirements for his/her degree, certificate,orgraduation;contactanyschoolsto which transfer is anticipated. All degree seeking students are issued a course catalog during New Student Orientation. The course catalog can also be viewed online at www.YVCC.edu under Resources. The student should become familiar with the catalog and the admission, registration, and academic requirements contained within. YVCC occasionally hosts Transfer Fairs that are attended by four-year colleges and universities. This is an opportunity for students to discuss transferring with representatives from those colleges and universities. It is also advised to visit the other college and university’s websites for more information. YVCC provides abundant reference materials for thestudentandfacultyadvisortouse,butthefinal responsibility rests with the student. Yakima Valley Community College, 2015-2016 37 ACADEMIC RULES 38 Academic Progress Standards & Procedures Purpose Yakima Valley Community College is committed to the educational success of students. The college recognizes that individual student success requires a clear educational goal, careful courseselection,andasubstantialcommitmentofstudenttimeandeffort.Insupportofstudent success, the college provides programs and services to assist students with their educational choices and their learning processes. The college has the additional obligation to support and require academic progress for enrolled students. This is essential both for the well-being of the student and for the responsible management of the public higher education resources. Standards In order to maintain satisfactory progress while enrolled at YVCC, students are expected to maintain a grade point average of 2.0 or higher on a quarterly and a cumulative basis. Financial aidstudentsmustsuccessfullycompleteallofthecreditsforwhichtheyareawardedfinancial aidandmustearnatleasta2.0quarterlyGPAtomaintainsatisfactoryprogress.Specificdetails ofthefinancialaidsatisfactoryprogressrequirementsareavailableonlineatwww.YVCC.edu/ FinancialAidorinprintedformatattheFinancialAidOffice.Studentsmaynotalwaysbeableto maintain these academic standards, so the college provides the following rules, standards, and procedures: Determining an Academic Plan All new degree-seeking students must establish that they are prepared to succeed in their chosen educational program. Students with fewer than 30 college-level credits will be required to see their academic adviser before they can register for the following quarter. Upon completion of 30 college-level credits, students who have not declared a program or major area of study will be required to meet with their advisor to prepare a degree audit and declare a major. Commitment to Academic Goals Upon completion of 60 credits toward the transfer associate degree or an associate of applied sciencedegree,studentsmustapplyforgraduation.Certificatestudentsmustapplyfor graduationoneortwoquarterspriortograduation,dependingonthecertificaterequirements. Thistimelineisintendedtoallowsufficienttimefornecessaryadjustmentstoastudent’scourse schedule and to better support timely program completion. Students will receive an email notificationremindingthemtoapplyforgraduation. Academic Probation Students will be placed on academic probation when they fail to make satisfactory academic progress. Students fail to make satisfactory academic progress when their GPA falls below the minimum standard of 2.0. The assignment of 10 or more credits of V grades in any quarter is also considered a failure to make satisfactory academic progress and will result in the student being placed on academic probation. Academic Suspension Students who have been placed on academic probation and who fail during the next quarter to make satisfactory progress shall be suspended for one academic quarter. Students placed onacademicsuspensionwillbenotifiedbymailandmayappealbythedeadlinestatedintheir suspension letter. Students who do not appeal will be dropped from their classes (tuition will be refunded, if warranted) and will be required to meet with their advisor and complete a degree audit as a condition of re-enrollment. Students will be blocked from registration until evidence of theirdegreeauditissubmittedtotheRegistrationOffice. Academic Dismissal Students who return from prior suspension and fail to meet minimum satisfactory progress for the quarter shall be dismissed from the college, subject to appeal. If dismissal is upheld, the student will not be eligible to return until the fourth quarter following the dismissal. Students will be blocked from registration until evidence of their degree audit is submitted to the Registration Office. Yakima Valley Community College, 2015-2016 ACADEMIC RULES Academic Renewal Policy In order to encourage students who may not have been successful during their previous college work, YVCC has established an academic renewal policy. Students who return after an absence of at least a year, and who subsequently pass two quarters of work (at least 12 credits each quarter) with a 2.0 GPA or better, may petition the Registrar and Director for Enrollment Services to implement the academic renewal policy. If the petition is accepted, grades for the quarter chosen, and all quarters prior to the one chosen, will be changed to “No Credit.” All courses previously taken remain on the transcript, but the grade point average is adjusted. Courses subject to this policy will not count toward completion of the student’s program of study. Students who wish to rescind this policy must petition to the Registrar. The policy may be used only once, and students must be enrolled at the time the policy is implemented. No other college work is subject to the provisions of this policy. Attendance Class attendance is required at the discretion of the instructor. Regular class attendance is encouraged and expected. No absences, whether approved by the college for participation in collegesponsored activities or necessitated by sickness or other personal emergency, relieve the student of responsibility for work assigned for the class during an absence. The student is responsible for arranging makeup work with instructors. Faculty members may submit an administrative withdrawal whenever a student misses two consecutive class sessions and does not contact the instructor.Norefundisgivenafterthefirstweekof the quarter. A grade of “F” may be assigned by the instructor if a student does not follow the prescribed procedures for withdrawing from a course or from the college. Studentsmustbeofficiallyenrolledinacourse to attend class. Confidentiality Release of Student Information Yakima Valley Community College, in compliance with the Family Educational Rights and Privacy Act of 1974 (FERPA) 34 CFR, Part 99, has designated the following items as Directory Information: name; photographs;majorfieldofstudy;eligibilityfor andparticipationinofficiallyrecognizedactivities, organizations and sports; weight and height of members of athletic teams; dates of attendance (quarters in attendance); enrollment status (number of credits enrolled in for a quarter at YVCC); degrees and awards received; and the most recent previous educational agency or institution attended by the student. 39 YVCC may disclose any of the above-listed items without the student’s prior written consent unless theRegistrationandRecordsOfficeisnotified in writing to the contrary. Once a student has designatedaconfidentialclassification,itwillnot be removed until the student submits a signed authorization requesting that it be removed. Someoftheeffectsofthestudent’sdecision torequestconfidentialstatusmayhaveanadverse effect.Friendsorrelativestryingtoreachthe student will not be able to do so through the college; information that someone is a student here will be suppressed, so that if a loan company, a prospective employer, family members, etc., inquire about a student, they will be informed that we have no record of the student attending here. All other student academic information is consideredconfidentialandwillnotbereleased, with certain exceptions as stated in 34 CFR, Part 99, without the student’s written permission. Students must appear in person in the Registration and RecordsOfficewithphotoidentificationandmust submit their written consent for the release of other academic information. Student Privacy Rights Under FERPA The Family Education Rights and Privacy Act of 1974 (FERPA)34CFR,Part99,affordsstudentscertain rights with respect to their education records. These rights are: • The right to inspect and review the student’s education records. • The right to request the amendment of any of the student’s education records that the student believes are inaccurate or misleading. • The right to consent to disclosures of personally identifiableinformationcontainedinthe student’s education records, except to the extent that FERPA authorizes disclosure without consent. See “Directory Information” in this catalog. • TherighttofileacomplaintwiththeU.S. Department of Education concerning alleged failures by the college to comply with the requirements of FERPA. More detailed information about each of these rights is contained in the YVCC Code of Student Rights and Responsibilities Handbook. For more information on these rights, contact the Superintendent of Documents,U.S.GovernmentPrintingOffice, Washington, D.C. 20402, or visit this U.S. Department of Education website, www.ED.gov/Policy/Gen/Guid/fpco/index.html Yakima Valley Community College, 2015-2016 ACADEMIC RULES 40 Evaluation of Transfer Credit Grades New England Association of Schools Middle States Association of Colleges and Schools North Central Association of Colleges and Schools Northwest Commission on Colleges and Universities Southern Association of Colleges and Schools Western Association of Schools and Colleges Students who wish to transfer credit from international institutions must have their international transcripts evaluated through the AACRAO International Education Services or the Foundation for International Services (FIS). Contact theInternationalStudentsProgramOfficeorthe AdmissionsOfficeformoreinformation.Regardless of institutional accreditation, YVCC does not grant credit for religion or theology courses that are sectarian in nature. Credit for professional/ technical oriented courses is at the discretion of the department or division chairperson of the applicable program. Individual courses, grades, and grade points for transfer credit will not appear on the transcript nor will they be included in the cumulative grade point averages on the transcript. Only the total number of acceptable credits will be posted on the student’s YVCC transcript upon graduation; however, courses and grades used to satisfy degree requirements will be used in calculating grade point averages for the established graduation grade point standards. Students should consult the “Honors and High Honors at Graduation” section of the catalog for information on the use of grades in transfer credit courses in the calculation of honors. Errors and Changes Students who believe that an error may have been made in the grade received in a course should contact the instructor immediately. If the instructor is not available, contact the dean for that division. Grade changes for grades other than “I” will not be accepted beyond one year. The decision to grant transfer credit is based upon several factors, chief among which is accreditation. For transfer purposes, YVCC recognizes as fully accredited only those institutions that have received accreditation by one of the following associations: Final Examinations Finalexaminationsarescheduledduringthefinal week of each quarter. As a matter of college policy, individual students are not permitted to take early finalexaminations. Ifastudentmustbeabsentfromaregularfinal examination and has a valid excuse, the student may be given a special examination with the permission of the instructor and the Vice President for Instruction and Student Services. Permission slipstorequestanearlyfinalmaybeobtainedfrom theOfficeoftheVicePresidentforInstructionand Student Services. Incourseswherefinalexaminationsarenotan appropriate measure of the work, an instructor may elect not to give an examination. Yakima Valley Community College, 2015-2016 A student must earn a grade of “C” or better in prerequisite courses, unless otherwise noted. Contact the program advisor immediately if there are any questions. Grade Point Average (GPA) Grade points serve as a means of objectively stating a given level of scholarship or mastery of tasks. A point value is assigned for each grade. A complete list of these grade point values appears in this catalog. The grade point average is calculated by dividing the total number of grade points by the total number of graded (A-F) credit hours. The grade points for a particular course are determined by multiplying the grade point value of the letter grade times the number of credits. For example, a three-credit course with a grade of B has nine grade points. I, N, S, V, W, CR/NC, and * grades are not included in the calculation of the grade point average. Grade Reports Grades are available to students each quarter, one week after grades are due. Grades can be obtained by any of the following means: • Use the student Online Services Center in the RegistrationandRecordsOfficeortheHopf Student Union Building. • Go to the YVCC Internet address at www.YVCC. edu, click “Student Portal” then “Registration”, then“UnofficialTranscript.” • VisittheRegistrationandRecordsOffice,show photoID,andobtainanunofficialcopyofthe transcript. • WritetheRegistrationandRecordsOfficeand request a copy. Include signature, student identificationnumber,andmailingaddress. Transcripts Anofficialtranscriptisacopyofthestudent’s academic record bearing the school’s seal and thesignatureoftheregistrar.Officialtranscripts are released to the student or third parties at the student’s written request. There is a 72-hour turnaroundtimeforofficialtranscripts.Afeeof $1.00 per copy will be charged for transcript requests of 10 or more. Unofficialtranscriptsforadvisingpurposesare furnished to the student upon request and with photoidentification.Studentsmayobtainthemby visiting our website or by using the Online Services ACADEMIC RULES CenterintheRegistrationandRecordsOfficeorin the Hopf Student Union Building. Confidentiality of Grades While YVCC recognizes the legitimate interest of parents and guardians to consult with the professionalstaffabouttheacademicandpersonal well-being of their sons and daughters, parents will not be furnished grade reports or transcripts without written permission from the student. Likewise, the spouse of a married student, regardless of the student’s age, will be given such information only with the written consent of the student. Students must appear in person in the Registration and RecordsOfficewithphotoidentificationandmust submit their written consent for the release of their grades. (See “Release of Student Information”). Grading Symbols Grades of A through D, S, and CR are considered passing grades; however, some degree programs may have restrictions on the use of the D, S, and CR grades. These grades may not be acceptable in meeting general or major requirements at some transfer institutions. The grade A is the highest possible grade, and grades below D are considered failing. Plus (+) or minus (-) signs are used to indicate grades that fall above or below the letter grades, but grades of A+ and D- are not used. Additional information regarding other grades used is provided below. For purposes of calculating grade points and averages, the grade point values are as in the following chart. Grade Description Gradepoint A Excellent 4.0 A3.7 B+ 3.3 B Above Average 3.0 B2.7 C+ 2.3 C Average 2.0 C1.7 D+ 1.3 D Below Average 1.0 F Failure 0.0 CR Credit or Progress 0.0 I Incomplete 0.0 N Audit 0.0 NCNo Credit 0.0 R Repeat 0.0 S Satisfactory 0.0 V Unofficial/AdministrativeWithdrawal 0.0 W OfficialWithdrawal 0.0 * No Grade Reported 0.0 CR/NC - Credit/No Credit Generally for use by the nursing and English departments. CR indicates credit will be granted to nursing students or, for English students, where progress was shown. English students who receive 41 a grade of CR in sub-100-level English courses have indicated progress was made in the course; however, a grade of S must be earned before they can progress to the next level of English. NC indicates no credit will be granted. Grades of CR/NC are not included in the grade point average calculation. I - Incomplete An incomplete grade (I) indicates that work is satisfactory as far as completed. It permits the student to complete the remaining work within fiveweeksofthefollowingtermifthestudentis registered or, if the student is not registered, within one calendar year. The I grade may be given in cases where a student has been in attendance and done satisfactory work up to a time near the end of the quarter but is unable to complete all work by the close of the quarter due to illness or other extenuating circumstances. Submission of I grades must be accompanied by a signed Incomplete Grade Card indicating what work is to be completed. The Incomplete Grade Card also requires the instructor to provide the grade a student should receive if the work is not completed within one year. I grades are not included in the GPA calculation. N- Audit Students may receive an audit grade (N) without instructor approval by indicating the audit category at the time of registration or by changing to audit during the designated add period. Students seeking an audit after the designated add period must meet with their instructor for approval. The instructor must sign their approval on an add/drop form before theRegistrationandRecordsOfficecanprocess the request. Auditing students are exempt from examinations and do not receive college credit; however, the instructor may require reasonable attendance and class participation. N grades are not included in the GPA calculation. The Student must meet all prerequisites for a class in order to audit the class. P/F - Pass/Fail YVCC does not use the P grade. See S (satisfactory) grade. R - Repeat The repeat (R) designation indicates that a student hasrepeatedaYVCCcourse.Studentsmustfilea RepeatCardintheRegistrationandRecordsOffice so that the grade point can be adjusted upon course completion. I, N, W, and V grades have no grade point value; therefore, no repeat cards are necessary when repeating a course for which a student received such a grade. All courses taken and all grades earned in compliance with the YVCC High-Demand Course Repeat Rule will appear on the student’s transcript. For all repeated courses, the higher grade forgives the lower grade and replaces it in GPA computations; however, the lower grades Yakima Valley Community College, 2015-2016 ACADEMIC RULES 42 will remain on the transcript but will not be used to compute the YVCC cumulative GPA. Grades received in violation of the YVCC High-Demand Course Repeat Rule will not be used in GPA computations and will not appear on the student’s transcript. See the complete text of the rule in this catalog or on the web at www.YVCC.edu * - No Grade The asterisk (*) is recorded on the permanent transcript when no grade is submitted by the instructor. The asterisk will remain on the transcript untilanofficialGradeChangeCardissubmittedto theRegistrationandRecordsOfficebytheinstructor. The asterisk is not included in the GPA calculation. S - Satisfactory The S grade indicates a satisfactory level of performance (C grade minimum) by the student. It is considered a passing grade but is not included in the GPA calculation. This grade may be used in certain instances where A-F grading is deemed inappropriate. Instructor permission required. Repeating a Class V - Unofficial Withdrawal Anunofficialwithdrawal(V)maybeassignedbyan instructor at the end of a quarter if the student has notofficiallywithdrawnfromacourse.Submission of a V grade must include the last date the student participated in class or was otherwise engaged in an academically related activity, such as by contributing to an online discussion or initiating contact with a faculty member to ask a course-related question. Each instructor must determine if it is appropriate to assign a V. A grade of F may be assigned by the instructor if a student does not follow the prescribed procedures for withdrawing from a course or from the college. The assignment of 10 or more credits of V grades in any quarter results in the student being placed on academic probation. V - Administrative Withdrawal An administrative withdrawal may also be assigned by an instructor during the quarter if the student has two or more consecutive unexcused absences. Submission of V grades must include the last date the student participated in class or was otherwise engaged in an academically related activity, such as by contributing to an online discussion or initiating contact with a faculty member to ask a courserelated question. Instructors who wish to withdraw students for lack of attendance at any time prior to the designated withdrawal deadline for the quarter maynotifytheRegistrationandRecordsOffice after the second missed class meeting. Students administratively withdrawn from a course will not be eligiblefortuitionrefundsafterthefirstweekofthe quarter. W - Official Withdrawal Anofficialwithdrawal(W)willbeassignedifa student drops a course or withdraws from the collegeafterthefirst10daysofthequarter(oras specifiedforshortersessions).AgradeofForVmay be assigned by the instructor if a student does not follow the prescribed procedures for withdrawing from a course or from the college. W grades are not included in the GPA calculation. Yakima Valley Community College, 2015-2016 State board policy permits only two repeats in addition to the original enrollment, except for certain performance classes. See the High Demand Course Repeat Rule which explains more stringent guidelines for repeating courses that are in high demand. High Demand Course Repeat Rule General Rule The YVCC High Demand Course Repeat Rule was developed to provide students with fair access to high demand classes. It allows students to repeat courses. In high demand circumstances, a course can be taken twice (once initially and once repeated). All letter grades earned, A through F as well as I, V, or W grades, will be reported on a student’s transcript. This course repeat rule applies to courses with wait listswhichareidentifiedbythedepartmentsashigh demand. YVCC departments reserve the right to establish program course repeat rules which may be more stringent than this college-wide High Demand Course Repeat Rule. Student Responsibility It is the student’s responsibility to understand and adhere to this and all college rules. Students who are discovered to have violated this policy will be administratively dropped from classes. A student repeating a course is responsible for completing a course repeat card, which may be obtained in the RegistrationandRecordsOffice,requestingthattheir GPA be recalculated. Violations Students will not receive credit for courses taken in violation of this college High Demand Course Repeat Rule. Related grades will not be used in computing GPAs, and the course will not appear on the student’s transcript. GPA Applications All courses taken and all grades earned in compliance with the guidelines of this policy will appear on the student’s transcript. The higher grade forgives the lower grade and replaces it in GPA computations. The lower grade will remain on the transcript but will not be used to compute the YVCC cumulative GPA. Grades received in violation of this rule will not be used in GPA computations and will not appear on the student’s transcript. A student ACADEMIC RULES transferring to another college should check that school’scourserepeatpolicy.Itmaydifferfromthis repeat rule. Exemptions The YVCC High Demand Course Repeat Rule does not apply to the following courses: • Courses with numbers below 100 (e.g., ENGL 090T) • Foreign language classes • Studio art, metalsmithing, design, and painting classes • Non-highdemandcourses(asdefinedby departments) • Courses designed to be repeated, for example: performance courses (e.g., music, physical education), seminar courses where content changes quarter to quarter, Math Center and Writing Center courses, or other courses designed for multiple quarter enrollment Waivers In extraordinary circumstances, and upon receipt of an acceptable plan of study, the Faculty member teaching the class, area dean, or the Vice President of Instruction and Student Services may provide written authorizationtotheOfficeofAdmissionstowaive this rule for a student. Honor Roll Each quarter the college recognizes outstanding academic achievement by placing students on the President’s List or the Dean’s List. Each of the students who meets the criteria for these designationswillreceivealetterandacertificate acknowledging this award. A notation of the award will also be placed on the student’s permanent transcript. President’s List To receive the President’s List designation, a student must earn both of the following: • A quarterly grade point average of 3.85 or higher. • A minimum of 12 graded credits (S & CR grades not included). Dean’s List To receive the Dean’s List designation, a student must earn both of the following: • A quarterly grade point average of 3.40 to 3.84. • A minimum of 12 graded credits (S & CR grades not included). Part-time Students The college is aware that some of our part-time studentshavealsoachievedsignificantacademic success while balancing full-time jobs, family responsibilities, and college studies. Part-time students are eligible each time they complete 43 12 credits at YVCC and their GPA falls within the designated list for the quarter. Dean’s List and President’s List notations will be posted on the transcript for the quarter in which the 12 credits are completed at YVCC . Part-time students need to notifytheRegistrationandRecordsOfficeeachtime they qualify. Non-Traditional Learning Yakima Valley Community College recognizes nontraditional learning as an important process in which students can receive college credit. Non-traditional learning is the knowledge and skills gained through work and life experience; through military training and experience; and through formal and informal education and training from in-state and out-of-state institutions including foreign institutions. Assessment of non-traditional learning is a means of determining whether or not the knowledge, skills, and abilities a student has gained through prior learning match the knowledge, skills, and abilities a student would gain bycompletingaspecificcourse.Qualifiedfaculty approve the appropriate course placement. No more than 45 credits of non-traditional learning credit will be awarded and no more than 25% of the program may be based upon credits granted using a prior experiential learning methodology, such as portfolio review. Credit will be awarded after the student completes one quarter at YVCC and only for courses within the institution’s regularcurricularofferings.Pleasevisitthe Non-Traditional Learning website for the most current information on Non-Traditional Learning. YVCC has categorized non-traditional learning into four distinct categories: Credit by Testing; Prior Experiential Learning; Extra-Institutional Learning; and Course Challenges. Credit by Testing Commonly accepted higher education equivalency examinations that are documented via a transcript orotherofficialrecord.YVCCrecognizesCredit by Testing through Advanced Placement (AP), International Baccalaureate (IB), College Level Examination Program (CLEP), and DANTES Subject Standardized Tests (DSST). Advanced Placement The Advanced Placement (AP) Program is a testing program of the College Entrance Examination Board (CEEB). It is a special, college-level, learning experience for high school students, which can take the form of an honors class, a strong regular course, a tutorial, or an independent study. High school students who have participated in the Advanced Placement Program during high school or have developed an equivalent background throughself-initiativemaytaketestsofferedbythe College Board each year during the month of May, and scores will be reported to three colleges of the student's choice. The student must have successfully Yakima Valley Community College, 2015-2016 ACADEMIC RULES 44 completed one quarter at YVCC before advanced placement credit will be placed on the transcript. Scores in computer science, economics, and music may also be submitted and will be evaluated on a case-by-case basis. Credit will be granted to students entering YVCC who have submitted scores from the College Board Advanced Placement Examinations Program. YVCC grants credit for scores of 3 or higher in Advanced Placement exams as follows: Exam Score Credit Art - History 3 5 Biology 3+ 5 Calculus AB 3+ 5 Calculus BC 3+ 10 Chemistry 3 5 Chemistry 4 5 Chemistry 5 5 English Language & Composition 3 or 4 5 English Language & Composition 5 10 English Literature & Composition 3+ 5 Economics: Micro 3+ 5 Economics: Macro 3+ 5 French Language & Culture 3 5 French Language & Culture 4 10 French Language & Culture 5 15 German Language & Culture 3 5 German Language & Culture 4 10 German Language & Culture 5 15 Geography 3+ 5 Government & Politics 3+ 5 History - European 3 or 4 5 History - European 5 10 History - U.S. 3 or 4 5 History - U.S. 5 10 Music Listening/Literature 3+ 5 Physics 3 or 4 5 Physics 5 5 Physics B Physics B 3 or 4 5 5 15 Psychology 3+ 5 Spanish Language & Culture 3 5 YVCC Courses ART& 100 BIOL 109 MATH& 151 MATH& 151, 152 CHEM 100 CHEM 109,110 CHEM 141,151 ENGL& 101 ENGL& 101, 102 ENGL& 101 ECON& 201 ECON& 202 FREN 101 FREN 101, 102 FREN 101,102,103 GERM 101 GERM 101, 102 GERM 101,102,103 EOG& 200 POLS& 202 HIST& 117 HIST& 117, 118 HIST& 136 HIST& 136, 137 MUS& 105 PHYS 115/125 PHYS 115/125. 116/126, 117/127 PHYS 115/125 PHYS 115/125. 116/126, 117/127 PSYC& 100 SPAN 101 Yakima Valley Community College, 2015-2016 Exam Score Credit Spanish Language & Culture 4 10 Spanish Language & Culture 5 15 Statistics 3+ 5 YVCC Courses SPAN 101, 102 SPAN 101,102,103 MATH& 146 International Baccalaureate Yakima Valley Community College is proud to recognize students who have completed International Baccalaureate (IB) courses as part of their high school curriculum. IB courses are challenging and demanding, and YVCC believes they provide exceptional readiness for the rigors of higher education. Five quarter credits are granted for Standard Level (SL) subjects in which a grade of 5 or higher is earned. Ten quarter credits are granted for Higher Level (HL) subjects in which a grade of 5 or higher is earned. The student must have successfully completed one quarter at YVCC before IB credit will be placed on the transcript. Credit will be granted to students entering YVCC who have submitted scores from the IB Organization. YVCC grants credit for scores of 5 or higher in International Baccalaureate exams as follows: Exam Score Credit YVCC Courses Language A: Literature (SL) 5+ 5 ENGL& 101 Language A: Literature (HL) 5+ 10 ENGL& 101 and ENGL& 102 Language A: Language and Literature (SL) 5+ 5 ENGL& 101 Language A: Language and Literature (HL) 5+ 10 ENGL& 101 and ENGL& 102 Spanish (SL) 5+ 5 SPAN 101 Spanish (HL) 5+ 10 SPAN 101 and SPAN102 Spanish ab initio (SL) 5+ 5 SPAN 101 Business Management (SL) 5+ 5 BUS& 101 Business Management (HL) 5+ 10 BUS&101 and BA 158 Economics (SL) 5+ 5 ECON& 201 Economics (HL) 5+ 10 ECON& 201 and ECON& 202 Geography (SL) 5+ 5 GEOG& 200 Geography (HL) 5+ 10 GEOG 101 and GEOG& 200 History (SL) 5+ 5 HIST 104 or HIST 105 History (HL) 5+ 10 HIST 104 and HIST 105 Information Technology in a Global Society (SL) 5+ 5 IT 101 ACADEMIC RULES Exam Score Credit YVCC Courses Information Technology in a Global Society (HL) 5+ 10 IT 101 and elective credit Philosophy (SL) 5+ 5 PHIL& 101 Philosophy (HL) 5+ 10 PHIL& 101 and PHIL& 120 Psychology (SL) 5+ 5 PSYC& 100 Psychology (HL) 5+ 10 PSYC& 100 and PSYC& 200 Social & Cultural Anthropology (SL) 5+ 5 ANTH& 206 Social & Cultural Anthropology (SL) 5+ 10 ANTH& 100 and ANTH& 206 Biology (SL) 5+ 5 BIOL 109 Biology (HL) 5+ 10 BIOL 109 and BIOL 201 Chemistry (SL) 5+ 5 CHEM 109/110 Chemistry (HL) 5+ 10 CHEM 109/110 and CHEM&141/151 Computer Science (SL) 5+ 5 IT 101 Computer Science (HL) 5+ 10 IT 101 and elective credit Design Technology (SL) 5+ 5 ENGR 100 and ENGR 108 Design Technology (HL) 5+ 10 ENGR 100, ENGR 104 and ENGR 108 Environmental Systems & Society (SL) 5+ 5 BIOL 102 Physics (SL) 5+ 5 PHYS 115/125 Physics (HL) 5+ 10 PHYS 115/125 and PHYS 116/126 Further Mathematics (HL) 5+ 10 Undecided Mathematical Studies (SL) 5+ 5 MATH 107 Mathematics (SL) 5 5 MATH& 142 Mathematics (SL) 6 or 7 5 MATH& 151 Mathematics (HL) 5+ 10 MATH& 151 and MATH& 152 College-Level Examination Program College-Level Examination Program (CLEP) examinations are based on undergraduate courses offeredduringthefirsttwoyearsofcollegestudy. They are developed by college instructors for the purpose of awarding college credit. Like endof-course examinations, CLEP exams demand comprehensive subject knowledge. Both CLEP subject and general examinations yield credit at YVCC when satisfactory performance levels are reached. CLEP examinations yield credit at YVCC when satisfactory performance levels are reached. CLEP tests are available in over 50 college subjects. 45 Credit will be granted to students entering YVCC who have submitted scores from the College Board Advanced Placement Examinations Program. YVCC grants credit for CLEP examinations as follows: Exam Score Credit YVCC Courses American Government 50+ 5 POLS& 202 American Literature 50+ 5 ENGL 220 Biology 50+ 5 BIOL 109 Calculus 50+ 5 MATH& 151 Chemistry 50+ 5 CHEM 100 College Composition 50+ 5 ENGL& 101 College Mathematics 50+ 5 MATH& 107 English Literature 50+ 5 ENGL 264 Financial Accounting 50+ 5 ACCT& 201 French- Level 1 50+ 5 FREN 101 French- Level 2 59+ 10 FREN 101 and FREN 102 German- Level 1 50+ 5 GERM 101 German- Level 2 60+ 10 GERM 101 and GERM 102 History of the US I 50+ 5 HIST& 136 History of the US II 50+ 5 HIST& 137 Human Growth & Development 50+ 5 PSYCH213 Humanities 50+ 9 HUM 102 and HUM 103 HUM 104 Information Systems & Computer Applications 50+ 5 IT 101 Intro to Educational Psychology 50+ 5 Elective Credit SS distribution Intro to Business Law 50+ 5 BUS& 201 Intro to Psychology 50+ 5 PSYCH& 100 Intro to Sociology 50+ 5 SOC& 101 Pre-calculus 50+ 5 MATH& 107 Principles of Macroeconomics 50+ 5 ECON& 202 Principles of Management 50+ 5 BA 158 Principles of Marketing 50+ 5 BA 156 Principles of Microeconomics 50+ 5 ECON& 201 Spanish- Level 1 50+ 5 SPAN 101 Spanish- Level 2 63+ 10 SPAN 101 and SPAN 102 Western Civilization I 50+ 5 HIST& 116 Western Civilization II 50+ 5 HIST& 118 Yakima Valley Community College, 2015-2016 ACADEMIC RULES 46 DANTES Standardized Subject Test DANTES Standardized Subject Test (DSST) examinations are based on undergraduate courses offeredduringthefirsttwoyearsofcollegestudy. They are developed by college instructors for the purpose of awarding college credit. Similar to CLEP examinations, DSST exams demand comprehensive subject knowledge. DSST examinations yield credit at YVCC when satisfactory performance levels are reached. YVCC is currently in the process of evaluating DSST examinations to determine the credit awarded classes that will result from a successfully completed DSST examinations. Please visit the Non-Traditional Learning website for the most current information on DSST examinations. Prior Experiential Learning Knowledge and skills acquired through experience alone, evaluated by faculty via evaluation of a compilation of work. YVCC is currently working on identifying departments interested in this type of non-traditional learning. Please visit the Non-Traditional Learning website for the most current information on Prior Experiential Learning. Extra-Institutional Learning Knowledge and skills acquired outside the institution andobjectivelyverifiedthroughthird-party certifications,industry-recognizedtesting/training, and crosswalks. Military training and experience willbeassesseduponevaluationofanofficialJoint Services Transcript. YVCC is currently working on identifying departments interested in this type of non-traditional learning. Please visit the Non-Traditional Learning website for the most current information on Extra-Institutional Learning. Course Challenge Under guidelines approved by each department, current students may challenge courses in which they believe they have substantial prior learning. This policy is meant to provide department faculty with a way to grant credit in appropriate courses to students who demonstrate mastery of the course outcomes. The policy for course challenge is outlined below: • Students may only challenge a course or courses for which they have not received college credit at any accredited institution. • The student must be enrolled in at least one course at YVCC during the quarter a course is challenged; however, the student cannot be enrolled in the course to be challenged. • The student should review degree requirements in this catalog to determine limits on using courses with S grades. • Credits earned by the challenge process do not count toward the residency requirement. See “Degree Requirements” in the course catalog. Yakima Valley Community College, 2015-2016 • • • • • • Thecoursebeingchallengedmustbeoffered during the quarter in which it is being challenged unlessotherwisespecifiedbythedepartment. Department faculty will determine which, if any, of their courses may be challenged. Any full-time YVCC instructor, with the signature of the department head on the course challenge form, may administer challenge examinations in accordance with departmental policy. In the event that a full-time instructor is not available, the department head, in consultation with the dean, may request that an adjunct faculty member administer a challenge exam. A course may be challenged only once. Challenge examinations must be given prior to the day grades are due each quarter. Credits earned will be recorded on the transcript with an S grade. A student must have a prior YVCC transcript to challenge a course. An unsuccessful challenge will not be posted. Course Challenge Process 1. Obtain a Course Challenge Form from the Registration&RecordsOffice. 2. Meet with the department head of the class to be challenged. The department head will help determine if the class is available for challenge and must sign the Course Challenge Form before the student can proceed to the next step. 3. Pay the cashier a nonrefundable, $25.00 per credit examination and transcription fee. 4. See the designated instructor to schedule the examination date. Upon successful completion of the course challenge, the instructor must sign the Course Challenge Form. Students failing the challenge test will not be given a grade, and no reference will be placed on the transcript. 5. Proceed to the dean of the department for an approval signature. 6. Take the completed Course Challenge Form to theRegistrationandRecordsOffice.Thecourse will be posted to the transcript with a grade of S at the end of the quarter. DEGREES 47 General Education Requirements: In order to meet general requirements, all candidates for degrees from Yakima Valley Community College must have: A minimum of 90 quarter credits; some professional/technical degrees require more A cumulative college-level grade point average of 2.0 or higher at YVCC A minimum of 30 credits completed at YVCC Exception Petition While candidates are expected to comply with all degree requirements, a student may request an exception if there are extenuating circumstances which warrant consideration. The review process isinitiatedbythestudent’ssubmissionofawrittenpetitiontotheRegistrationandRecordsOffice outlining the exception requested and stating the reasons for the request. The petition should be submitted with the degree application two quarters before the student plans to graduate. The Registrar & Director of Enrollment Services, in consultation with the Dean of Student Services, will reviewthepetition.Thestudentwillreceivewrittennotificationofthedecision. YVCC Student Learning Outcomes The college faculty recognizes two institutional student learning outcomes, Analytical Reasoning and Communications, that are integral to the mission of YVCC. The faculty continues to consider these outcomes and how they apply across the divisions. General Education Requirements A substantial core of general education is regarded as an essential component of all instructional programs. In order to meet general requirements, all candidates for degrees from Yakima Valley Community College must have: A minimum of 90 quarter credits; some professional/technical degrees require more. A cumulative college-level grade point average of 2.0 or higher at YVCC A minimum of 30 credits completed at YVCC General Education in Transfer Degrees (60+ credits) General education in the transfer degrees introduces students to the content and methodology of the major areas of knowledge—the humanities, the natural sciences, and the social sciences. The facultyhasidentifiedandadoptedtwofundamentalabilitiesessentialtolifelonglearningthatare assessed in courses across the degree. • Analytical Reasoning is the ability to consider an issue, idea, or concept systematically and assess the component parts and their application. • Communication includes the delivery and reception of ideas. Sixotherabilitiesreflectskillsandvalueswhichthefacultyconsiderimportanttobeinganeducated person. Historical perspective, research, aesthetic literacy, service learning, problem solving, and cross-cultural global perspective are practiced within various courses of the general education curriculum. General Education Requirements for Applied Science Professional/Technical Degrees and Certificates (45+ credits) Inordertobeawardedanappliedsciencedegreeorcertificate,studentsmustcompletecourses covering three core competency distribution areas: computation, communication, and human relations.Specificcoursesarerequiredthatwillfulfillthesecompetencies.Thecurriculumin professional/technical areas is competency based and has been developed to meet industry-wide skills standards. Honors at Graduation Graduateswithexceptionalacademicqualificationswhoarecompletinganassociatedegreeora certificaterequiring45ormorecreditsmaygraduatefromYVCCwithhonorsorhighhonors.The designations are based on the cumulative college-level grade point average. Calculations are based only on YVCC coursework numbered 100 and above, whether or not the coursework is required by a particular program. Courses numbered 099 or below are not considered. Because the honors/high honors designations are granted by YVCC, transfer credits are not used in calculating Grade Point Averages (GPA). Eligibility is limited to qualifying graduates who have completed at least 30 credits at YVCC. Classes taken during spring quarter will not be included in GPA calculations since grades will not have been posted before the time of commencement. To receive the honors designation, students must earn a YVCC college level GPA of 3.40 to 3.84. To receive the high honors designation, students must earn a 3.85 or higher college-level GPA. Yakima Valley Community College, 2015-2016 48 Reciprocity Agreement DEGREES Washington community and technical colleges (CTCs) offerreciprocitytostudentswhoaretransferring within the CTC system and are pursuing a Direct Transfer Agreement degree or the Associate in Science - Transfer degree. Students who completed an individual course that met distribution degree requirementsorfulfilledentireareasoftheirdegree requirements at one college will be considered to have met those same requirements, if they plan to complete the same degree, when they transfer to another community or technical college in Washington. The degree requirements include communication skills, quantitative skills, or one or more distribution area requirements. Students must initiate the review process and must be prepared to provide necessary documentation. Reciprocity Procedures Students who transfer from another community or technical college to YVCC may be eligible for reciprocity if they have: • Applied for admission to YVCC • Completed an individual course at the other college that meets the communication, quantitative, or distribution area requirement or completed entire areas of their degree requirements for the same degree at the other college (communication, humanities, etc.) • Maintained a cumulative, college-level GPA of 2.0 or better at the other college • Met the other college’s residency requirement (minimum number of credits required to earn their degree) • Continued to pursue the same academic transfer degree at YVCC • Met YVCC prerequisite, general education, and graduation requirements • Provided all necessary documentation to YVCC (a reciprocity agreement request form is located in theRegistrationOffice) Uponreceiptofthecompletedformandofficial transcripts from the other college, YVCC agrees to consider that the distribution area requirements have been met upon evaluating the student’s transcript. Yakima Valley Community College, 2015-2016 Transfer Credits Under the Reciprocity Agreement 1. Requestanofficialcopyofyourtranscriptfrom the other college be sent to YVCC for evaluation. 2. Obtain a copy of the evaluation results from the RegistrationOffice.Reviewtheresultsofyour transfer evaluation. If you think that reciprocity applies to you, complete and mail the reciprocity agreement request form (obtain the form from theRegistrationOffice)totheregistrar’sofficeat the other college. 3. The other college will complete the form and senditbacktotheYVCCRegistrationOffice.A copy will then be mailed to you. The reciprocity agreement request form must be attached to your YVCC graduation application. It is also required that you inform your advisor of the agreement in order to ensure proper advising concerning your educational goals. For additional information concerning the reciprocity agreement, contact the credentials evaluator in the RegistrationOffice. Specification of Catalog Year Studentsmayelecttograduateundertheofficial printedcataloginforceatthetimetheyfirstentered YVCC, provided they remain continuously enrolled (continuousenrollmentisdefinedasattendinga minimum of two quarters out of each academic year)andthelapsedtimedoesnotexceedfiveyears. Theymayalsochoosetograduateundertheofficial printed catalog in force at the time they apply for graduation. BACHELOR OF APPLIED SCIENCE DEGREES Community and technical colleges play an important role in producing baccalaureate degree graduates in Washington State. State Board of Community and Technical Colleges advocated for community and technical college applied baccalaureate programs to help: • Meet state goals for increasing the overall number of baccalaureate degrees awarded to 42,400 per year. The community and technical college system will need to increase the number of their students who transfer to a baccalaureate program to 22,000 by 2030 including 1,400 baccalaureate degrees awarded. • Expand the workforce mission of community and technical colleges to serve the needs of local and state employers. • Increase educational pathways for professional and technical associate graduates who have been limited in their ability to apply credits toward a bachelor degree. The workforce student population is comprised of a large portion of people of color, older working adults, and people (women) who are place-bound with family responsibilities. Thesedegreesaredesignedtohelplocalstudentsgrowprofessionally,financially,andpursue their educational goals here in Yakima. Consider enrolling in Yakima Valley Community College's bachelor degree program. Degrees Offered Bachelor of Applied Science in Business Management Bachelor of Applied Science in Information Technology Networking - System Administration Bachelor of Applied Science in Business Management The Bachelor of Applied Science Degree in Business Management (BASM) at Yakima Valley Community College is designed for prospective students who have earned an associate of applied science, associate in arts DTA, or associate in business DTA and need a pathway to a bachelor’s degree. This pathway combines lower-division technical and transfer courses with upper-division credits in business management resulting in an application-oriented four-year degree. The BAS caters to working adults. Classes meet in the evenings one time per week for two hours and seats are available in Yakima and Grandview. Continued instruction and student interaction takes place online. Full-timestudents,thosetaking15creditsperquarter,canfinishtheprogramintwoyears onceprerequisiteshavebeenmet.Currently,coursesarescheduledtobeofferedduringthefall, winter, and spring quarters. This program is also open for part-time enrollment. Bachelor of Applied Science in Business Management For more information visit: www.YVCC.edu/BASIT WhileadmissionintotheBASprogramsarecompetitive,allinterestedandqualifiedindividuals are encouraged to apply. For admission and selection information, go to www.YVCC.edu/ Bachelors Yakima Valley Community College, 2015-2016 49 TUITION RATES 50 YAKIMA VALLEY COMMUNITY COLLEGE TUITION AND FEES - 300 level and above 2015 - 2016 Academic Year Tuition is set by the State Board for Community and Technical Colleges which acts upon legislative authority. Rates are subject to change. Washington Resident International Nonresident Per Credit Charges: State Tuition-Operating 224.29 Fee 564.26 State Tuition-Building Fee 10.58 23.58 Student Activity Fee 10.58 10.58 YVCC Technology Fee 4.50 4.50 YVCC ELearning Fee 3.00 3.00 YVCC Combined Service 4.50 Fee 4.50 Per Credit 257.45 610.42 Total Charges per Credit 1 257.45 610.42 2 514.90 1220.84 3 772.35 1831.26 4 1029.80 2441.68 5 1287.25 3052.10 6 1544.70 3662.52 7 1802.15 4272.94 8 2059.60 4883.36 9 2317.05 5493.78 10 2574.50 6104.20 11 2591.88 6122.27 12 2609.26 6140.34 13 2626.64 6158.41 14 2644.02 6176.48 15 2661.40 6194.55 16 2678.78 6212.62 17 2696.16 6230.69 18 2713.54 6248.76 Per credit over 18 242.37 595.34 * Total cost includes state tuition and fees, combined service fees of $4.50 per credit up to a maximum of $45.00, a $4.50 per credit technology fee, and a $3.00 per credit eLearning fee. Special course or laboratory fees may apply to certain courses and will result in additional charges. See course materials for more information. A processing fee is deducted from all college withdrawal refunds $5.00 for part-time, $10.00 for full-time. Note: Veterans may be entitled to reducedtuition.ContacttheVeterans’Officeforqualifyinginformation. Yakima Valley Community College, 2015-2016 TRANSFER DEGREE INFORMATION Direct Transfer Degrees (DTA) YakimaValleyCommunityCollegeofferstheAssociateinArtsDTA.TheAssociateinBusinessDTA degree ensures satisfaction of lower division general education (or core) requirements and lower division business requirements at the state baccalaureate institutions. Students who earn any of these degrees will normally be prepared to transfer to Washington colleges and universities with junior standing, having met most lower-division general education requirements subject to the provisos listed in the Inter-College Relations Committee (ICRC) Handbook. The handbook is available at www.WashingtonCouncil.org or in the YVCC Counseling and Advising Center. The college endorses the Policy on Inter-College Transfer among Washington public colleges and universities, which was approved by the Higher Education Coordinating Board in February, 1986. YVCCoffersanAssociateinScience-TransferTrack1orTrack2degree.Specialadvisingis required. Degrees Offered The Associate in Arts DTA, the Associate in Business DTA, and the Associate in Science - Transfer degree are designed for students intending to transfer to a four-year college or university. These degreesareallpartoftheICRCtransferagreementandofferseveraloptionsdependingonthe student’s area of interest. Senior institutions in Washington that honor these agreements are listed below under “Transfer Information.” Associate in Arts DTA Associate in Business DTA Associate in Science - Transfer Track 1 or Track 2 TheAssociateofAppliedScience-TransferdegreeisofferedthroughtheWorkforceEducation Division.Foradditionalinformation,referenceProfessional/TechnicalDegreesandCertificates. General Information Students who plan to transfer from YVCC to another college or university should work closely with a faculty advisor and study the following information: • At the time of transfer, students will be expected to meet the entrance requirements of the institutions to which they are transferring. The transferability of courses taken at YVCC is determined by the institution to which the student transfers. Other institutions accept most YVCC distribution courses. • Electives should be chosen carefully from courses numbered 100 or above and according to the guidelines found in the electives section for each degree. Students should work closely with faculty advisors before attempting to transfer professional/technical courses. • A student may earn a total of more than 90 credits at YVCC, but the total number of credits accepted for transfer is determined by the institution to which the student transfers. • Courses numbered below 100 will not normally transfer to a baccalaureate institution. To complete the transfer process to a senior institution, students are advised to follow these procedures: 1. Review a current catalog of the institution to which they wish to transfer to and obtain current informationregardingadmissionproceduresandspecificmajorrequirements.Studythe entrancerequirementsandsuggestedfirst-andsecond-yearlevelcoursesinthemajorfield ofinterest.Institutionsdifferintheirtreatmentofcreditsreceived. 2. Discuss with a YVCC counselor or advisor about transfer needs. Transfer guide sheets for seniorinstitutionsareavailableonmostwebsitesforspecificcolleges. 3. Confer,eitherbyletterorpersonalinterview,withanadmissionsofficeratthesenior institution for information about curriculum and transfer regulations. 4. Check carefully a quarter or two before transferring to be sure that all requirements will be met and all regulations are observed to the satisfaction of the senior institution. Lastminutechangesinastudent’smajorfieldofstudyorchoiceofseniorinstitutionmaycreate transfer problems. Such changes should be made only after consultation with advisors. Yakima Valley Community College, 2015-2016 51 52 TRANSFER DEGREE INFORMATION Degree Application Procedures for DTA All candidates for a DTA must submit a degree application for approval. Students are required to submit their applications once they have completed a total of 60 credits. This is intended to allow sufficienttimeformeaningfuladjustmentstoa student’s course schedule in order to better support timely program completion. Follow these steps to apply: 1. Obtain the appropriate degree application online at www.YVCC.edu or from the Registration and RecordsOffice. 2. Make an appointment with assigned advisor and complete all information requested on the application. 3. Obtain necessary signatures. 4. Take the completed application to the Cashier’s Office,paythe$10graduationfee,andreturn the application marked “PAID” to the Registration andRecordsOffice. Studentswillbenotified,inwriting,ifthedegree application cannot be approved as submitted. To apply for a high school diploma (SHB 1758) by earning an associate degree, see “Pathways to a High School Diploma” section of the catalog. Senior Institutions These senior institutions honor the ICRC transfer agreement: • Bastyr College • Central Washington University • Cornish College of the Arts • Eastern Washington University • Gonzaga University • Heritage University • Northwest University • PacificLutheranUniversity • Saint Martin’s University • SeattlePacificUniversity • Seattle University • The Evergreen State College • University of Washington • Washington State University • Western Washington University • Whitworth University Students wishing to enter institutions not listed above should confer with a counselor or advisor as early as possible so that appropriate course equivalencies at YVCC can be accurately selected. Mostoftheschoolslistedhavesomespecific requirements which can be met at YVCC but are not required in our AA degrees. Check with an advisor earlyinyouracademiccareertofindoutabout additional requirements of your chosen transfer institution. Yakima Valley Community College, 2015-2016 Transfer-back Policy It is sometimes in the best interest of students to transfer to a baccalaureate-granting institution before satisfying the requirements for a transferable associate degree at YVCC. Therefore, students who have completed a minimum of 30 credits at YVCC may complete YVCC’s requirements for a transferable associate degree at another accredited institution of higher learning if the courses being applied are deemed to be equivalent to YVCC’s course requirements. Transfer Rights & Responsibilities Student Rights & Responsibilities Students have the right to fair and equitable treatment by the colleges and universities of Washington as outlined in the guidelines below. 1. Students have the right to clear, accurate, and current information about their transfer admission requirements, transfer admission deadlines, degree requirements, and transfer policies that include course equivalencies. 2. Transfer and direct-entry students have the right to expect comparable standards for regular admission to programs and comparable program requirements. 3. Studentshavetherighttoseekclarification regarding their transfer evaluation and may request the reconsideration of any aspect of that evaluation. In response, the college will follow established practices and processes for reviewing its transfer credit decisions. 4. Students who encounter other transfer difficultieshavetherighttoseekresolution. Eachinstitutionwillhaveadefinedprocessfor resolution that is published and readily available to students. 5. Students have the responsibility to complete all materials required for admission and to submit the application on or before the published deadlines. 6. Students have the responsibility to plan their courseofstudybyreferringtothespecific published degree requirements of the college or academic program in which they intend to earn a bachelor’s degree. 7. When a student changes a major or degree program, the student assumes full responsibility for meeting the new requirements. College & University Rights & Responsibilities Colleges and universities have the right and authority to determine program requirements and course offeringsinaccordancewiththeirinstitutional mission and to communicate and publish these requirementsandcourseofferingstostudentsand the public. 1. 2. 3. 4. TRANSFER DEGREE INFORMATION Colleges and universities have the responsibility to provide clear, accurate, and current information about their transfer admission requirements, transfer admission deadlines, degree requirements, and transfer policies that include course equivalencies. Colleges and universities have the responsibility to answer students’ questions about transfer issues and provide students with opportunities for appropriate follow-up. Colleges and universities have the responsibility to provide comparable standards for transfer and direct-entry students for regular admission to programs. Transfer and direct-entry students must satisfy comparable program requirements. Colleges and universities have the responsibility to communicate admission and transfer-related decisions to students in writing (electronic or paper) and include information about student transfer rights and responsibilities. Direct Transfer Agreement Degrees Associate in Arts Requirements A. Basic Requirements: 18-20 Credits A minimum 2.0 (C) GPA is required in each of the following groups. No S grades allowed (exceptions: AP. CLEP, DANTES, and IB scores). Group A (10 credits) ENGL& 101, ENGL 102 Group B (5 credits) MATH 107, 111, 220, 264 or MATH& 107, 132, 141, 142, 146, 148, 151, 152, 153, 254 or PHIL& 120 B. Group C (3-5 credits) CAS 106, CMST 140, CMST& 101, 210, 220 or ENGL 203 Distribution Requirements: 45 Credits A 2.0 (C) GPA is required in each of the following distributionareasandnomorethanfivecredits of S grades can be used in each. No more than 10 credits from any one subject area are allowed. Humanities (15 credits) Select15creditsinthreedifferentsubjectareas from the approved humanities distribution list. Thesecreditsmayincludeamaximumoffive credits in skill performance courses, which are underlined in the approved distribution list, and amaximumoffivecreditsof100-levelforeign language or 100-level American Sign Language. Natural Sciences/Math (15 credits) Select15creditsinthreedifferentsubjectareas from the approved distribution list. Choices must include at least one of the laboratory courses which are underlined in the approved distribution list. Social Sciences (15 credits) Select15creditsinthreedifferentsubjectareas from the approved distribution list. C. Electives (25-29 Credits) Core Electives (15-17 credits) 15-17 credits of electives should be chosen carefully from the distribution of courses listed in Quantitative/Symbolic Reasoning (Group B) and Humanities, Social Sciences, and Natural Sciences from the approved distribution list. A minimum 2.0 (C) GPA is required in this distribution area. General Electives (10-12 credits) Select 10-12 credits from 100-level or above courses. These may include additional Core Electives as well as courses from the Restricted List. No more than three Physical Education activity credits apply toward a DTA degree. See the Physical Education section of catalog for eligible courses. Associate in Business Requirements A. Basic Requirements: 15 Credits A minimum 2.0 GPA is required in each of the following groups. No S grades allowed (exceptions: AP, CLEP, DANTES, and IB scores). Group A (10 credits) Required - ENGL& 101 and ENGL 102 Group B (5 credits) Required - MATH 111* *Note: This degree must include the math sequence of MATH 111 and MATH& 148. B. Distribution Requirements: 45 Credits A 2.0 (C) GPA is required in each of the following areas,andnomorethanfivecreditsofSgrades can be used in each. No more than 10 credits from any one subject area are allowed. Humanities (15 credits) Select 15 credits in three subject areas from the approved humanities distribution list. These creditsmayincludeamaximumoffivecreditsin skill performance courses, which are indicated by (P) in the approved distribution list, and a maximumoffivecreditsof100-levelforeign language or American Sign Language. Natural Sciences/Math (15 credits) Required - MATH& 148 * and select 10 credits in two additional subject areas from the approved distribution list. Choices must include at least one of the laboratory courses, which are indicated by (L) on the approved distribution list. * Note: This degree must include the math sequence, MATH 111 and MATH&148. Social Sciences (15 credits) Required - ECON& 201 and 202 and select 5 credits from an additional discipline from the approved distribution list. Yakima Valley Community College, 2015-2016 53 54 C. TRANSFER DEGREE INFORMATION Business Core (25 Credits) No S grades allowed in the business core. All business option degrees must include the 25-credit business major core: ACCT& 201, 202, 203, BUS& 201, and BA 256. D. Elective (5 credits) Selectanadditionalfivecreditsfromcourses numbered 100 or above. These may include additional Core Electives as well as courses from the Restricted List. No more than three Physical Education activity credits apply toward a DTA degree. Note: Many universities and colleges have computer course requirements for admission to the business major. See your advisor to determine if a computer course is recommended as the elective. Associate in Science - Transfer Note: Special advising is required for this degree. YakimaValleyCommunityCollegeoffersthe Associate in Science - Transfer degree for students who are interested in pursuing a bachelor’s degree in biology, biochemistry, or chemistry (Track 1) or engineering, computer science (information technology), or physics (Track 2) at a baccalaureate institution. Students completing the Associate in Science Transfer will receive the same priority consideration for admission to the baccalaureate institution as those students completing the direct transfer agreement and will be given junior status by the receiving institution. Students with this degree do not, however, meet the general education requirements of the receiving institution. Therefore, students will be required to complete the general education requirements or general university requirements during the junior and senior year. This degree is appropriate for a student who has a strong commitment to majoring in one of the sciences and who is ready to enter MATH& 151 (Calculus) and ENGL& 101. Completion of this degree will prepare the transfer student for upper division study in the sciences; however, it does not guarantee admission to the major. Course sequences should be completed at one institution. For example, the physics sequence or chemistry sequence should be completed at one school. Advising is a critical element for students pursuing the Associate in Science - Transfer degree in order to determine exactly which courses are included in each of the categories. Students are responsibleforcheckingspecificrequirementsof the baccalaureate institution. Students interested in pursuing this degree should contact the Admissions OfficedirectlyforreferraltoAssociateinScience- Transfer degree advisors. Yakima Valley Community College, 2015-2016 Options The Associate in Science - Transfer degree has two tracks: Track 1 (biology, biochemistry, chemistry, and geology) and Track 2 (engineering, computer science [information technology], and physics). Degree Requirements A. Communications (5 credits) ENGL& 101 B. Mathematics (15 credits) MATH& 151, 152, 153, or MATH& 146 (Track 1) MATH& 151, 152, 153, or MATH 220 (Track 2) C. Humanities and Social Sciences (15 credits) Fivecreditsofhumanitiesandfivecreditsof social sciences are needed from the approved distribution list. Five additional credits of either humanities or social sciences are also required. D. Major Requirements (60 credits) Tobedeterminedbythespecificdegreethe student is pursuing. Distribution List Codes DTA DISTRIBUTION LIST 55 Note: Italicized courses are acceptable for distribution but are no longer offered for instruction. (L) = Lab Course (P) = Performance Course + = HIST& 116, 117, and 209 may be used for Humanities or Social Science distribution but not both. # = Credit cannot be given for both ECON 213 and HIST 213, ECON 205 and GEOG 205, PSYCH 230 and SOC 230, or AGSCI 101 and BIOL 107. Communications College Academic Skills CAS 106 College Seminar Communications CMST 140 CMST& 101 CMST& 210 CMST& 220 English ENGL 102 ENGL 203 ENGL& 101 Drama 3 Feature Writing Introduction to Communications Interpersonal Communications Public Speaking 3 5 5 5 English Composition II The Research Paper English Composition I 5 3 5 Humanities Only 5 credits of 100-level modern language (ASL, French, German, or Spanish) may be used for Humanities distribution. American Sign Language ASL 101 ASL 102 ASL 103 Art ART& 100 ART 101 ART 102 ART 104 ART 105 ART 107 ART 112 ART 121 ART 122 ART 150 ART 201 ART 202 ART 203 ART 204 ART 205 ART 210 ART 211 ART 212 ART 280 ART 281 ART 282 ART 283 CHST 120 5 5 5 Art Appreciation Design I Design II (P) Drawing I Drawing II (P) Drawing III (P) Intermediate Watercolor (P) Western Traditions of Art Non-Western Traditions of Art Intro to Art (P) Functional Pottery (P) Clay I: Handbuilding (P) Clay II: Intermediate Wheel (P) Clay II: Intermediate Handbuilding (P) Advanced Clay (P) Painting I (P) Painting II (P) Painting III (P) Art History I Art History II Art History III Asian Art History 5 4 4 4 4 4 2 5 5 4 5 4 4 4 2 4 4 4 5 5 5 3 Chican@s Art & Culture Communication Studies CMST& 101 CMST 115 CMST 140 CMST& 210 CMST& 220 CMST 280 English American Sign Language I American Sign Language II American Sign Language III Chican@ Studies Introduction to Communication Newswriting Feature Writing Interpersonal Communication Public Speaking Intercultural Communication DRMA& 101 DRAMA 115 DRAMA 150 DRAMA 161 DRAMA 180 DRAMA 181 DRAMA 182 DRAMA 188 DRAMA 189 DRAMA 201 DRAMA 202 DRAMA 203 DRAMA 204 DRAMA 205 DRAMA 282 5 5 5 3 5 5 5 ENGL 130 ENGL 131 ENGL 132 ENGL 135 ENGL 136 ENGL 137 ENGL 138 ENGL 140 ENGL 141 ENGL144 ENGL 145 ENGL 150 ENGL 170 ENGL 171 ENGL 201 ENGL 202 ENGL 203 ENGL 205 ENGL 209 ENGL 212 ENGL 220 ENGL 221 ENGL 222 ENGL 264 ENGL 265 ENGL 266 ENGL 270 ENGL 271 ENGL 275 Introduction to Theatre Rehearse/Performance Tech (P) Introduction to Cinema National Cinemas Acting Beginning (P) Acting Intermediate (P) Acting Advanced (P) Stage Makeup (P) Basic Stagecraft/Theater (P) Contemporary Theater Theater History I Theater History II Theater History III 19th Century Drama Acting Seminar Advanced (P) Writers and Ideas I Writers and Ideas II Writers and Ideas III Introduction to Fiction Introduction to Plays Introduction to Poetry Introduction to Novel Science Fiction The Mystery Novel LiteratureofPacificNW&West Introduction to Native American Literature Women in Literature Student Literary Journal I Student Literary Journal II Creative Writing I Creative Writing II The Research Paper Poetry Workshop Introduction to Mythology Survey Latin American Fiction Survey American Literature to 1870 Survey American Literature 1870 to 1945 Survey American Literature 1945 to Present English Lit: Begin to 1660 English Lit: 1660 to 1832 English Lit: 1832 to Present Introduction to Shakespeare Shakespeare in Ashland The Bible as Literature Ethnic Studies ETHS 103 ETHS 120 ETHS 203 History HIST& 116 HIST& 117 HIST 208 HIST 209 5 2 3 5 3 4 4 3 4 3 5 5 5 5 4 2 2 2 3 3 3 3 3 3 3 3 3 3-5 3-5 3 3 3 2 5 5 5 5 5 5 5 5 5 3 5 Media, Art & American Ethnicity African American Experience Ethnic Storytelling 5 3 3 Western Civilization I + Western Civilization II + Roman Civilization Greek Civilization + 5 5 5 5 Yakima Valley Community College, 2015-2016 56 Humanities HUM 102 HUM 103 HUM 104 HUM 111 HUM 112 HUM 113 HUM270 Music MUS 100 MUS 101 MUS 102 MUS 103 MUS 104 MUSC& 105 MUS 116 MUS 117 MUS 119 MUS 130 MUS 133 MUS 149 MUS 218 MUS 224 MUS 225 MUS 226 DTA DISTRIBUTION LIST Introduction to Humanities I Introduction to Humanities II Introduction to Humanities III American Pop Culture I American Pop Culture II American Pop Culture III SignificantFiguresinWorldCivilization 3 3 3 2 2 2 2 Music Fundamentals Ear Training I Music Theory I Ear Training II Music Theory II Music Appreciation History of Rock and Roll World Music History of Jazz College Chorus (P) Chamber Singers (P) Jazz Ensemble (P) Music of 20th Century Music History I Music History II Music History III 3 2 3 2 2 5 5 3 5 3 2 2 5 3 3 3 Philosophy PHIL& 101 PHIL& 115 PHIL 150 PHIL 167 PHIL 215 PHIL 220 Introduction to Philosophy Critical Thinking Existential Group World Philosophy Introduction to Ethics Philosophy of Religion Photography PHOTO 101 PHOTO 102 PHOTO 103 PHOTO 203 Photography I (P) Photography II Digital Photography (P) Intermediate Digital Photography (P) Political Science POLS 201 Spanish SPAN 101 SPAN 102 SPAN 103 SPAN 201 SPAN 202 SPAN 203 SPAN 231 SPAN 232 SPAN 233 5 5 2 5 5 5 3 3 5 5 Introduction to Political Theory 5 Spanish I First Year Spanish II First Year Spanish III First Year Spanish I Second Year Spanish II Second Year Spanish III Second Year Second Year Spanish for Prof Speaking Second Year Spanish for Academic Writing Second Year Spanish for Academic Reading 5 5 5 5 5 5 5 5 5 Natural Sciences/Math Agriculture AGSCI 101 Introduction to Plant Science (L) # Anthropology ANTH& 205 Biological Anthropology Astronomy ASTR& 100 Survey of Astronomy Yakima Valley Community College, 2015-2016 Biology BIOL 102 BIOL 105 BIOL 107 BIOL 109 BIOL 124 BIOL 140 BIOL 201 BIOL 211 BIOL 221 BIOL 225 BIOL 230 BIOL 231 BIOL 232 BIOL 124 Environmental Science (L) Biology for Nonmajors with Lab (L) Introduction to Plant Science (L) # General Biology (L) Plants & Wildlife of Washington Marine Biology (L) Biology for Majors I (L) Biology for Majors II (L) Biology for Majors III (L) Natural History Yakima Valley Human Anatomy & Physiology I (L) Human Anatomy & Physiology II (L) Microbiology (L) Plants & Wildlife of Washington Chemistry CHEM 100 Introduction to Chemistry CHEM 109/110 Principles of Chemistry (L) CHEM& 141 General Chemistry I CHEM& 142 General Chemistry II CHEM& 143 General Chemistry III CHEM& 151 General Chemistry I Lab (L) CHEM& 152 General Chemistry II Lab (L) CHEM& 153 General Chemistry III Lab (L) CHEM 209/210 Introduction to Organic/Biochem (L) CHEM& 241 Organic Chemistry I Lecture CHEM& 242 Organic Chemistry II Lecture CHEM& 243 Organic Chemistry III Lecture CHEM& 251 Organic Chemistry I Lab (L) CHEM& 252 Organic Chemistry II Lab (L) Geography GEOG 102 GEOG 210 Geology GEOL& 101 GEOL& 103 GEOL& 115 GEOL 155 GEOL 206 GEOL&208 Math MATH& 107 MATH 111 MATH& 141 MATH&142 MATH& 146 MATH& 148 MATH& 151 MATH& 152 MATH& 153 Nutrition NUTR 101 5 5 Introduction Physical Geology (L) Historical Geology (L) Geology National Parks (L) Glacial Geology Glacier & Climate Change GeologyofPacificNorthwest(L) 5 5 5 3 5 5 Math in Society Algebra Applied to Bus/Econ Precalculus I Precalculus II Introduction to Stats Business Calculus Calculus I Calculus II Calculus III 5 5 5 5 5 5 5 5 5 Nutrition 5 Philosophy 5 Physical Science 5 5 5 3 3 3 2 2 2 5 4 3 3 3 3 Physical Geography Earth's Climate (L) 5 PHIL &120 5 5 5 5 5 5 5 5 5 3 5 5 5 5 Introduction to Logic 5 PHSCI 101 Physical Science Survey I 5 (Physical Science 101 may be used for Chemistry or Physics distribution but not for both.) PHSCI 102 Physical Science Survey II 5 (Physical Science 102 may be used for Chemistry or Physics distribution but not for both.) PHSCI 112 Physical Science Survey II with Lab (L) 5 DTA DISTRIBUTION LIST Physics PHYS 100 Introduction to Physics PHYS 115/125 General Physics I (L) PHYS 116/126 General Physics II (L) PHYS 117/127 General Physics III (L) PHYS 211/221 Engineering Physics I (L) PHYS 212/222 Engineering Physics II (L) PHYS 213/223 Engineering Physics III (L) 5 5 5 5 5 5 5 ANTH& 100 ANTH 110 ANTH& 204 ANTH& 206 ANTH& 217 Survey of Anthropology Mayas & Aztecs Archaeology Cultural Anthropology Plateau Native Peoples Chican@ Studies CHST 112 CHST 115 CHST 220 Chican@ Exp. in Contemporary Society La Chicana Chican@ Community Study Communication Studies CMST& 102 Introduction to Mass Media Economics ECON 101 ECON& 201 ECON& 202 ECON 205 ECON 213 Intro to Economics Micro Economics Macro Economics Economic Geography # Economic History # Ethnic Studies ETHS 101 ETHS 145 American Ethnic Minorities US Indian Relations Geography GEOG 101 World Regional Geography GEOG & 200 Human Geography GEOG 205 Economic Geography # History HIST& 116 HIST& 117 HIST& 118 HIST& 136 HIST& 137 HIST 205 HIST 209 HIST 213 HIST&214 HIST 270 HIST 275 Western Civilization I + Western Civilization II + Western Civilization III U.S. History I U.S. History II U.S. History 1945 to Present Greek Civilization + Economic History # PacificNorthwestHistory History of Latin America History of Mexico Political Science POLS 100 POLS 100W POLS& 101 POLS& 202 POLS& 203 POLS 205 POLS 270 Contemporary World Problems Contemporary World Problems Intro Political Science American Government International Relations State & Local Government Political Economy Psychology PSYC& 100 PSYC& 200 PSYCH 209 PSYCH 213 PSYC& 220 PSYCH 230 General Psychology Lifespan Psychology Fundamentals of Psychological Research Human Life-Span Development I Abnormal Psychology Social Psychology # SOC& 101 SOC& 201 SOC 210 SOC 230 SOC 250 5 3 5 5 2 5 5 5 5 5 5 5 5 5 5 3 5 5 5 Intro to Sociology Social Problems Sociology of Sex/Gender Social Psychology # Marriage & Family 5 5 5 5 5 Quantitative Math Social Sciences Anthropology Sociology 57 MATH 111 MATH 220 MATH264 MATH& 107 MATH& 132 MATH& 141 MATH& 142 MATH& 146 MATH& 148 MATH& 151 MATH& 152 MATH& 153 MATH& 254 Algebra Applied to Business/Economics Linear Algebra DifferentialEquations Math in Society Math for Elementary Education II Pre-Calculus I Pre-Calculus II Introduction to Statistics Business Calculus Calculus I Calculus II Calculus III Calculus IV Philosophy PHIL& 120 Introduction to Logic 5 5 5 5 5 5 5 5 5 5 5 5 5 5 Electives Electives should be chosen carefully from courses numbered 100 or above. A maximum of 15 credits may be taken from the Restricted Course List (see index). Co-op Credits A maximum of 15 co-op credits is allowed. 5 5 5 5 5 5 5 5 5 5 5 3 5 5 5 5 5 5 5 5 5 5 5 Yakima Valley Community College, 2015-2016 58 RESTRICTED SUBJECT AREAS FOR TRANSFER InterCollege Relations Commission, Associate Degree Courses List, Part II (May 1995) The following list is intended to provide Washington community colleges with information regarding restrictions on the transferabilityofcoursestakeninfulfillmentofassociatedegreerequirements.Pleasenote:Thislistrepresentsanintercollege agreementandisnotmeanttoreflectthetransferpolicyofanyindividualinstitution.Itistheunderstandingoftherepresentatives of participating baccalaureate colleges that associate degrees meeting the ICRC guidelines would ordinarily include no more than 15 credits in subjects on this list unless a special agreement had been arranged with the particular receiving institution. * In these subjects, the introductory survey courses are acceptable. Accounting * (Only Principles I, II, III are transferable) Adult Basic Education Aeronautics/Aviation Administration of Justice * (Criminal Justice, Law Enforcement, Police Science, Corrections) Agriculture * Air Conditioning/Heating/ Refrigeration Aircraft Repair Allied Health Program American Institute of Banking (AIB) Animal Technology Appliance Repair Technician Applied Linguistics Architectural Auto Mechanics Avionics Banking and Finance Barbering Biomedical Equipment Boat Building BusinessandOfficeTechnician Career Planning/Exploration Carpentry/Construction Methods Chemical Dependency Childcare Chiropractic Clothing and Apparel Commercial Design Communications (Radio, TV, Film) Computer Information Systems Computer Repair Consumer Education Cooking and Baking Cooperative Work Experience, Field Experience (Only practicum in Teacher Education is transferable) Cosmetology Counseling Psychology Court Reporting Culinary Arts (Cooking, Baking) Custodial Training, Maintenance Data Processing (Courses in technical data processing/ data entry, personal computer use and software packages and their applications are not acceptable. For acceptable courses in Computer Science, see the Associate Degree Course List Part I.) Dental Assistant Dental Hygiene Diagnostic Ultrasound Technology Diesel Mechanics Dietician Diving Technology Drafting Early Childhood Education * Education * Electronics Emergency Medical Technician Engineering Technology English as a Second Language Engineering Technology Environmental Technology Equine Sciences ESL (Courses that are preparation in English) Family Life Farm and Industrial Machinery Maintenance Ferrier/Horseshoeing Fashion Design and Merchandising Fire Science Fisheries * Fisheries Technology Fitness Technology Floristry * Food Service Forest Technology Forestry General Studies Gerontology Assistant Graphics Reproduction (Only introductory survey course in graphic arts is transferable.) Hazardous Materials Health (First Aid) Health Technologies (Radiology, Biomedical Photography) Histotechnology Home Economics (Restricted except courses in the scientificstudyofnutrition) Horology Horticulture Hospitality Hotel/Motel Management Human Resources Human Services (Counseling, gerontology, community health advocate, etc) * Independent Study Industrial Relations, Industrial Sciences Instructional Assistant Instrumentation and Control Interior Design and Merchandising Interpreter Training Journalism Keypunch Operator, Data Entry Labor Relations and Studies (Restricted except labor history and economics courses) Landscaping Leadership Skills Legal Studies Leisure Services Yakima Valley Community College, 2015-2016 Library Skills, Library Technician Life Skills Machining, Machine Shop Marine Technology Marketing * Mechanics Media Technology Medical Technology Microcomputers Mid-Management Military Science (Lower division) Nanny Natural Resources Needle Trades Technology Nondestructive Testing Nuclear Technician Nursing/Nurse Aid Nursing Home Administration Occupational Education Oceanography Technology OfficeOccupations,Skillsand Technology Ophthalmic Dispensing and Technology Optometric Technician Paralegal Paraprofessional programs Parent Education Parks and Recreation * Peer Counseling and Advising Personal Development and Human Relations Pharmacy Assisting Photographic Equipment Technician Physical Therapy Assisting Practical Nursing Preschool and Parenting Procurement/Purchasing Professional Development Public Works Technician Pulp and Paper Manufacture Technology Quality Control Radio and Television Technology Radiologic Technology Reading Real Estate Recreation/Leisure Parks * Rehabilitation Replacement Parts Respiratory/Inhalation Therapy Restaurant Management Retail Management Saddlemaking Sales Satellite Communications Secretarial Studies Security Small Business Management Social Sciences (Restricted except some courses listed under this title which have academic content) Social Services * Soils Special Education Stationary Steam Engineering Student Government Study Skills (Including speed reading, note-taking, time management, test-taking, “skimming and scanning,” and other college survival skills) Substance Abuse Supermarket Supervision Surgical Surveying Technology programs Auto Parts Telecommunications Tourism and Travel Transportation Upholstery Veterinary Assistant Vision Care Vocational Education Waste Water Water Science Technology Welding Wildlife Management Workshops and Mini-courses * See the associate degree course list, Part I for exceptions. The full ICRC Handbook is available in the YVCC Counseling & Advising Center or at www.washingtoncouncil. org. Since 1995, the following colleges have subscribed to the Intercollege Relations Commission Guidelines: Bastyr University Central Washington University Cornish Institute Eastern Washington University Gonzaga University Heritage University Northwest College PacificLutheranUniversity SeattlePacificUniversity City University Seattle University The Evergreen State College Saint Martin’s College University of Washington Washington State University Western Washington University Whitworth College Degrees Offered SPECIAL DEGREES 59 Associate in General Studies Associate in Technology - Servicemen’s Opportunity College Associate in General Studies TheAssociateinGeneralStudiesdegreeisdesignedtoallowmaximumflexibilityinattaininga degree for those with broad needs and experiences. It is not meant to be a transferable degree, although individual courses may transfer to four-year colleges and universities. A. Communication Skills (8 credits) Required: ENGL& 101; other communication courses: 3 credits B. Distribution Credits (30 credits) Sincenospecificlistisdesignatedforthesecourses,studentsmayincludeawiderrangeof courses in the following areas than is found in the approved distribution list. Humanities (10 credits) Select from at least two subject areas. Natural Sciences/Math (10 credits) Select from at least two subject areas. Social Sciences (10 credits) Select from at least two subject areas. C. Electives: (52 credits) Total for Degree: 90 Credits See “General Education Requirements” section of the catalog for additional requirements. Associate in Technology - Servicemen’s Opportunity College Yakima Valley Community College is one of more than 400 institutions that make up the network of Servicemen’s Opportunity College (SOC). The SOCAD program at YVCC enables a service person stationed virtually anywhere in the United States and at many posts overseas to take college-level courses and progress steadily toward a degree. Active-duty personnel are able to make full use of their military education and experiences in planning their academic and professional careers. The Associate in Technology degree is designed exclusively for military participants. It assists senior, professional, military personnel in achieving promotional points and early retirement. SOCADisatwo-yearprogram(90quarterhoursrequired)thatenableswarrantofficersand noncommissionedofficerstoearncreditlargelyfrommilitaryexperiences. A minimum of four college classes (18 quarter hours of credit total) may be all that is required forcompletionbywarrantofficersandseniornoncommissionedofficers.Thebalanceof72 quarter hours of credit may be granted from MOS (Mode of Service) experience, service schools, prior college courses, or other YVCC courses (18 credits minimum required at YVCC). This degree is not designed as a college academic transfer degree. Military personnel interested in a college transfer degree may contact the Counseling Center at YVCC for further information. YVCC courses required ENGL 090T, 095, or ENGL&101 (5 credits) CMST& 220 (5 credits) Social sciences/Natural Sciences (5 credits) Electives (5 credits) Yakima Valley Community College, 2015-2016 60 PROFESSIONAL/TECHNICAL DEGREES Degrees Offered Associate of Applied Science Associate of Applied Science Transfer YVCC/Perry Technical Institute Combined Associate of Applied Science The Associate of Applied Science (AAS) degrees are designed to provide competencies related to the workplace; these degrees are not designed as a transfer degree to a four-year institution. StudentsearninganAASmaygoontoearnBachelorsofAppliedScience(BAS)degreesofferedat variousdifferentcommunitycollegesinthestate.StudentswishingtotransferAAScreditswillnot be automatically accepted as a junior at four-year colleges and universities; however, since some individual courses taken under this plan are transferable, students wishing to transfer are likely to receive some advanced-standing credit after their transcript is individually evaluated by the receiving institution. An AAS may be awarded upon completion of a prescribed program. Inordertobeawardedanappliedsciencedegreeorcertificate,studentsmustcomplete courses covering three core competency distribution areas: computation, communication, and humanrelations.Specificcoursesarerequiredthatwillfulfillthesecompetencies.Thecurriculum in professional/technical areas is competency-based and has been developed to meet industry-wide skills standards. Forspecificdegreerequirements,pleaserefertothe“GeneralEducationRequirements” section and the appropriate program of study section of this catalog. The following degrees are currentlybeingofferedatYVCC: Aerospace Machining Technology Agribusiness Automotive Service Technology Accounting Business Management Business Management, Entrepreneurship Specialty Business Management, Marketing Specialty Business Technology, Administrative Assistant Business Technology, Bilingual AdministrativeOfficeAssistant Business Technology, Bilingual LegalOfficeAssistant Business Technology, Bilingual MedicalOfficeAssistant BusinessTechnology,LegalOffice Assistant Business Technology, Medical OfficeAssistant Chemical Dependency Studies Civil Engineering Technology Construction Design Criminal Justice Dental Hygiene Early Childhood Education ECE Preschool Sped Option Electrical Technology - Perry Tech Heating, Vent, A/C & Refrigeration - Perry Tech Information Technology General IT Network Administrator IT General Support Specialist Instrument & Industrial Automation Technology - Perry Tech Medical Assisting Medical Billing & Coding Nursing Para-educator Production/Pest Management Radiologic Sciences Surgical Technology Technology (SOCAD) TV Production/Broadcast - YV Tech Veterinary Technology Vineyard Technology Winery Technology Associate of Applied Science - Transfer Degree (AAS-T) The Associate in Applied Science - Transfer degree (AAS-T) is designed to build upon the technical courses required for job preparation but also includes a college-level General-Education component, common in structure for all such degrees. Several four-year colleges and universities havespecificbachelor'sdegreeprogramsthatacceptAAS-Tdegreeswithagreeduponarticulation agreements. YVCC has two AAS-T degrees in Early Childhood Education and Agribusiness. (See the programdescriptioninthiscatalogforspecificprogramrequirements. YVCC/Perry Technical Institute Combined Degree Program The combined degree program provides students the opportunity to obtain specialized training at PerryTechnicalInstitutetogetherwithspecificYVCCcourseworkthatwillbetterpreparestudents for their jobs and provide them with advancement opportunities. Students may complete their YVCC coursework before, during, or after their Perry Technical Institute training. On successful completion of both the Perry Technical Institute training and YVCC classes, students will earn an Associate of Applied Science in Electrical Technology; Heating, Ventilation, Air Conditioning, and Refrigeration Technology; or Instrumentation and Industrial Automation Technology. Yakima Valley Community College, 2015-2016 PROFESSIONAL/TECHNICAL CERTIFICATES Certificates of Achievement ThecertificateprogramsofferedatYVCCincludeawiderangeofsubjectsandrequirevarying lengthsoftimeforcompletion.Thespecificrequirementsforeachcertificatearegiveninthe programdescriptionssectionofthiscatalog.CertificatesofAchievementwillbeissuedupon successfulcompletionoftheprescribedcertificateprogramswitha2.0orhighergradepoint averageinthecoursesrequiredforthatcertificate.Certificateapplicationsmaybeobtainedfrom theRegistrationandRecordsOffice. Inadditiontospecificcertificateprograms,YVCCmayalsoawardthecommunitycollege certificatetoanystudentwhocompletes90creditsatthecollege.Personsinterestedinreceiving thisCertificateofAchievement,whichrecognizestwoyearsofcompletedworkattheinstitution, mayrequestthecertificationapplicationfromtheRegistrationandRecordsOfficeintheDeccio HigherEducationCenter.Awardofthecertificateisbyapprovaloftheregistrar.Thefollowing certificatesarecurrentlyofferedatYVCC: Access Accounting Clerk Animal Science Technology Automotive Electrical & Electronic Systems BusinessTechnology-BilingualOfficeAssistant BusinessTechnology-GeneralOfficeAssistant Business Technology - Legal Receptionist Business Technology - Medical Receptionist Business Accounting Business Management Business Marketing CDA Track: • Family Child Care • Infant - Toddler Care • Preschool CESCL Training Chemical Dependency Studies CISCO Internetworking CNC Operator Communications/Call Taker Community College Computed Tomography Correctional Crime Scene Investigation CT Scan Dental Assisting - YV Tech Drafting ECEInitialCertificate ECEShortCertificateofSpecialization: • Administration • Early Childhood Education (General) • Family Child Care • Infant - Toddler Care • School - Age Care ECECertificate/StateCredential Ethnic Studies Excel High School Diploma - YVCC Information Technology Computer User Information Technology General InformationTechnologyOfficeSuite Information Technology Programming Machining Technology Managing & Maintaining the PC Medical Assisting Medical Billing and Coding Medical Interpreter - Spanish/English Nursing Assistant OfficeSkillsI&II OfficeWorker1A,1B,&1C Para-Educator Pharmacy Technician Phlebotomy Police Clerk/Support Specialist PowerPoint Practical Nursing Retail Management STARS: • Administration of Early Learning Programs • Brain Development and Young Child • Child Abuse and Neglect • Health for Preschool Teachers • Infant/Toddler Caregiving • Kindergarten Readiness •ManagingDifficultBehaviors • Math for Preschool Teachers • Science for Preschool Teachers Steering, Suspension, & Brake Systems Surgical Technology Tree Fruit Production Vineyard Technology Wine Sales Winery Technology Yakima Valley Community College, 2015-2016 61 62 Prerequisites PROGRAMS & COURSES Thissectionofthecatalogidentifieswhatthespecificprerequisites,ifany,areforeachcourse. Course prerequisites are requirements that students must meet before they can enroll in a particular course. A student must earn a grade of C (2.0) or higher in prerequisite courses, unless otherwise noted, or unless the student receives the department chair’s written approval for the class or program. Students are required to complete the prerequisites for a course before they can enroll in that class. As students register for classes, the system will check their student records for prerequisite requirements. If these requirements are found in the record, the student will be registered in the class, but if they are not found, the system will not allow registration for that course. For information about departmental policies regarding prerequisites, contact the appropriate dean’soffice. Course Numbering The numbers from 0-99 designate developmental courses and certain professional/technical classes. These classes are not college level. Classes numbered from 100-299 are college-level and generally transferable to baccalaureate degree programs. Coursesnumbered099,199,or299designateindependentstudyandfieldexperience classes. Courses numbered 098, 198, or 298 designate experimental or exploratory classes. Cooperativefieldexperience(co-op)coursesareassignedthe190and290numberedseries. Community service courses are numbered with 076 and are not awarded credit. Courses listed in this catalog constitute the most recent record of the total academic program ofthecollege.Listingdoesnotmeanthatallcoursesareofferedeveryquarteroreveryyear. Consulttheclassscheduleforspecificcourseofferings. Common Course Numbering Washington’s community and technical colleges want to make it easier for students to transfer credits among the state’s 34 community and technical colleges. YVCC has moved to a common course numbering system, which will mean that the same course will be titled and numbered in a similar way at every community and technical college in the state. There are a number of changes in course names and numbers for YVCC. The changes should help you know that a course you have taken at one Washington college is the same at another, and the course will transfer easily. Commoncoursesareidentifiedbyan“&”followingthedepartmentabbreviation.Transfer coursesthatarenotidentifiedascommonwillstilltransferundertheDirectTransferAgreement asinthepast.PleasedirectanyquestionstotheRegistrarintheEnrollmentServicesOfficeatthe phone number listed in the front of this catalog. Definitions and Codes Co-requisite: These are one or more courses that must be taken together in the same quarter. For example, a lecture and lab in Chemistry. Cross-disciplined courses: Coursesintwodifferentdisciplinesthathavethesamecourse description and credits. Credit cannot be given for both courses. Distributions for DTA: Communications Humanities Humanities - Performance Natural Sciences Natural Sciences - Lab Quantitative Social Science Quarter Offered Codes F Fall Quarter S Spring Quarter SR Summer Quarter W Winter Quarter O Occasionally Yakima Valley Community College, 2015-2016 Core Competency Codes Computation Communication Human Relation Accounting Physical Fitness Art Electives See also “Business Administration” Courses ACCT& 201: Principles of Accounting I 5 Cr Quarters: F, W, S, SR Introduction to the theory and practice of accounting, includingfinancialstatements. ACCT& 202: Principles of Accounting II 5 Cr Quarters: F, W, S Depreciation, payroll taxes, partnerships, and corporations. Prerequisite: ACCT& 201 ACCT& 203: Principles of Accounting III 5 Cr Quarters: W, S, SR ACCT& 203 introduces students to the procedures and techniques with which managers use accounting information to make decisions. The course includes departmental and cost accounting. Prerequisite: ACCT& 201 and ACCT& 202 Adult Basic Education (ABE) Integrated Basic Education and Skills Training (I-BEST) The Integrated Basic Education and Skills Training (I-BEST) programs enable students to develop both their literacy and job skills in order to be prepared for the workforce and continued study in college. I-BEST pairs a professional/ technical content instructor with an adult basic education instructor to help students progress in reading, writing, and math while being trained for a career. Participants in the I-BEST program can work on their basic education while earning college-level credit. I-BESTprogramsofferedatYVCCinclude: • NursingAssistantCertification • Business Technology For more information on the I-BEST programs, visit www. YVCC.edu/CCC or call 509-574-4911. Nursing Assistant Certification (NAC) I-BEST The primary emphases in adult Basic Education (ABE) programs are helping students improve their basic reading, writing, and math skills to succeed in college or employment. The ABE programs assist students in earning an adult high school diploma, preparing to take a high school equivalency exam (such as the GED) or upgrading academic skills for college study. ABE courses lead directly into credit bearing college courses for those students who wish to continue their college education. High School Equivalency Exam Preparation ABE courses help students prepare to take a high school equivalency exam such as the GED (General Education Development) exam. The GED exam is administered on the computer and the students need to have strong academic skills and knowledge in the areas of reading, writing, math, computer technology, social studies, and science in order to pass the exam. High School 21+ (HS21+) Students who are 21 years of age or older can earn high school credit from ABE courses and earn an adult high schooldiploma.Asstudentsshowcompetencyinspecific subject areas, YVCC will grant high school credit. HS21+ allows individuals to apply previously earned high school credittowardtheirdiplomaandthenfinishtherestofthe credits required by taking classes at YVCC. Students are not required to pass the high school state assessment or complete a senior project. Students may also be able to earn high school credit based on prior knowledge through training and/or work experience. To earn a high school diploma, students must earn a total of 19 high school creditsanddemonstrateproficiencyinEnglishandmath. ABE and credit level faculty coordinate curriculum to facilitate a smooth student transition from ABE directly into credit-bearing college courses for those students who wish to continue their college education. Content Area English Math Science (1 credit must be a lab science) Washington State History & Government US History & Government Contemporary World Problems Occupational Education Health Total Diploma Credits 1.5 1 5.5 19 Credit 3 2 2 .5 1 1 1 .5 YVCCoffersatwo-quarterprogramtopreparestudents for a career as a nursing assistant. By participating in this program, students will improve their reading, writing, and math skills while participating in NAC skills training. Upon successful completion of the program, students earn a YVCCCertificateofCompletionandwillbeeligibletoapply andtestfortheNursingAssistantCertificationwiththe Washington state Department of Health. First Quarter: NAC Foundations Credits ABE 023/024/025 Math 3/4/5 ABE 069 Workplace Skills ABE 070 Medical English ABE 071 Medical Terminology Second Quarter: NAC Theory & Clinicals ABE 034 Writing 4 NRSE 100 NAC Theory 10 NRSE 101 Clinical Practice 4 NRSE 102 Test Preparation 1 Total College Credits 15 Business Technology (BT) I-BEST YVCCoffersstudenttheopportunitytoobtaingeneraloffice skills while reinforcing basic reading, writing, and math. Studentscanearntwocertificates--OfficeSkillsIandOffice Skills II. Courses are available for four consecutive quarters of study. First Quarter Credits ABE 023/024/025 Math 3/4/5 ABE 034/035 Writing 4/5 BT 121 Human Relations 4 BT 122 Ten-Key Calculator 2 BT 125 Learning the Keyboard 2 IT 102 Windows 2 Second Quarter ABE 023/024/025 Math 3/4/5 ABE 034/035 Writing 4/5 BT 123 Recordkeeping 5 BT 126 Keyboarding Document Format 3 Office Skills Certificate I Total College Credits 19 Third Quarter ABE 023/024/025 Math 3/4/5 ABE 034/035 Writing 4/5 BT 127 Intermediate Keyboarding I 3 BT 160 Word Processing Short Course 2 IT 100 Introduction to Computers 3 Yakima Valley Community College, 2015-2016 63 64 Fourth Quarter ABE 023/024/025 Math 3/4/5 ABE 034/035 Writing 4/5 BT 128 Intermediate Keyboarding II BT 130 Basic Business Essentials BT 161 Word Processing Completion Office Skills Certificate II Total College Credits 2 5 3 37 Courses ABE 023: ABE Math 3 Variable Cr Quarters: F/W/S/SR This ABE course provides instruction in low intermediate basic education math concepts in whole numbers, measures of central tendency, graphs, and measurements asdefinedbytheWashingtonStateLearningStandardsfor Adult Basic Education. Prerequisite: Eligibility determined by minimum CASAS score of 211, math placement quiz, and/or permission of instructor ABE 024: ABE Math 4 Variable Cr Quarters: F/W/S/SR This ABE course provides instruction in high intermediate basic education math concepts in fractions, decimals, percents,andintegersasdefinedbytheWashingtonState Learning Standards for Adult Basic Education. Prerequisite: Completion of ABE 023 or eligibility for ABE 024 as determined by the math placement quiz and/or instructor recommendation ABE 025: ABE Math 5 Variable Cr Quarters: F/W/S/SR This ABE course provides instruction in low adult secondary math concepts in ration/proportions, percents, geometry, algebra,andgraphsasdefinedbytheWashingtonState Learning Standards for Adult Basic Education. Prerequisite: Completion of ABE 024 or eligibility for ABE 025 as determined by the math placement quiz and/or instructor recommendation ABE 033: Writing 3: WA State History & Civics Variable Cr Quarters: F/W/S/SR A course for Basic Skills students who wish to improve their written communication skills, prepare for the GED writing test, earn Social Studies credit for the HS21+ diploma, or to advance to ABE 034. Students learn to write simple narrative, informative or expressive texts of a paragraph, and steps/instructions/commands for varied audiences and purposes. Prerequisite: CASAS reading score of 211 or higher and/or permission of instructor ABE 034: Writing 4: US History & Writing Variable Cr Quarters: F/W/S/SR This course is for Basic Skills students who wish to improve their written communications skills for the GED writing test, to earn Social Studies credit toward a HS21+ diploma, or to prepareforcollege-levelcontent.Throughwell-definedand structured writing activities, students learn to write multiple paragraphs using complex sentences structure to inform, persuade, complete a task, or for personal expression. Prerequisite: CASAS/COMPASS placement or permission of instructor Yakima Valley Community College, 2015-2016 ABE 035: Writing 5: Contemporary Word Problems Variable Cr Quarters: F/W/S/SR This course is for Basic Skills students who wish to improve their written communication skills for the GED writing test, to earn Social Studies credit for the HS21+ diploma, or to prepareforcollege-levelcontent.Throughwell-definedand structured writing activities, students learn to write multiple paragraphs using complex sentence structure to inform, persuade, complete a task, or for personal expression. Prerequisite: CASAS reading score of 236 or higher, appropriate writing rubric placement score, and/or permission of instructor ABE 040: Transitioning to College Variable Cr Quarters: F/W/S/SR This course is for students entering college who want an overview of what college is all about. Topics include college admissions and programs, degree requirements, college transferinformation,financialaidandfinancialplanning, learning styles, personality and career interest assessments, time management,; listening and note-taking skills, test taking, memory techniques, and career information. Prerequisite: ABE 033 as assessed by the CASAS ABE 043: Reading 3: Personal Health & the Human Body Variable Cr Quarters: F/W/S/SR This is a basic reading course focused in the content areas of the human body and personal health. Prerequisite: CASAS score of 211 or above or permission of instructor ABE 044: Reading 4: Physical Science Variable Cr Quarters: F/W/S/SR This is a basic reading course focused in the content area of physical science. Prerequisite: CASAS score of 221 or above and/or permission of instructor ABE 045: Reading 5: Life Science Variable Cr Quarters: F/W/S/SR This is a basic reading course focused in the content area of life science. Prerequisite: CASAS score of 236 or above and/or permission of instructor ABE 060: Personal Fitness Variable Cr Quarters: F/W/S/SR Thisisabasicpersonalfitnesscourse.Inthiscourse, students will learn some safe practices for being involved in aregularfitnessprogram.Theywillthenbeexpectedtoput thesepracticesinplaceforaneight-weekpersonalfitness plan. There will be weekly readings and the use of multimediatobroadenexpertiseinfitness.Quizzeswillprove competency in the assigned learning. Each student will also participatefivedaysperweekinapersonalfitnessplanand report through a weekly journal submitted to the instructor. ABE 069: Workplace Skills Variable Cr Quarters: F/W/S/SR This course is part of the Foundations to Health Care series and is designed for the ABE/ESL student to prepare him/ her for a pathway in a vocational health-related career. The course will facilitate the ABE/ESL student in developing pre-employment and workplace skills and computers/ technology including goal setting, self assessment, problem solving, decision making, communication, job search, and employment. Prerequisite: Students mush achieve a minimum score of 221 on the CASAS reading test and/or a minimum score of 40 on the COMPASS reading test. Students should be able to read, write, understand, and speak the English language as communication is an important part of healthcare and all instructions are in English ABE 070: Medical English Variable Cr Quarters: F This course is designed to develop basic English skills and explore general health areas including anatomy and physiology and issues such as prevention/early detection of disease, safety, community programs, how our immune system works, signs, symptoms, and cause of disease. This is an interactive course that will develop writing, reading, verbal communication, vocabulary, and English in the context of health. Prerequisite: A minimum score of 221 on the CASAS reading test and/or a minimum score of 40 on the COMPASS reading test. Students should be able to read, write, understand, and speak the English language as communication is an important part of healthcare and all instructions are in English ABE 071: ABE/ESL Basic Medical Terminology Variable Cr Quarters: F/W This course is part of the Foundations to Health Care series and is designed for the ABE /ESL student to develop basic medical terminology and prepare him/her for a pathway in a vocational health occupation-related career. The course will facilitate the ABE/ESL student by developing basicprinciplesofwordbuilding,suffixes,prefixes,and abbreviations used in medical terminology. This is an interactive course that will develop reading and writing of basic medical terminology and common medical abbreviations. Prerequisite: A minimum score of 221 on the CASAS reading test and/or a minimum score of 40 on the COMPASS reading test. Students should be able to read, write, understand, and speak the English language as communication is an important part of healthcare and all instructions are in English ABE 034: Writing 4: US History & Writing Variable Cr Quarters: F/W/S/SR This course is designed to present students with occupational learning experiences. Students will explore career options, acquire life and basic academic skills, develop awareness of high academic standards needed for achievement, cultivate leadership skills, describe the connection between high skill and high wage employment preparation, and learn about advanced and continuing education. ABE 082: ABE Technology Variable Cr Quarters: F/W/S This course is for basic education students interested in developing basic technical skills for home and family use. ABE 083: Basic Technology II Variable Cr Quarters: F/W/S AcoursethatisspecificallydevelopedforABEstudents who are interested in further developing basic technology skills. This class serves as a transition class for college-level classes. Prerequisite: ABE 082 or instructor's permission. English as a Second Language (ESL) Adult English as a Second Language (ESL) literacy classes are for adults who want to learn to understand, speak, read,andwriteEnglish.SixESLclasslevelsareofferedin order to appropriately place applicants who have varying levels of English skills. Classes combine listening, speaking, reading, and writing instruction and prepare students to transition into ABE classes. Courses ABESL 011: Literacy I Variable Cr Quarters: F/W/S/SR A student enrolled in ABESL 011 has very limited literacy in his/her own language. The emphasis of work is oral; listening and speaking. Beginning reading/writing activities are introduced. Learning is embedded in a series of themes chosen by the class. Prerequisite: ABE 082 or instructor's permission. ABESL 012: Literacy II Variable Cr Quarters: F/W/S/SR Students in ABESL 012 can perform the copying of words, phrases, and sentences more readily than ABESL 011 students. Emphasis of work is oral; listening and speaking. Learning and practice of skills are embedded in themes chosen by the class. Prerequisite: Entry test using the oral screen of the CASAS test or placement into class with score of 181-190 on the listening portion of the CASAS test or permission of instructor ABESL 013: Literacy III Variable Cr Quarters: F/W/S/SR A student enrolled in ABESL 013 can perform the copying of words, phrases and sentences more readily than ABESL 012 students. Emphasis of work is also oral with an increasing emphasis on reading and writing. Prerequisite: Entry test suing the oral screen of the CASAS test or placement into class with a score of 191-200 on the listening portion of the CASAS test or permission of instructor ABESL 014: Literacy IV Variable Cr Quarters: F/W/S/SR A student enrolled in ABESL 014 has basic comprehension, speaking, reading, and writing skills. Reading and writing may be at the developing stage but includes recognition and writing of letters and words. Work in ABESL 014 is oral with an increasing emphasis through the quarter on reading and writing. Prerequisite: Students must pass the oral screen of CASAS test as well as place with a score of 201-210 on the listening portion of the CASAS test or permission of instructor. ABESL 015: Literacy V Variable Cr Quarters: F/W/S/SR A student enrolled in ABESL 015 can follow basic oral instruction, ask questions to clarify, and participate in routine work, school and social conversations. The student has basic reading/writing skills. The emphasis of work in ABESL 015 is on conversation skills, reading, and writing. Prerequisite: Students must pass the oral screen of the CASAS as well as place with a score of 211-220 on the listening portion of the CASAS test. Yakima Valley Community College, 2015-2016 65 66 ABESL 016: Literacy VI Variable Cr Quarters: F/W/S/SR ABESL 016 students can follow multi-step oral instructions, identify vital information from an oral source, ask clarificationquestions,explain/reportinformationorally, and negotiate in conversations in routine work, learning, and social situations. At Level 6, basic reading/writing skills are in place. The emphasis of work is on advanced conversation skills, reading, and writing. Prerequisite: Students must pass the oral screen of the CASAS as well as place with a score of 221-234 on the listening portion of the CASAS test. Aerospace Machining Technology Yakima Valley Community College Aerospace Machining Technologydegreeandcertificatespreparestudents for entry-level positions in the manufacturing industry. Students learn the skills required to plan and carry out the operations needed to make aerospace machined products thatmeetprecisespecifications.Courseinstructioncovers blueprint reading, manual machining, computerized machining, metrology, quality control, engineering drawing, Computer Aided Design & Drafting (CADD) and Computer Aided Manufacturing (CAM) software as well as Coordinate Measuring Machine (CMM) programming. Associate of Applied Science in Aerospace Machining Technology First Year - Fall ENGR 116 Blueprint Reading for Machine Trades I 5 ENGR 117 Mathematics for Machine Trades I 5 ENGR 120 Machining & CNC Technology - Lecture I 5 ENGR 140 Machining & CNC Technology - Lab I 5 Total Credits 20 First Year - Winter ENGR 121 Machining & CNC Technology - Lecture II 5 ENGR 126 Blueprint Reading for Machine Trades II 5 ENGR 127 Mathematics for Machine Trades II 5 ENGR 141 Machining & CNC Technology - Lab II 5 Total Credits 20 First Year - Spring ENGR 111 Mechanical CAD (Intro to Solidworks) 3 ENGR 122 MasterCAM 5 ENGR 123 Catia V5 3 ENGR 142 Machining & CNC Technology - Lab III 5 Total Credits 16 First Year - Summer PTECH 120 Technical Writing 5 or BA 138: Written Business Communications or ENGL& 101: English Composition I Total Credits 5 Second Year - Fall ENGR 101 Project Management 5 ENGR 212 Inspection & Metrology 5 ENGR 213 Quality Control (AS9100 & ISO Standards) 5 ENGR 223 Advanced MasterCam 3 Total Credits 18 Second Year - Winter ENGR 235 CNC Mill 5 ENGR 241 CNC Lathe I 5 ENGR 242 CNC Tooling & Setup 5 Total Credits 15 Second Year - Spring ENGR 270 Advanced Machining CNC Lathe 5 ENGR 272 Advanced Machining CNC Mill 5 ENGR 190-193 Co-op Field Experience I, II, III or ENGR 230-232: Engineering Project Design 5 Total Credits 15 Total Credits for Degree 109 Aerospace Machining Technology Certificate TheMachiningTechnologycertificatepreparesqualified individuals for entry into the job market as a machinist. Instruction covers programming and basic set-up and operation of manual & CNC machines, blueprint reading, shop mathematics, machine tool theory, and inspection. Students will be involved in the production and machining of aerospace/industry parts. Instruction will also include the use and care of a wide variety of measuring devices used in the machining profession. Requirement: Must be eligible for MATH 075 Yakima Valley Community College, 2015-2016 First Quarter ENGR 116 Mathematics for Machine Trades I ENGR 117 Blueprint Reading for Machine Trades I ENGR 120 Machining & CNC Technology - Lecture I ENGR 140 Machining & CNC Technology - Lab I Total Credits First Quarter Second Quarter ENGR 126 Mathematics for Machine Trades II ENGR 127 Blueprint Reading for Machine Trades II ENGR 121 Machining & CNC Technology - Lecture II ENGR 141 Machining & CNC Technology - Lab II Total Credits Second Quarter Total Credits for Certificate CNC Operator Certificate MachiningTechnologycertificateplus: Third Quarter ENGR 111 Mechanical CAD (Intro to Solidworks) ENGR 122 MasterCAM ENGR 123 Catia V5 ENGR 142 Machining & CNC Technology - Lab III Total Credits Third Quarter Summer/Fall Quarter ENGR 101 Project Management PTECH 120 Technical Writing or BA 138: Written Business Communications or ENGL& 101: English Composition I Total Credits Summer/Fall Quarter Total Credits for Certificate 5 5 5 5 20 5 5 5 5 20 40 3 5 3 5 16 5 5 10 66 Courses ENGR 101: Project Management 5 Cr Quarters: F This course is a comprehensive overview of engineering project management. It will emphasize the fundamental principles of contracts, plan reading, resource management, and human relations in the engineering workplace. ENGR 111: Mechanical CAD 3 Cr Quarters: S Students learn the essentials of mechanical drafting using a CAD software. Basic and geometric tolerances, layouts and detailing standards are discussed. Prerequisite: ENGR 110 ENGR 116: Mathematics for Machine Technology I 5 Cr Quarters: F Thisisthefirstpartofatwo-partcourseusingmathematics in a practical and applied way to solve engineering problems; particularly problems that are encountered in the machine trade profession. Arithmetic, algebra, and geometry will be covered. Prerequisite: MATH 050 or permission of instructor. ENGR 117: Blueprint Reading for Machine Trades I 5 Cr Quarters: F This is an introductory class to be able to read blueprints and understand machine trade terminologies from mechanical drawings.Thisisthefirstpartofatwo-partseries. ENGR 120: Machining & CNC Technology I - Lecture 5 Cr Quarters: F Thisisthefirstpartofatwo-partlectureserieson machining and CNC technology. This course provides the basic understanding, usage, and safety procedures for conventional lathes and milling machines. It introduces CNC machine programming. Prerequisite: Concurrent enrollment in ENGR 140 ENGR 121: Machining & CNC Technology II - Lecture 5 Cr Quarters: W This is the second part of a two-part lecture series on machining and CNC technology. This course provides an advanced understanding of usage and safety procedures for conventional lathes, milling machines, and CNC machine. Prerequisite: ENGR 120, ENGR 140, and concurrent enrollment in ENGR 131 ENGR 122: MasterCam 5 Cr Quarters: S This course is designed to introduce students to computeraided manufacturing using MasterCam for 2, 3, and 4 axis machining. This will include wireframe creation and tool path generation for CNC machining. Prerequisite: ENGR 121 and ENGR 141 ENGR 123: CATIA 3 Cr Quarters: S Students learn the fundamentals of 2D and 3D orthographic projection drawing on the latest version of CATIA program. Students will learn how to draw to scale and print out their work (color or B/W). The class is taught in a drawing studio format, and portfolio creation is a key component of the course. The goal is that by the end of the quarter, students willknowhowtocreateaccuratelyandefficientlyany2-Dand 3-D drawing. ENGR 126: Mathematics for Machine Technology II 5 Cr Quarters: W This is the second part of a two-part course using mathematics in a practical and applied way to solve engineering problems; particularly problems that are encountered in the machine trade profession. Arithmetic, algebra, geometry, and trigonometry will be covered. Prerequisite: ENGR 116 or permission of instructor ENGR 127: Blueprint Reading for Machine Trades II 5 Cr Quarters: W This is an advanced class to be able to read blueprints and understand machine trade terminologies from mechanical drawings. This is the second part of a two-part series. Prerequisite: ENGR 117 or permission of instructor ENGR 140: Machining & CNC Technology I - Lab 5 Cr Quarters: F Thisisthefirstpartofatwo-partlaboratoryserieson machining and CNC technology. This course provides the basic hands-on operation and safety procedures for conventional lathes and milling machines. It also introduces CNC machine programming. Prerequisite: Concurrent enrollment n ENGR 120 ENGR 141: Machining & CNC Technology II - Lab 5 Cr Quarters: W This is the second part of a two-part laboratory series on machining and CNC technology. This course provides an advanced hands-on operation and safety procedures for conventional lathes, milling machines, and CNC machine programming. Prerequisite: ENGR 120, ENGR 140, and concurrent enrollment in ENGR 121 ENGR 142: Machining & CNC Technology III 5 Cr Quarters: S This course is designed to allow students to develop manual and CNC machining skills required for advanced manufacturingsuccessaswellasproduceafinishedproject suggested by the instructor. Prerequisite: ENGR 121 and ENGR 141 Yakima Valley Community College, 2015-2016 67 68 ENGR 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: O On-the-job training experiences with the engineering faculty assisting the student in analyzing, applying, and instituting engineering theory through actual practice. Variable credit is determined by the number of hours a student works per week. A minimum of one student-instructor contact hour is required per week. Prerequisite: Permission of instructor ENGR 212: Inspection & Metrology 5 Cr Quarters: F This course focuses on the science and skill of measuring and inspection. Students will learn to measure size, position,form,surfacefinish,andorientation.Students will understand the application of a variety of measuring instruments such as micrometers, calipers, gages, PCMM, and CMM. Students will learn the methods and instruments usedtoeffectivelyinspectpartsintheshop.Instructors will reinforce the theory and technique of accuracy, precision, and repeatability to help students develop an uncompromising attitude for good measuring technique. Prerequisite: ENGR 126, ENGR 127, and ENGR 121 ENGR 213: Quality Control 5 Cr Quarters: F Students will acquire a comprehensive understanding of total quality management as dictated in AS9100 and ISO specifications.Studentswilllearnhowtoread,interpret,and utilize standardization documentation. Prerequisite: ENGR 142 ENGR 223: Advanced MasterCam 3 Cr Quarters: F This course is a Mastercam CAD/CAM software class for Machine Technology-oriented students. The purpose of this class is to continue to build upon skills introduced in ENGR 122. The students will create complex part geometry and assign 3D tool paths as well as the generation of 4- and 5-axis tool paths in Mastercam. Prerequisite: ENGR 122 ENGR 230, 231, 232: Engineering Design Project 5 Cr Quarters: F, W, S Studentswillpreparespecificationsforarealengineering project. This course is intended to give second-year engineering technology and construction design students an opportunity to use their abilities in project conception and design with the aid of CAD, surveying equipment, and other engineering tools. ENGR 235: CNC Mill 5 Cr Quarters: W This course is designed to build skills and knowledge in Computer Numerical Controlled (CNC) milling. Upon completion of this course, students should be able to program, set up, and operate a CNC milling machine. Prerequisite: ENGR 142 ENGR 241: CNC Lathe 5 Cr Quarters: W This course is designed to build skills and knowledge in Computer Numerical Controlled (CNC) milling. Upon completion of this course, students should be able to program, set up, and operate a CNC milling machine. Prerequisite: ENGR 142 Yakima Valley Community College, 2015-2016 ENGR 242: CNC Tooling & Set Up 5 Cr Quarters: W This course is designed to provide Computerized Numerical Control (CNC) machine tool set up, workholding, and operation. Theory will be practical in nature and relate directly to shop-based applications. CNC Lathe and Mill operations will be stressed; however, the theory and concepts will be applicable to various CNC machine tools as well as manual machines. Prerequisite: ENGR 142 ENGR 270: Advanced Machining CNC Lathe 5 Cr Quarters: S This course is designed to build skill and knowledge in CNC. Upon completion of this course, students should be able to program, set up, and operate CNC equipment. Students will work on projects using the CNC to practice the concepts taught in class. Prerequisite: ENGR 241 ENGR 272: Advanced Machining CNC Mill 5 Cr Quarters: S This course is designed to build skill and knowledge in CNC. Upon completion of this course, students will be able to program, set up, and operate CNC equipment. Students will work on projects using the CNC to practice the concepts taught in class. Prerequisite: ENGR 235 Agriculture The mission of the Agriculture program is to serve as a partner with the diverse agriculture industry to provide students with the attitudes, abilities, and problem-solving capabilities to meet career responsibilities and lead agriculture into the future. As the number one employer in central Washington, the agricultureindustryoffersexcitingandchallengingcareer opportunities. Program Outcomes Upon successful completion of this program the student should be able to: • Develop skills needed to meet various agriculture career responsibilities. • Enter entry level jobs in the agriculture industry or meet additional responsibilities in current positions. • Transfer successfully into articulated programs. Careers Agricultural production, processing, and marketing activities in our agriculturally diverse geographic area are supported by many enterprises which conduct activities in research, marketing, technical advising, input supply, regulatory compliance, storage, packing, processing, production, and animal health and care. Firms working in one or more of these activity areas require employees who can implement solutions to practical problems using existing and new technology and with concern for safety and environmental protection. YVCC’sAgriculturedepartmentdegreesandcertificates provide students with the necessary skills and abilities thatemployersdesire.Salariesandbenefitsinentry-level positions vary but have remained competitive. Advancement inthevariouscareerfieldsremainsopenandattainable. • Agribusiness program: Students completing the program should be able to apply business management and agriculture production principles to the management andoperationofagribusinessfirms. • TreeFruitProductionprogram:Degreeofferedin partnership with Wenatchee Valley College. Career opportunities include horticulturists, integrated pest management specialists, production managers, and processing managers. • Vineyard Technology program: Hands-on training will be provided in all aspects of vineyard operations with a broad knowledge of viticulture and applied sciences. • Winery Technology program: Students will learn appropriate wine-making principles from fermentation to bottling with experience in the tasting room and management. For more information on current employment trends, check with the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is available at the following websites: www.Access.wa.gov or www. WorkforceExplorer.com Degrees Associate of Applied Science The Agriculture Associate of Applied Science degrees are designed for students to develop skills to enhance employment opportunities in the agriculture industry or to prepare students for transfer into baccalaureate degree programs at other institutions. YVCC’sAgriculturedepartmentoffersthefollowing Associate of Applied Science degrees: • Agribusiness • Tree Fruit Production • Vineyard Technology • Winery Technology TheAgriculturedepartmentalsooffersanAssociatein Applied Science Transfer (AAS-T) degree, for students wishing to transfer to a four-year institution. Information on this degree can be found at www.yvcc.edu/ag. Agribusiness Thisdegreeisofferedjointlybetweenthebusiness and agriculture departments. Students will develop an understanding of basic business management and agriculture production principles. They can apply these principles and skills to the management and operation of agribusinessfirms.Examplesofcareeropportunitiesinclude crop production managers, sales representatives, farmers and ranchers, agribusiness managers and owners, and record-keeping specialists. Required Courses Credits ACCT& 201 Principles of Accounting I 5 AG 101 Introduction to Agriculture 1 AG 125 Safety and Labor Management 5 AG 220 Current Ag Issues and Trends 3 AGECN 201 Economics in Agriculture 5 AGECN 210 Farm Management 5 AGSCI 101 Introduction to Plant Science 5 AGSCI 201 Soils 5 AGSCI 130 Introduction to Animal Science or AGSCI 211: Fruit Science 5 BA 115 Business Math 5 BA 138 Written Business Communication 5 BA 180 Consumer Financial Planning 5 BA 220 Human Relations Workplace 2 BUS& 101 Introduction to Business 5 BT 101 Beginning Keyboarding 5 or BT 160: Word Processing Short Course 2 ECON& 202 Macro Economics 5 IT 100 Introduction to Computers 3 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 Approved Electives* 20 Total Degree Credits 96-98 *20 credits can be from the following disciplines: AG, AGECN, AGSCI, BA, BIOL, CHEM, IT, MATH, or SPAN. Tree Fruit Production YVCCoffersaTreeFruitProductiondegreeinpartnership with Wenatchee Valley College. Students take classes at YVCC along with classes from WVC via distance learning. With successful completion of this program, students earn an Associate of Technical Science degree from Wenatchee Valley College without having to travel from the Yakima Valley. Career opportunities include horticulturists, integrated pest management specialists production managers, and processing managers. For more information on the program of study, contact the Agriculture Department at 509.8827007. Vineyard Technology This degree emphasizes the development of grape production principles with specialization in the integrated management of insect, disease, and weed pests. Examples of career opportunities include grape production manager, crew supervisor, technical advisor, and production crew worker. Program and Curriculum Guide Fall Year 1 AG 120 Introduction to Washington Wines AGSCI 101 Introduction to Plant Science AGSCI 135 General Viticulture MATH 085 Beginning Algebra (or higher) Winter Year 1 AG 125 Safety & Labor Management AGSCI 131 Washington’s Terroir Credits 2 5 3 5 5 3 Yakima Valley Community College, 2015-2016 69 70 CHEM 100 Introduction to Chemistry ELECTIVE Elective Spring Year 1 AGSCI 112 Essentials of Winemaking CHEM 109 Principles of Chemistry Lecture CHEM 110 Principles of Chemistry Lab BA 138 Written Business Communication Summer Year 1 AG 190** Co-op Work Experience AGSCI 233 Summer Viticulture Fall Year 2 WGMT 112 Irrigation (taken at WWCC) AGSCI 212 Winemaking BA 115 Business Math Winter Year 2 AGECN 210 Farm Management AGSCI 201 Soils AGSCI 213 Integrated Pest Management AGSCI 234 Winter Viticulture 5 5 **The work experience can be taken in the Fall, Winter, Spring, or Summer quarters. 3 4 1 5 Vineyard Technology AAS-T 4 3 4 5 5 5 5 5 2 Spring Year 2 AGSCI 214 Sustainable Agriculture AGSCI 235 Vineyard Management Approved Elective Total Degree Credits **The work experience can be taken in the Fall, Winter, Spring, or Summer quarters. 5 5 5 99 Winery Technology This degree provides students with an understanding of principles and application of technology associated with wine production. Students will have the opportunity to learn about wine making using appropriate production, processing, sanitation, preservation, and safety methods. Students will also apply methods to evaluate grape and wine quality. Examples of careers in this area include technician, quality control specialist, wine maker assistant, retail salesperson, and plant operation supervisor and worker. Program and Curriculum Guide Term One AG 120 Introduction to Washington Wines AGSCI 101 Introduction to Plant Science AGSCI 135 General Viticulture MATH 085 Beginning Algebra (or higher) Term Two AG 125 Safety & Labor Management AGSCI 131 Washington’s Terroir BA 138 Written Business Communication CHEM 100 Introduction to Chemistry Term Three AGSCI 112 Essentials of Winemaking BA 115 Business Math BIOL 105 Biology for Non-majors CHEM 109 Principles of Chemistry Lecture CHEM 110 Principles of Chemistry Lab Term Four AG 190** Co-op Work Experience AGSCI 202 Winery Operations I AGSCI 212 Wine making Approved Elective Term Five AGECN 212 Winery Management AGSCI 203 Winery Operations II AGSCI 255 Advanced Winemaking Approved Elective Term Six AGSCI 204 Winery Operations III AGSCI 235 Vineyard Management AGSCI 240 Winery Compliance AGSCI 245 Wine Sensory Total Degree Credits Yakima Valley Community College, 2015-2016 Credits 2 5 3 5 5 3 5 5 3 5 5 4 1 4 3 5 5 5 3 5 5 3 5 2 3 99 Program and Curriculum Guide Credits Term One AG 120 Introduction to Washington Wines 2 AGSCI 101 Introduction to Plant Science 5 AGSCI 135 General Viticulture 3 MATH 085 Beginning Algebra (or higher) 5 Term Two AGSCI 131 Washington's Terroir 3 AGSCI 201 Soils 5 AGSCI 213 Integrated Pest Management 5 ENGL& 101 English Composition I 5 Term Three AGSCI 112 Essentials of Winemaking 3 CMST& 210 Interpersonal Communication or CMST& 220: Intro to Public Speaking 5 Approved Humanities 5 Approved Ag Elective 5 Term Four AGECN 201 Agricultural Economics 5 AGSCI 212 Wine Making 5 CHEM 109 Principles of Chemistry Lecture 4 CHEM 110 Principles of Chemistry Lab 1 Term Five AGECN 210 Farm Management 5 CHEM 209 Intro to Organic/Biochemistry Lecture 4 CHEM 210 Intro to Organic/Biochemistry Lab 1 BA 256 Statistics 5 Term Six AGSCI 214 Sustainability 5 AGSCI 235 Vineyard Management 5 Approved Arts 5 Total Degree Credits 96 Certificates Thefollowingcertificatesaredesignedtoprovidestudents withaconcentrationofcoursesinaspecifictechnicalarea. Thecertificatesmaybesuitableforstudentswhowishto increase their knowledge and skills in a particular area. All coursestakenforthecertificateswouldapplytowardthe related associate degree programs. Certificate in Tree Fruit Production AG 125 Safety & Labor Management AGECN 210 Farm Management AGSCI 101 Plant Science AGSCI 201 Soils AGSCI 220 Current Ag Issues AGSCI 211 Fruit Science IT 100 Introduction to Computers Approved Electives Total Credits Certificate in Winery Technology AG 120 Introduction to Washington Wines AG 125 Safety & Labor Management AGSCI 101 Introduction to Plant Science AGSCI 112 Essentials of Winemaking AGSCI 135 General Viticulture AGSCI 212* Winemaking AGSCI 235* Vineyard Management AGSCI 240* Winery Compliance AGSCI 245* Wine Sensory AGSCI 255* Advanced Winemaking CHEM 100 Introduction to Chemistry Total Credits *Courses normally taken in year two. 5 5 5 5 3 5 3 10 41 2 5 5 3 3 5 5 2 3 5 5 43 Certificate in Vineyard Technology AG 120 Introduction to Washington Wines AG 125 Safety & Labor Management AGSCI 101 Introduction to Plant Science AGSCI 112 Essentials of Winemaking AGSCI 135 General Viticulture AGSCI 201* Soils AGECN 210* Farm Management AGSCI 212* Winemaking AGSCI 235* Vineyard Management CHEM 100 Introduction to Chemistry Total Credits *Courses normally taken in year two. Certificate in Wine Sales AG 120 Introduction to Washington Wines AGSCI 112 Essentials of Winemaking AGSCI 131 Washington’s Terroir BA 156 Marketing BA 275 Wine Marketing Total Credits 2 5 5 3 3 5 5 5 5 5 43 2 3 3 5 5 18 Courses AG 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. AG 080: Practical Farm Management I 2 Cr Quarters: F This course is designed to provide an introduction to the development of business goals, establishment and use of record-keeping systems, and preparation and analysis of financialreportstohelpindividualsmoreeffectivelymanage agricultural crop and livestock production enterprises. AG 085: Practical Farm Management II 2 Cr Quarters: F Thiscoursereviewsmethodsusedtodevelopcashflow, enterprise, and partial and whole farm budgets. Additional topics include the development of farm safety plans, a discussion of the management of labor resources, and a review of risk management techniques appropriate for crop and livestock production enterprises. Prerequisite: AG 080 AG 098, 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in agriculture. AG 101: Introduction to Agriculture 1 Cr Quarters: F Agriculture represents the single largest industry in the United States with many diverse career opportunities. The various sub-sectors that complete the agriculture industry will be discussed. Students will explore various job and career opportunities through observation, interviews, computer searches, and guest speaker presentations. AG 110: Agriculture Club 1 Cr Quarters: F The YVCC Agriculture Club is a member of the state and national Postsecondary Agriculture Student Organization. Students may receive one credit for participation in club activities, provided they prepare for and participate in at least one interview contest at the fall competition for the state organization. Preparation includes writing a resume and a letter of application as well as completing an application form. AG 120: Introduction to Washington Wines 2 Cr Quarters: F, W A course of study designed to introduce the participants to the art of knowing wine as part of human tradition and culture. There will be an overview of the Washington grape and wine industry, including an introduction to terminology, a summary of Washington grape production areas, types of wines produced, and the basics of wine evaluation. AG 121: Wine Selection and Serving 2 Cr Quarters: O This course presents an overview of appropriate wine serving techniquesandguidelinesforselectingwinesthateffectively enhance foods and occasions. AG 125: Safety & Labor Management 5 Cr Quarters: W Theprocessofsettingupaneffectivesafetymanagement program will be presented in accordance with employee safety and labor regulations relating to on-farm production and agribusiness environments. There will be practical emphasis on the development of leadership and human relations skills for successful interpersonal relationships. This course will also provide principles for the safe and environmentally responsible use of agricultural chemicals as a component of an integrated pest management system. AG 130: Wine Basics I Winemaking 2 Cr Quarters: O An introductory overview of winemaking, including a review of procedures, equipment requirements, and techniques for winemaking. AG 131: Wine Basics II Wine Quality Evaluation 2 Cr Quarters: O Students will be introduced to the use of visual, smell, and taste sensory processes to evaluate wine quality. AG 132: Wine Basics III Grape Growing 2 Cr Quarters: O Students will obtain a general overview of grapevine establishment and cultural methods used for grape growing. AG 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor AG 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor AG 220: Current Agriculture Issues & Trends 3 Cr Quarters: W-Odd Years Introduces students to important issues and trends that are occurring in agriculture. It presents important regulatory, environmental, economic, and public issues and examines howtheyareeffectingchangesandtrendsinproduction agriculture, agribusiness, agricultural research, and government policy. AG 290- 293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 71 72 Agricultural Economics AGECN 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in agricultural economics. AGECN 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor AGECN 201: Economics in Agriculture 5 Cr Quarters: F The introduction of microeconomics principles with application to agriculture. The importance of agriculture in our economy and the general organization of agriculture are presented. Students will examine input and production, supply and demand, and marketing principles. The principles will be used to develop practical, managerial, decisionmaking skills. AGECN 210: Farm Management 5 Cr Quarters: W Thiscourseisastudyoftheprinciplesforprofitable management of farms, ranches, and other business firmsrelatedtoagriculture.Discussedaremethodsfor developingfinancialstatementsandusingthemtomeasure performanceandefficiencyofagriculturalproduction enterprises. The importance of using budget development, investment analysis techniques, various sources of capital, andriskmanagementskillsforeffectivefarmmanagement decisions are also emphasized. AGECN 212: Winery Management 5 Cr Quarters: S There are over 50 wineries of diverse size in the Yakima Valley, and the number of wineries continues to increase. Students will have the opportunity to review economic and managementprinciplesandapplythemforeffectiveand efficientbusinessandoperationalplanningandwinery management. Agricultural Science AGSCI 101: Introduction to Plant Science 5 Cr Quarters: F An introductory course presenting principles of anatomy, morphology, physiology, and growth of crop plants. The effectsofenvironmentalconditions,culturalpractices,and management techniques on plant growth, development, yield, and quality are discussed. Students are introduced to important crops of Washington as well as principles of their production, propagation, and quality evaluation. This course is cross disciplined. Credit cannot be given for both AGSCI 101 and BIOL 107. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab AGSCI 110: Irrigation Principles 5 Cr Quarters: O Methods and practices of irrigation used in crop production in Central Washington. Principles of soil and plant water relationships and irrigation system design will be introduced. The issues of water sources, consumption amounts, and waterqualityalongwiththeireffectsonwatermanagement decisions will be presented. Yakima Valley Community College, 2015-2016 AGSCI 112: Essentials of Winemaking 3 Cr Quarters: S Introductory level enology course that will give an overview oftheelementsofviticultureandvinificationinvolvedin quality wine production. Topics will include fermentation, winery operations, roles of equipment, and technology. AGSCI 130: Introduction to Animal Science 5 Cr Quarters: F Introduction to the breeds and breed types of typical farm animals. The course will provide a general introduction to reproduction, care, and feeding of common agricultural animals with consideration of problems related to the local area. This course includes 4 hours of laboratory per week. Prerequisite: Placement testing eligibility for ENGL 095 and ENGL 081T or higher AGSCI 131: Terroir 3 Cr Quarters: W Thiscoursewillfocusondefiningtheconceptofterroir and what makes Washington unique in the world of wine. ThegeologichistoryofWashingtonanditseffectonthe formation of soil will be discussed with comparisons to the great wine grape-growing areas of the world. AGSCI 135: General Viticulture Grape Growing 3 Cr Quarters: F An introduction to the science and cultivation of growing grapes, including history, biology, climate, vineyard management practices, common pests and diseases, and establishment and training practices. Also included is a general overview of grape quality as it relates to harvest. AGSCI 170: Elementary Food Science 5 Cr Quarters: O A discussion of the interrelationship between people and their food supply with broad coverage of food products, food technology methods, and food safety issues. AGSCI 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in agricultural science. AGSCI 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Independentstudy/fieldexperienceinagriculturalscience. AGSCI 201: Soils 5 Cr Quarters: W Lifeonearthisdependentuponsoils.Effectivemanagement of soils is needed to protect this natural resource and at the same time produce food and biomass to support societies. Students will develop an understanding of soil formation and the basic physical, chemical, and biological properties of soils.Studentswillexaminefactorsthatinfluencesoilquality and how to manage soils considering important issues such as soil fertility and nutrient management, soil erosion, soil pollution, and land use planning. AGSCI 202: Winery Operations I 3 Cr Quarters: F Wine grape crush and post-fermentation processing practices and the principles and techniques involved in the production of premium table wine will be explored. This will include application in a winery setting with appropriate equipment, sanitation, and safety methods. Prerequisite: AGSCI 112 or permission of instructor AGSCI 203: Winery Operations II 3 Cr Quarters: W Wine processing techniques involved in the operation of a wine cellar are emphasized. The focus is on wine transfer techniques,additions,filtrations,blending,topping,and other winery operations. Wine analyses are also practiced. Prerequisite: AGSCI 112 or permission of instructor AGSCI 204: Winery Operations III 3 Cr Quarters: S Emphasis is on routine wine processing practices that occur during the spring prior to bottling. This hands-on experience will include barrel care and maintenance, blending exercises, quality control methods, and bottling practices. Prerequisite: AGSCI 112 or permission of instructor AGSCI 205: Weed Science 5 Cr Quarters: O An introductory weed science course presenting principles ofweedidentification,biology,andmanagement.Cultural, mechanical, biological, and chemical control methods will be incorporated in order to develop integrated weed management strategies for use on annual and perennial crops of Central and Eastern Washington. Herbicide classificationandmodesofactionwillbepresented. Recommended: AGSCI 101 AGSCI 210: Vegetable/Row Crop Production 5 Cr Quarters: O Principles for successful production, fertility management, handling, and storage of important vegetable and row crops of Central Washington. Appropriate propagation techniques and methods of crop improvement will be introduced. AGSCI 211: Introductory Fruit Science 5 Cr Quarters: O Practices, methods, and techniques of deciduous tree fruit production.Specifictopicswillincludeorchardlocation, varieties of trees, propagation, production management, andtheeffectofenvironmentontreefruitgrowthand development. AGSCI 212: Winemaking 5 Cr Quarters: F The science of winemaking involves the application of microbiology, chemistry, sensory phenomena, engineering, and other disciplines to create a quality product. This course will address the procedures, equipment, and techniques used for making quality wine. Recommended: AGSCI 101 and AGSCI 120 AGSCI 213: Integrated Pest Management 5 Cr Quarters: W This online course will introduce the philosophy, ecological foundation, and strategies and tactics of plant and animal pest management. Principles and practices of integrated chemical, cultural, and biological controls and issues related to pesticides and the environment will be emphasized. The information in this course will address management issues related to common, expected pest problems as well as minor pest problems. Recommended: AGSCI 101 AGSCI 215: Applied Plant Pathology 5 Cr Quarters: O Anintroductiontotheclassification,symptoms, epidemiology, and control of plant diseases of tree fruits and other important crops of Central Washington. Recommended: AGSCI 101 AGSCI 220: Applied Entomology 5 Cr Quarters: O Ageneralintroductiontoanatomy,classification,andcontrol of important insect pests of tree fruits and other important cropsofCentralWashington.Componentsofeffective integrated insect management programs will be presented. AGSCI 221: Wine Quality and Consumer Education 5 Cr Quarters: O This course will review characteristics used to assess wine quality and will provide guidelines for selecting and serving appropriate wines to accompany diverse menus and occasions. Principles of wine marketing and consumer sales from beverage or grocery stores, restaurants, and tasting rooms will be discussed. Recommended: AGSCI 120 AGSCI 222: Packing and Storage of Horticultural Crops 5 Cr Quarters: O The design, organization, logistics, and management of packing and storage facilities will be discussed. Principles of refrigeration and regular- and controlled-atmosphere storage will be presented with emphasis on application of thetechnologyforeffectivemanagementofpostharvest crop quality. Students will be introduced to the operation and control of packing line components. AGSCI 225: Food Quality Assurance 5 Cr Quarters: O An overview of the role of quality assurance in producing a safe food supply. Students will be introduced to the methodology and design of quality assurance programs for analyzing microbial and chemical hazards and identifying physical factors associated with food quality. Recommended: AGSCI 170 AGSCI 233: Summer Viticulture 3 Cr Quarters: SR This course will concentrate on vineyard management techniques from fruit set to harvest that relate to canopy management and fruit quality. Students will be introduced to how to monitor and control populations of grapevine pests andbeneficialinsects.Cropestimationandadjustmentswill also be covered. Prerequisite: AGSCI 135 or permission of instructor AGSCI 234: Winter Viticulture 2 Cr Quarters: W This course will focus on vineyard management techniques from post-harvest to budburst. Students will be introduced to principles and practical aspects of carbohydrate reserve formation and utilization, post-harvest irrigation, fertilization, cold weather protection, cold damage assessment, pruning, and other vineyard practices. Prerequisite: AGSCI 135 AGSCI 214: Sustainable Agriculture 5 Cr Quarters: S Students will be introduced to the concepts of how sustainable practices have a major impact on modern Agriculture. The biological, environmental and social factors involved in organic food production are covered, as well as the concept of alternative practices. Yakima Valley Community College, 2015-2016 73 74 AGSCI 235: Vineyard Management 5 Cr Quarters: S Vineyard Management involves integrating appropriate production strategies with the science of premium grape growing. This course is designed to educate students about establishing and maintaining a healthy commercial wine grape vineyard. Management issues related to production of high quality grapes as part of the winemaking process will be addressed. Prerequisite: AGSCI 135 AGSCI 238: Horse/Horsemanship 3 Cr A basic study of light horses. Quarters: O AGSCI 240: Winery Compliance 2 Cr Quarters: W Emphasis will be on the methods and practices to develop a good winery safety plan. Focus will also include tracking, monitoring, and recording wine additions and losses to remain in compliance with state and federal agencies. AGSCI 245: Wine Sensory 3 Cr Quarters: S Introduction to the principles of sensory and chemical characteristics in wines. Students will obtain knowledge of wine sensory terminology and will learn wine faults and how to recognize them. The components of a wine will be evaluated,includingappearance,aroma,andflavor. AGSCI 250: Plant Propagation 5 Cr Quarters: O Plant propagation techniques are used to multiply selected plants and preserve their essential genetic characteristics. Plant propagation is essential to the success of production agriculture and ornamental horticulture. The class will review the concepts of sexual and asexual plant propagation and specificallyaddressprinciplesandtechniquesofpropagation by seed and cuttings. Also addressed will be principles and techniques in micro-propagation and propagation by budding, grafting, and layering. Recommended: AGSCI 101 AGSCI 255: Advanced Winemaking 5 Cr Quarters: W Winemaking is a complex process. This course will explore fermentation techniques in detail and review important post-fermentation treatments. Wine spoilage will be discussed. There will be a detailed review of the chemical constituents in grapes and wine. Appellation control laws and adulteration concerns will also be addressed. Prerequisite: AGSCI 212 AGSCI 260: Postharvest Physiology 5 Cr Quarters: O Description of the postharvest processes occurring in fruits and vegetables, including respiration, physical and chemical changes, and moisture loss and their relation to storage longevity and quality of commodities. Management of postharvest decay and disease development will be discussed. Yakima Valley Community College, 2015-2016 Allied Health Technology The Allied Health Technology department provides career and enrichment coursework and clinical experiences in order to build the knowledge, skills, and competencies for providing care for people of all ages in a variety of medical professions. Thedifferentareasofstudyofferedinclude:Medical Assisting, Medical Billing and Coding, Medical Interpreter, Pharmacy Technician, Phlebotomy, and Surgical Technology. Eachprogramhasdifferentadmissioncriteria, coursework, and degree options, ranging from introductory classesandcertificatestoassociateofappliedscience degreesfocusedonaspecificareaofstudy. The majority of courses in Allied Health Technology are offeredthroughanonlineformat.Clinicallaboratorypractice and clinical externship is required in some program courses. Program Outcomes Upon successful completion of this program the student should be able to: • Utilizewell-definedprofessionalskillstoperformbasic procedures common to the various health care careers • Recognizetheimportanceofeffectivecommunication between health care professionals and their patients • Describe strategies to modify health care interactions to meet the needs of a culturally diverse community Medical Assisting Program Overview Combining convenient online instruction, laboratory simulations, and supervised clinical practice, the YVCC MedicalAssistingCertificateofCompletionprogram prepares students for a career as a medical assistant. Instruction includes core courses essential to health care professionals as well as specialty courses in medical assisting. Simulations of patient examination rooms, a laboratory,andafrontofficereceptionandbusinessarea in the allied health laboratory allow for hands-on practice of essential psychomotor skills. Clinical practice in local physician’sofficesandclinicsprovidesactualexperiences to prepare students for entry-level positions as a medical assistant. TheYVCCMedicalAssistingCertificateofCompletion program is 66 credits in length. Students may complete the course of study in four quarters of full-time attendance. Part-time study is also available. A program application is required, with thirty students accepted annually by use of a competitive point system. Upon successful completion of the program,thegraduatewillreceiveaCertificateinMedical Assisting. The Yakima Valley Community College Medical Assisting CertificateofCompletionprogramisaccreditedbythe Commission on Accreditation of Allied Health Education Programs (www.Caahep.org) upon the recommendation of the Medical Assisting Education Review Board (MAERB). Commission on Accreditation of Allied Health Education Programs, 1361 Park St., Clearwater, FL 33756; 727.210.1350. The optional Associate of Applied Science degree in Medical Assisting requires the student to complete 28 additional credits for a total of 94 credits. Prerequisite Courses Credits BT 101 Beginning Keyboarding 5 IT 105 Computer Literacy 3 Core Courses AH 105 Introduction to Pharmacology 3 AH 108 Comm. & Legal Concepts in Health Care 5 AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 AHBC 101 Introduction to Medical Coding 3 AHBC 102 Introduction to Medical Billing PTECH 115 Applied Mathematics II PTECH 120 Technical Writing Total Core Courses Credits 2 3 5 38 Clinical Procedures Courses AHMA 115 Clinical Procedures 10 Includes assisting with physical exam, asepsis, measurement of body functions; surgeries and wound care; activity, sensory systems and neurological exams; medication administration; medical laboratory; phlebotomy; cardiac and respiratory, digestive and nutritionary, and urinary and reproductive system procedures. AHMA145 OfficeEmergencies 1 Administrative Procedures Courses AHMA 125 Administrative Procedures 5 Includes scheduling and managing appointments, medical records, supply inventory, accounting principles, and business equipment and facility management. Practicum Courses AHMA 201 Externship AHMA 202 Externship Seminar AHMA203 CertificationExaminationPreparation Total Program Credits 7 1 4 66 Associate of Applied Science in Medical Assisting Medical assisting students may complete the following requirements to obtain an Associate of Applied Science degree. Natural Sciences Minimum of 5 credits Social Sciences Minimum of 5 credits Electives 18 credits with no more than 3 credits to come from physical education, drama, art, and music combined. Total Credits Associate Degree Option 94 Medical Billing & Coding Program Overview Combining convenient online instruction, laboratory simulations, and supervised practice, the YVCC Medical Billing and Coding Program prepares students for a career as a billing and coding specialist. Instruction includes core courses essential to health care professionals as well as specialty courses in medical billing and coding. Simulation of afrontofficereceptionandbusinessareainthealliedhealth laboratory allows for realistic practice. Supervised practice in localphysician’soffices,hospitals,andclinicsprovidesactual experiences to prepare students for entry-level positions as billing and coding specialists. TheMedicalBillingandCodingcertificateprogram, totaling 69 credits, may be completed on a full-time basis during four quarters of study, with part-time options for studyalsoavailable.Theendpointofthecertificateprogram will be supervised practice in a community facility. The 106-credit Associate of Applied Science degree in Medical Billing and Coding will add coding content particular to the hospital and clinical settings as well as education to prepare a student for the clinical and supervisory roles. A program application is required for both program options, with twenty students accepted annually by use of a competitive point system. Prerequisite Courses Credits BT 101 Introduction to Keyboarding 5 IT 105 Computer Literacy 3 Core Courses AH 105 Introduction to Pharmacology 3 AH 108 Comm. & Legal Concepts in Health Care 5 AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 AHBC 101 Introduction to Medical Coding 3 AHBC 102 Introduction to Medical Billing BA 115 Business Math PTECH 120 Technical Writing Total Core Courses Credits Program-Specific Courses AHBC 121 Health Care Reimbursement Issues I AHBC 122 Health Care Reimbursement Issues II AHBC 131 ICD-9-CM Coding AHBC 132 CPT/HCPCS Coding AHBC 133 ICD-10-CM Coding 2 5 5 40 3 3 2 4 3 Administrative Procedures Courses AHMA 125 Administrative Procedures 4 Includes scheduling and managing appointments, medical records, accounting principles, and business equipment and facility management. Practicum Courses AHBC 201 Coding Professional Practice 5 AHBC 203 CPC Examination Review 5 Total Program Credits 69 Associate of Applied Science in Medical Billing & Coding The community board advising the Medical Billing and Coding program has suggested the following coursework for the Associate of Applied Science degree in Medical Billing and Coding. All Associate of Applied Science degree in Medical Billing and Coding candidates will complete the 69 creditsspecifiedintheMedicalBillingandCodingcertificate program followed by 36 additional credits. Courses ACCT& 201 AHBC 218 AHBC 220 AHBC 224 Credits Principles of Accounting I 5 Health Care Reimbursement III 4 Advanced Coding 5 Billing Compliance Issues 3 20 elective credits to be selected in conjunction with the academic advisor 20 Total Program Credits 106 Medical Interpreter Program Overview Medical interpretation is a complex skill. Designed for the Spanish/English bilingual student, the YVCC Medical Interpreter program teaches the framework to understand the role of medical interpreter, the professional criteria to respond to a variety of interpreting situations, and the concreteskillstoallowtheinterpretertoprovideeffective interpretation and cultural advocacy. The curriculum uses participatory training techniques, such as role play, to include the student in an active learning process. The Medical Interpreter program is a short-term certificateprogram.Thecertificatewillincludethefollowing coursework. Certificate AH 119 Medical Terminology AHMI 101 Spanish Medical Interpreter Total Credits 5 5 10 Patient Navigation This program is designed to prepare students for patient navigation, care coordination, and advocacy roles. The program is based on an essential concept that four critical pieces to the patient navigation puzzle serve as a foundation; the system, the patient, the navigator role on the interdisciplinary team, and the skills needed to perform the role.Thecoursesareofferedinalearn-at-your-ownpace, sequential format. The Patient Navigation program is currently under development. For more information contact Allied Health Technology at 509-574-4913. Yakima Valley Community College, 2015-2016 75 76 Pharmacy Technician Program Overview Winter Quarter AH 172 Phlebotomy Clinical Experience Total Credits Combining convenient online instruction, laboratory simulations, and supervised clinical practice, the YVCC Pharmacy Technician program prepares students for a career as a pharmacy technician. Instruction includes core courses essential to health care professionals as well as specialty courses in pharmacy technology. A simulation of a pharmacy drug preparation area in the allied health laboratory allows for hands-on practice of essential psychomotor skills. Clinical practice in hospitals and retail pharmacies provide actual experiences to prepare students for entry-level positions in a variety of pharmacy settings. The YVCC Pharmacy Technician program is 62 credits in length. Students may complete the course of study in four quarters of full-time attendance. Limited part-time study is also available. A program application is required, with ten students accepted annually by use of a competitive point system. Upon successful completion of the program, the graduatewillreceiveacertificateinPharmacyTechnician Studies. Surgical Technology Program Overview The YVCC Surgical Technology program is 96 credits in length. Students may complete the course of study in seven quarters of full-time attendance. Limited part-time study is also available and must be scheduled with a program advisor. Instruction includes core courses essential to health care professionals as well as specialty courses in surgical technology. Simulation of an operating room within the laboratory provides hands-on practice in skills necessary to become a part of the surgical team. End-point courses include clinical rotations in surgery departments located around the Yakima Valley. Prerequisite Courses Credits BT 101 Beginning Keyboarding 5 IT 105 Computer Literacy 3 Core Courses AH 105 Introduction to Pharmacology 3 AH 108 Comm. & Legal Concepts in Health Care 5 AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 PTECH 115 Applied Mathematics II 3 PTECH 120 Technical Writing 5 Total Core Credits 33 Pharmaceutical Procedures Courses AHMA 115 Clinical Procedures (Asepsis) Program-Specific Courses AHPT 125 Pharmacy Tech Skills I AHPT 140 Pharmacy Law AHPT 170 Pharmacy Tech Skills II AHPT 175 Pharmacy Tech Skills III Practicum Courses AHPT 201 Pharmacy Externship AHPT 203 Pharmacy Technician Review Total Program Credits 1 4 1 5 6 8 4 62 Phlebotomy Program Overview Admission and Requirements A limited number of student positions are available. Interested students may pick up an application at the Allied Health department or an application can be mailed to them. AhighschooldiplomaorGEDcertificateandproofofthe firstHepatitisBdosemustbereturnedwithcompleted application for acceptance. Upon acceptance into the YVCC Phlebotomy program, students will be required to provide documentation of immunizations: 2 doses MMR (measles, mumps, rubella) or proof of immunity by titer, 2 doses of Varicella (chicken pox) or documentation from a physician of disease or proof of immunity by titer, 1 dose Tetanus, Diphtheria, Pertussis (Tdap), 3 doses Hepatitis B, a tuberculosis (TB) PPD skin test (if no documented negative skin test within last 12 months a 2-stepPPDisrequired),andcurrent-yearseasonalflushot. Current healthcare provider CPR/First Aid card and a 7-hour HIV/BloodBournePathogenscertificateisalsorequired. Program of Study - Fall Quarter Courses AH 170 Phlebotomy Essentials AH 171 Phlebotomy Essentials Lab Yakima Valley Community College, 2015-2016 2-4 7-9 Credits 4 1 Prerequisite Courses Credits BT 101 Beginning Keyboarding 5 IT 105 Computer Literacy 3 Core Courses AH 105 Introduction to Pharmacology 3 AH 108 Comm. & Legal Concepts in Health Care 5 AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 PTECH 115 Applied Mathematics II 3 PTECH 120 Technical Writing 5 Total Core Credits 33 Clinical Procedures Courses AHST 104 Surgical Equipment & Biomedical Safety AHST 106 Asepsis & Infection Control in Surgery AHST112 InstrumentationIdentification/SetUp AHST 125 Surgical Competencies I AHST 135 Surgical Competencies II AHST 150 Surgical Interventions/Procedures AHST 155 Surgical Pharmacology Total Procedures Credits 3 4 5 5 5 10 5 37 Practicum Courses AHST 201 Operating Room Clinical I AHST 202 Operating Room Seminar I AHST 210 Operating Room Clinical II AHST 211 Operating Room Seminar II AHST220 PreparingforBoardCertificationI AHST221 PreparingforBoardCertificationII Total Practicum Credits Total Program Credits 9 2 9 2 2 2 26 96 Courses AH 076: Community Service 0 Cr Quarters: F, W, S Thisclassisofferedasaself-support,communityservice, non-credit course. AH 098, 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in allied health. AH 105: Introduction to Pharmacology 3 Cr Quarters: F, W, S Introduction to Pharmacology presents a beginning description of topics pertaining to the understanding of the medication order, terminology used in prescribing medications, legislation relating to drugs, drug references, drugclassifications,andformsofdrugs. Prerequisite: IT 105, BT 101, and PTECH 115 required for Medical Assisting, Surgical Technology, and Pharmacy Technician students AH 108: Communication & Legal Concepts in Health Care 5 Cr Quarters: F, W, S This course is designed to assist health care professionals to better understand and meet the needs and expectations of culturally diverse patient populations. Topics discussed will include communication in the medical setting, medical legal and ethical considerations, and culturally-appropriate health care strategies. Students will be introduced to factors that affecthealthcareinteractions,suchasculturalbackground, developmental stage, grief, stress level, legal requirements, and ethical dilemmas. Prerequisite: BT 101 and IT 105 AH 110: Human Body in Health & Disease I 5 Cr Quarters: F, W, S, SR This course is an integration of basic structures and functions ofthehumanbodywithdiseaseprocessesthatcanaffect bodysystems.ThisisthefirstoftwoHumanBodyinHealth and Disease classes and includes an introduction to cellular function as well as the anatomy and physiology of the integumentary, skeletal, muscular, sensory, and digestive systems. Included are the diagnostic tests, treatments, and possible prognoses for common disease processes that can affecteachofthesesystems. Prerequisite: IT 105 and BT 101 AH 119: Medical Terminology 5 Cr Quarters: F, W, S, SR This online course is designed to teach the language of medicinetothosewhoarepursuinganadministrativeoffice or clinical career in a medical-related or legal profession. Pronunciation, spelling, and meaning of the most commonly used medical terms will be covered. Anatomy and physiology medical terminology are covered for each body system. Practical application of words and abbreviations in operative reports, consultation, and examinations will be addressed. AH 120: Human Body in Health & Disease II 5 Cr Quarters: F, W, S This course is an integration of basic structures and functions ofthehumanbodywithdiseaseprocessesthatcanaffect body systems. This is the second of two Human Body in Health and Disease classes and includes a discussion of the anatomy and physiology of the endocrine system; hemodynamics; the heart, circulation and blood vessels; immunity and the lymphatic system; and the respiratory, urinary, and reproductive systems. Included are common diagnostic tests, treatments, pharmacological agents, and possible prognoses for common disease processes that can affecteachofthesesystems. Prerequisite: IT 105, BT 101, and AH 110 AH 155: First Aid/CPR/Blood-Borne Pathogen Training 2 Cr Quarters: F, W, S, SR This course will meet all Washington State requirements for First Aid, CPR, and Blood-Borne Pathogen training. The courseisintendedforanyindividualwhodesirescertification at the Health Care Provider level in the above topics. AH 170: Phlebotomy 4 Cr Quarters: F Phlebotomy is the collection of a sample of blood in order to perform laboratory testing. This course will teach entry-level phlebotomy skills, including venipuncture by syringe,vacutainer,andbutterflymethodsandcapillary puncturesoftheheelandfinger. Prerequisite: Acceptance into the course, copy of high school diploma or GED certificate submitted with the application, and concurrent enrollment in AH 171 AH 171: Phlebotomy Lab 1 Cr Quarters: F Phlebotomy is the collection of a sample of blood in order to perform laboratory testing. Students will practice entry-level phlebotomy skills, including venipuncture by syringe,vacutainer,andbutterflymethodsandcapillary puncturesoftheheelandfinger. Prerequisite: Acceptance into the course, copy of high school diploma or GED certificate submitted with the application, and concurrent enrollment in AH 170 AH 172: Phlebotomy Clinical Experience 2 or 4 Cr Quarters: W Phlebotomy Clinical Experience is a class in the mastery of phlebotomy techniques while working with patients in the hospital lab and clinic setting. Students will spend 60 hours in clinical labs and successfully draw 50 patients in order to complete the two-credit option. Students will spend 120 hours and successfully draw 100 patients in order to complete the four-credit option. Prerequisite: Successful completion of AH 170 and AH 171 AH 199, 299: Independent Study/Field Experience Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor Allied Health AHLTH 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. AHLTH 098: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in allied health. Medical Assistant AHMA 115: Clinical Procedures Variable Cr Quarters: F, S This variable credit course provides a theoretical foundation and hands-on practice of basic patient exam techniques and procedurescommonlyperformedinthephysician’soffice, clinic, or hospital. The role of each allied health technology specialty in relation to these procedures is emphasized. Prerequisite: Acceptance into an Allied Health Technology program AHMA 125: Administrative Procedures 4-5 Cr Quarters: F, W, S This variable credit course provides theoretical foundation and hands-on practice of administrative procedures commonlyusedinthephysician’soffice,clinic,orhospital. The role of each allied health technology specialty in relation to these procedures is emphasized. Prerequisite: Acceptance to an Allied Health Technology program AHMA 145: Office Emergencies for Medical Assistants 1 Cr Quarters: F, S This course provides an introduction to medical emergencies thatmayoccurinthemedicalofficeorclinicsetting.The medical assisting student will learn to respond to emergency situationseffectivelyanduseproceduralguidelineswhile operating within their scope of practice. Prerequisite: Acceptance into the Medical Assistant program Yakima Valley Community College, 2015-2016 77 78 AHMA 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in allied health medical assistant. AHMA 201: Medical Assist Externship 7 Cr Quarters: W, SR During this course, the student will be placed in a clinic or medicalofficetoperform,undertheguidanceofapreceptor, the medical and administrative skills learned while completing the medical assisting curriculum. Prerequisite: Completion of all required Medical Assisting courses AHMA 202: Medical Assisting Externship Seminar 1 Cr Quarters: W, SR This seminar meets once a week for those students enrolled in AHMA 201 or AHMA 205. Students will discuss the week’s experiential activities performed in the clinical setting. Legal and ethical issues will be reviewed. Students will have the opportunity to ask questions and receive input from the instructor and other students. Prerequisite: Concurrent enrollment in AHMA 201 or AHMA 205 AHMA 203: Certification Examination Prep 4 Cr Quarters: W,SR This course will systematically lead the student through a review of program topics, and impart updated information on topics from the curriculum that may be included in anationalcertificationexam.Studentswilllearnthe preparation and test-taking techniques required to complete acertificationtypeexam.Thecourseendpointwillbeto completeanationalcertificationexam,eithertheCMAor RMA. Prerequisite: AHMA 115 and concurrent enrollment in AHMA 201 and AHMA 202 AHMA 205: Combined Externship 7 Cr Quarters: W,SR This course is designed for students who are pursuing a certificateand/ordegreeinboththeMedicalAssisting and Medical Billing and Coding programs simultaneously. Students will be placed in a medical facility to practice the skills they have learned throughout the Medical Assisting and Medical Billing and Coding curricula. Under the guidance of a preceptor, the student will perform billing, coding, administrative, and clinical duties. Students are required to complete a 10-hour orientation followed by 100 hours performing billing, coding, and administrative functions and 100 hours performing clinical duties in the externship facility. Prerequisite: Acceptance into the Medical Assisting and Medical Billing and Coding programs and concurrent enrollment in AHMA 202 Medical Billing and Coding AHBC 101: Introduction to Medical Coding 3 Cr Quarters: F, W, S Provides a basic introduction to the medical coding procedures used to obtain reimbursement for medical procedures and examination services. Topics will include the proper application of CPT and ICD-9-CM, and HCPCD coding and introduction to ICD-10-CM. Prerequisite: Acceptance into the Medical Billing and Coding, Medical Assisting, or Medical Office Assistant programs or permission of instructor Yakima Valley Community College, 2015-2016 AHBC 102: Introduction to Medical Billing 2 Cr Quarters: F, W, S An introduction to accurate billing procedures in the medical office.Topicswillincludehealthcareinsurance,preparation of an insurance claim form to receive reimbursement for a patient encounter, applying third party payer guidelines, and collection procedures. This course provides basic information to begin understanding the billing systems used inamedicaloffice. Prerequisite: Acceptance into the Medical Billing and Coding, Medical Assisting, or Medical Office Assistant programs or permission of instructor AHBC 121: Health Care Reimbursement Issues I 3 Cr Quarters: W The study of health care reimbursement issues in acute and alternate health care. This course will include information about prospective payment systems for acute and alternate health care facilities, insurance programs, and managed care. Prerequisite: AHBC 102 or permission of instructor AHBC 122: Health Care Reimbursement Issues II 3 Cr Quarters: W The study of health care reimbursement issues in the outpatient and inpatient setting. Federal, state, and private health insurance plans, including managed care plans, will be studied as well as the cycle of health insurance claims. Included are health insurance terminology standard in a hospital billing department and legal issues relating to reimbursement processing. The following topics will be studied and discussed: UB-92 billing forms, DRG (diagnostic related groups), Correct Coding Initiative, billing and coding compliance issues, and collections. Prerequisite: Acceptance into the Medical Billing and Coding program, AHBC 102, and AHBC 121 or permission of instructor AHBC 131: ICD-9-CM Coding 2 Cr Quarters: W The study of ICD-9-CM coding principles, including coding practice using actual patient records and abstracts, and introduction to ICD-10-CM. Prerequisite: AHBC 101 and AH 119 or permission of instructor AHBC 132: CPT/HCPCS Coding 4 Cr Quarters: W The study and practice of coding principles according to the CPT and HCPCS coding systems. Also included is instruction intheassignmentofappropriatemodifierstoCPTand HCPCS codes that are dependent upon the health care environment,e.g.,physician’sofficeorhospitaloutpatient department. Prerequisite: AHBC 102 and AH 119 or permission of instructor AHBC 133: ICD-10-CM Coding 3 Cr Quarters: F,W,S During this course, the medical coding student will study ICD-10-CM (Volume 1 and 2). ICD-10-CM is the diagnostic coding system which will replace ICD-9-CM. Students will study the coding principles and guidelines. They will apply that knowledge to assign the ICD-10-CM code(s). Prerequisite: AHBC 101, AH 119, AHBC 131, or permission of instructor AHBC 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in allied health billing and coding. AHBC 201: Coding Professional Practice 5 Cr Quarters: S, SR During this course, the Medical Billing and Coding student willbeplacedineitheramedicaloffice,long-termcare facility, hospital, or an online externship program. They will practice the skills they have learned throughout the Medical Billing and Coding curriculum. Students will complete additional applications of billing and coding procedures that will be taught and tested in campus seminars and internet-based modules. Prerequisite: Successful completion of the Medical Billing and Coding certificate classes: AHBC 121, AHBC 122, AHBC 131, AHBC 132, and AHMA 125 AHBC 203: CPC Examination Review 5 Cr Quarters: S, SR This course is designed to assist students to prepare fortheoutpatient(physician-based)certificationexam administered by the American Academy of Professional Coders,requiredtoacquirethecredentialsofCertified Professional Coder (CPC). Topics discussed will include anatomy, medical terminology and pathophysiology, health care reimbursement issues, CPT coding, ICD-9-CM coding, and HCPCS coding. Prerequisite: Concurrent enrollment in AHBC 201 or permission of instructor AHBC 218: Health Care Reimbursement Issues III 4 Cr Quarters: F This course provides an in-depth study of health care reimbursement issues to prepare students to obtain reimbursement for examinations and procedures performedinthephysician’soffice,ambulatorysurgical center, emergency room, and hospital. The student will gain an appreciation of the importance of accuracy in billing practices. Fraud and abuse concerns will be addressed as wellasprocedurestoassistintheidentificationofimproper billing practices. Prerequisite: Successful completion of AHBC 122 and AHBC 132 or permission of instructor AHBC 220: Advanced Coding 5 Cr Quarters: F The study of CPT, ICD-9-CM (Volumes 1, 2, and 3), HCPCS codingprinciplesinthephysician’sofficeandhospital settings. Students practice coding from source documents such as operative reports and patient medical records. Implications of DRGs (diagnostic related groupings) and APGs (ambulatory patient groups) and their relationships to coding assignment for reimbursement are explored. Students apply theoretical concepts to problem-solve coding situations. Students will study the impact of ICD-10-CM coding on medical facilities and the changes that will go into effectwiththeICD-10-CMcoding. Prerequisite: Acceptance into the Medical Billing and Coding program, AHBC 122, AHBC 131, and AHBC 132 or permission of instructor AHBC 224: Medical Billing & Compliance Issues 3 Cr Quarters: F Medical record documentation and billing practices are under new guidelines and strict penalties. This course teaches the skills to perform an accurate and complete assessmentofmedicalofficecodingandreimbursement practices to ensure compliance with insurance carriers and government agencies. Concepts regarding use of the medical record as an audit tool to demonstrate that the services provided were necessary and reasonable will be discussed. Included will be auditing procedures to ensure reimbursementcomplianceinthemedicaloffice. Prerequisite: AHBC 122 and AHBC 132 or permission of instructor Medical Interpreter AHMI 101: Spanish Medical Interpreter 5 Cr Quarters: F, S This course teaches the Spanish translations for the most common biomedical terms used during the patient-provider encounter. Direct translation of medical terms, explanatory phrases when no direct linguistic translation exists, and colloquial terms will be covered. Also included is instruction in the special linguistic skill that is required of interpreters for supporting the triad relationship of patient-interpreterclinician while reinforcing the patient-clinician bond. Prerequisite: Bilingual Spanish/English Patient Navigation AHPN 101: The Patient Navigator 1 Cr Quarters: F, S This course introduces the interrelationships and intricacies of the very complex health and community services system anidentifiestheroleofthepatientcarenavigatorinassisting thepatienttoeffectivelymaneuverwithinthesystem. AHPN 102: The Patient Experience 1 Cr Quarters: F, S This course focuses on the whole patient including cultural considerations, barriers to optimal healthcare, the impact of chronic illness, and discusses promoting individual wellness usingdefinedadvocacyandengagementtechniques. Prerequisite: AHPN 101 with a grade of C or better or permission of instructor AHPN 103: The Medical Team 1 Cr Quarters: F, S This course will introduce care coordination as a practice and explore the roles of the navigator among the roles of the other members of the medical team. Prerequisite: AHPN 102 with a grade of C or better or permission of instructor AHPN 104: The Whole Patient 1 Cr Quarters: F, S This course introduces the importance of learning to respond with cultural sensitivity in order to serve patients withdifferentvalues,beliefs,andperspectivesabouthealth and wellness. Prerequisite: AHPN 103 with a grade of C or better or permission of instructor AHPN 105: The Communication Link 1 Cr Quarters: F, S This course will introduce the basic communication skills which increase the care navigator's quality of interactions with both patients and members of the health team. Prerequisite: AHPN 104 with a grade of C or better or permission of instructor AHPN 106: The Navigator as Coach 1 Cr Quarters: F, S Thiscoursewillfocusonthedifferencebetweencoaching and navigation, the scope of practice of the patient care navigator in the coaching process, and the skills the patient care navigator can use to motivate patients to successfully navigate the health and community services system while engaging in their own care. Prerequisite: AHPN 105 with a grade of C or better or permission of instructor Yakima Valley Community College, 2015-2016 79 80 AHPN 107: The Navigator Skills 1 Cr Quarters: F, S This course will provide a basic introduction to the required skills. Patient navigators are required to build relationships, problem solve, and locate resources. These functions require skills in communication, building relationships, navigation, and other related skills for successful practice of the patient care navigation role. Prerequisite: AHPN 106 with a grade of C or better or permission of instructor AHPN 201: The Health Care Matrix 1 Cr Quarters: F, W This course foucses on increasing knowledge of the intricacies and interrelationships of the complex health care system.Inordertobeeffective,thepatientcarenavigator mustlearntoworkwithinadefinedscopeofpracticeto connect the components of the health care system which include the patient, health care processes, the medical team, available resources, and the culture of the patient and the community. Prerequisite: AHPN 107 with a grade of C or better or permission of instructor AHPN 202: The Personal Patient Profile 1 Cr Quarters: F, W This course will focus on the aspect of patient navigation that empowers patients by assisting and preparing them tounderstandtheirownperonsalprofileincludingcultural considerations, personal characteristics, literacy, and activity levels. Prerequisite: AHPN 201 with a grade of C or better or permission of instructor AHPN 203: The Crisis Plan 1 Cr Quarters: F, W This course will focus on the emotional, social, and psychological impacts of chronic disease, behavioral health, and end-of-life issues and how the patient navigator can navigate the health care system on behalf of patients in crisis. Prerequisite: AHPN 203 with a grade of C or better or permission of instructor AHPN 204: The Engaged Patient 1 Cr Quarters: F, W This course will identify the challenges that patients face inmakinglastingchangesthatpositivelyaffecthealthand wellness and explore strategies to engage patients and their families in their own care. Evidence-based strategies that support healthy behaviors will be introduced. Students will practice motivtional interviewing techniques, Teach Back technique, and activation conversations that focus on strategies to engage both patients and familes. Prerequisite: AHPN 203 with a grade of C or better or permission of instructor AHPN 205: The Advanced Navigator 1 Cr Quarters: F, W This course will focus on advanced patient care navigation processes that prepare students to coordinate care for their clients while advancing the triple aim: better health outcomes, increased patient satisfaction and experience, and lower costs. Prerequisite: AHPN 204 with a grade of C or better or permission of instructor Yakima Valley Community College, 2015-2016 AHPN 206: The Cultural Impact 1 Cr Quarters: F, W This course will concentrate on advanced patient care navigation techniques used to identify, collect, and organize patient interview data on cultural, socio-economic, physical, and emotional issues for analysis and decision making. Prerequisite: AHPN 205 with a grade of C or better or permission of instructor AHPN 207: The Advanced Coach 1 Cr Quarters: F, W In this course, students will practice advanced communication and non-clinical coaching skills to facilitate health care team interaction while empowering patients to self-advocate and communicate their needs. Prerequisite: AHPN 206 with a grade of C or better or permission of instructor AHPN 208: The Navigation Capstone 1 Cr Quarters: F, W This culminating experience for patient care navigation will provide opportunities for advanced practice. Through in-depth case studies and group activities, opportunities willbeofferedtoapplylearnedpatientcarenavigatorskills in order to practice processes that would change patient outcomes. Prerequisite: AHPN 207 with a grade of C or better or permission of instructor Pharmacy Technician AHPT 098, 198, 298: Experimental/Exploratory Studies 10 Cr Quarters: O Experimental/exploratory studies in Allied Health Pharmacy Technician. AHPT 125: Pharmacy Technician Skills I 4 Cr Quarters: F This course teaches beginning pharmacy technician skills, including pharmacy math skills, common pharmacy abbreviations, drug dosage forms and routes of administration, pharmacy references, prescriptions, drug orders, and introduces the 100 most commonly prescribed medications. Prerequisite: Acceptance into the Pharmacy Technician program AHPT 140: Pharmacy Law 1 Cr Quarters: F This course provides an overview of pharmacy law and how it relates to the pharmacy technician. Some of the moreinfluentiallawsregulatingthepracticeofpharmacy will be discussed as well as the requirements for fulling prescriptions and medication orders. Eight hours of this course will be devoted to Washington State pharmacy law, with the remainder of the course to cover Federal law. Prerequisite: IT 105, BT 104, and acceptance into the Pharmacy Technician program AHPT 170: Pharmacy Technician Skills II 5 Cr Quarters: W This course covers commonly used pharmacy procedures including computer skills, labeling, insurance, billing, formularies, materials management systems, evaluating and processing medication orders and prescriptions, and the top 200 most commonly prescribed medications. Prerequisite: Acceptance into the Pharmacy Technician program and successful completion of AHPT 125 and AHPT 140 AHPT 175: Pharmacy Technician Skills III 6 Cr Quarters: W This course teaches sterile and non-sterile compounding skills. Included are the pharmaceutical skills of repackaging; preparation of medications in various forms; use and maintenance of compounding equipment; documentation; packaging and labeling of compounded medications; procurement of compounding supplies; storage; preparation, administration, and distribution of drugs and supplies to patients in the hospital; intravenous admixtures; and unit dose preparation. Prerequisite: Acceptance into the Pharmacy Technician program and successful completion of AHPT 125 and AHPT 140 AHPT 201: Pharmacy Externship 8 Cr Quarters: S The goal of the pharmacy externship course is to provide student exposure to community-based practice to develop competence as a pharmacy technician. Students will be assigned to a retail and/or hospital pharmacy to practice pharmacy technician skills under the supervision of a facility-designated preceptor. Prerequisite: Acceptance into the Pharmacy Technician program, completion of all required Allied Health core and Pharmacy Technician courses, and concurrent enrollment in AHPT 203 AHPT 203: Pharmacy Technician Review 4 Cr Quarters: S This course is designed as a capstone to the pharmacy technician student’s program of study. It will systematically lead the student through a review of program topics and impart updated information on topics that may be included inthefinalcomprehensiveprogramexaminationaswellasin thenationalcertificationexam.Strategiestoprepareforthe exams, including test-taking techniques, will be emphasized. Prerequisite: Acceptance into the Pharmacy Technician program, completion of all required Allied Health core and Pharmacy Technician courses, and concurrent enrollment in AHPT 201 Surgical Technology AHST 098, 198, 298: Experimental/Exploratory Studies 10 Cr Quarters: O Experimental/exploratory studies in Allied Health Surgical Technology. AHST 104: Surgical Equipment & Biomedical Safety 3 Cr Quarters: F This course explores the surgical technologist’s role with regard to equipment and supplies utilized within the operatingroom.Topicscoveredincludeelectrical,fire, biological, and chemical hazards in the operative area, properties of physics, surgical department designs, and physical components of the surgical suite. Students will identify common equipment and supplies by type, name, and function and will demonstrate proper care and handling. Students will apply principles of robotics to safe patient care and will examine support services and regulatory agencies with regard to their role in patient safety. Prerequisite: Current enrollment within the Surgical Technology program AHST 106: Asepsis & Infection Control in Surgery 4 Cr Quarters: W This course explores the impact of microbiology and asepsis on the practice of sterile technique and infection control in the operating room. Topics covered include cell structureandfunction,classificationoforganisms,immune responses, infectious processes, microbial growth and aseptic techniques, immunology, bacteriology, pathogens ofbodyfluidsandsystems,virology,parasitology,mycology, andwoundhealingwithrelationtohowtheseaffectsurgical practice. Prerequisite: Acceptance into the Surgical Technology program AHST 112: Instrument Identification & Set Up 5 Cr Quarters: F This course explores the surgical technologist’s role with regard to instrumentation utilized within the operating room to provide quality patient care. Students will identify basic instrumentsbyname,classification,andfunction.Students will demonstrate proper care, handling, and assembly of instruments and will apply the knowledge of instruments of surgical procedures. Prerequisite: Acceptance into the Surgical Technology program AHST 125: Surgical Competencies I 5 Cr Quarters: F Thefirstoftwosurgicalcompetencycourses,thiscourse explores the surgical technologist’s role in caring for the surgical patient. Topics include preoperative patient routines,properpatientidentification,surgicalconsents, review of the patient chart, care of patient possessions, patient care the evening and morning of surgery, methods ofpatienttransportation,establishingthesterilefield, room setup, the surgical scrub, gowning and gloving, assisting other team members, patient catheterization, skin preparation, positioning and draping the patient, preparation of the patient for anesthesia, and monitoring the sterilefield. Prerequisite: Acceptance into the Surgical Technology program AHST 135: Surgical Competencies II 5 Cr Quarters: W The second of two surgical competency courses, the course explores the surgical technologist’s role in caring for the surgical patient in an intra-operative and post-operative setting . Topics include intra-operative and post-operative case management, monitoring the patient during surgery, methods of homeostasis and blood replacement, emergency situations, specimen collection and care, tissue approximation, wound management, post-anesthesia recover, surgical documentation, contamination and disinfection, reprocessing of instruments, sterile storage and distribution, instrument wrapping and labeling, issues related to death and dying, discharge planning, and health and wellness. Prerequisite: Acceptance into the Surgical Technology program and AHST 125 AHST 150: Surgical Interventions & Procedures 10 Cr Quarters: W This course explores the surgical technologist’s role in diagnostic and surgical interventions. Students will determine which diagnostic procedures require surgical intervention and will explore general, obstetric and gynecologic, ophthalmic, otorhinolaryngologic, oral and maxillofacial, plastic and reconstructive, genitourinary, orthopedic, cardiothoracic, and peripheral vascular surgeries, as well as neurosurgery. Prerequisite: Acceptance into the Surgical Technology program Yakima Valley Community College, 2015-2016 81 82 AHST 155: Surgical Pharmacology 5 Cr Quarters: F Explores the surgical technologist’s role in pharmacology and anesthesia. Topics include terminology, action, use and modes of administration of drugs and anesthetic agents, side effectsandcontradictions,factorsthatinfluenceanesthesia selection,identificationofmonitoringdevices;complications related to anesthesia and possible interventions; transfer of drugs from non-sterile to sterile areas, and care and precaution in identifying drugs and solutions in the operating room. Prerequisite: Acceptance into the Surgical Technology program AHST 201: Operating Room Clinical I 9 Cr Quarters: S The Operating Room Clinical I course is designed to provide the student with exposure to community based practice in order to develop competence as an entry-level surgical technologist. Students are assigned to a surgical suite to practice all skills related to the surgical technologist within the perioperative setting under the supervision of a facility-designated preceptor. Emphasis will be placed on the surgical technologist in the scrub role. Prerequisite: Acceptance into the Surgical Technology program, successful completion of AHST 150, and concurrent enrollment in AHST 202 and AHST 220 AHST 202: Operating Room Seminar I 2 Cr Quarters: S Students in this course will meet once a week with a surgical technology instructor to discuss progress and solve problems in clinical-related issues. Prerequisite: Acceptance into the Surgical Technology program, completion of all required Allied Health core and Surgical Technology courses with a grade of C (2.0) or better, and concurrent enrollment in AHST 201 and AHST 220 AHST 210: Operating Room Clinical II 9 Cr Quarters: SR During this second of two clinical rotations, students will continue the practice of the surgical scrub role under the supervision of a facility-designated preceptor. Students will be expected to show progression towards autonomous performance of surgical technology functions as well as increased competency in more complex surgical cases. Prerequisite: Acceptance into the Surgical Technology program, successful completion of AHST 201, and concurrent enrollment in AHST 211 and AHST 221 AHST 211: Operating Room Seminar II 2 Cr Quarters: SR Students in this course will meet once a week with a surgical technology instructor to discuss progress and solve problems in clinical-related issues. Prerequisite: Acceptance into the Surgical Technology program, completion of all required Allied Health core and Surgical Technology courses with a grade of C (2.0) or better, and concurrent enrollment in AHST 210 and AHST 221 Yakima Valley Community College, 2015-2016 AHST 220: Preparing for Board Certification 2 Cr Quarters: S Thefirstoftwocoursesthatwillpreparethesurgical technology student to successfully participate in the National BoardCertificationExamination.Thecoursewillreviewall subjects relating to surgical technology with an emphasis on test-taking strategies and skills. Topics covered will include medical terminology, anatomy and physiology, microbiology and infection control, pharmacology and anesthesia, biomedical science and technology, the surgical patient and the surgical environment, wound management and asepsis, instrumentation and equipment, case preparation, and the professional aspects of surgical technology. Prerequisite: Acceptance into the Surgical Technology program and successful completion or concurrent enrollment in AHST 201 and AHST 202 AHST 221 Preparing for Board Certification II 2 Cr Quarters: S The second of two courses that will prepare the surgical technology student to successfully participate in the National BoardCertificationExamination.Thecoursewillreview concepts relating to surgical technology including surgery in all specialities with an emphasis on test-taking strategies and skills. Topics covered will include general, obstetric, gynecologic, genitourinary, head and neck, plastic and reconstructive, orthopedic, neurologic, ophthalmic, thoracic, cardiac, and vascular surgery. Prerequisite: Acceptance into the Surgical Technology program and concurrent enrollment in or successful completion of AHMA 210 and AHST 211 Anthropology Through its various subdisciplines, anthropology provides a holistic approach to studying humans as cultural and biological animals. The anthropology courses taught at YVCC offerstudentsanopportunitytodevelopasolidgroundingin the discipline. Students choosing to pursue a degree in anthropology should follow a program leading to the Associate in Arts DTA degreeandthentransfertoacollegeoruniversitythatoffers anthropology as a major. Courses ANTH& 100: Survey of Anthropology 5 Cr Quarters: F, W An introduction to cultural anthropology, biological anthropology, archaeology and linguistics. The primary focus is on how anthropologists know what they know and the importance and applications of that knowledge. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences ANTH 110: Mayas and Aztecs 3 Cr Quarters: O A course that introduces students to the basics of archaeological methodology and explores the Pre-Colombian civilizations of Mexico and Central America including the Olmecs, Mayas, and Aztecs. Distribution for DTA: Social Sciences ANTH 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in anthropology. ANTH 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor ANTH& 206: Cultural Anthropology 5 Cr Quarters: F, W, S Examines human societies from a cross-cultural perspective. Special attention is paid to the form and function of major cultural institutions, including subsistence and economic systems, marriage, family and kinship systems, religion and magic, and myth and ritual. Students will also explore questions concerning status, gender, basic personality development, language, reality construction, the mechanismsandeffectsofculturechange,theimportance of cultural relativism, and the nature of anthropological investigation. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences ANTH& 217: Plateau Native Peoples 2 Cr Quarters: O Using text-based discussion, video presentations, and visits to the museum and/or cultural center, the course provides a comprehensive overview of the lifeways, beliefs, and experiences of the original inhabitants of this area (the Mid-Columbia region). Prerequisite: Eligibility for ENGL& 101 and MATH 085 Distribution for DTA: Social Sciences ANTH 240: Youth Subcultures 4 Cr Quarters: S The purpose of this course is to acquaint students with methodologies and models of analysis appropriate for studying youth subcultures. Focusing on the origins, styles, and histories of the mod, skinhead, hippie, punk and goth subcultures, particular attention is paid to the popular contention that youth subcultures represent a response to various historic, social, economic, and generational circumstances. Prerequisite: Eligibility for ENGL& 101 ANTH& 204: Archaeology 5 Cr Quarters: O Thiscourseoffersanintroductiontocontemporaryand historic archaeological approaches, both theoretical and practical. It provides a general background to world prehistory, with special emphasis on the Americas. This course provides the trends and general practice of cultural resources management in the United States, and provides a basic understanding of archaeological preservation. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences ANTH& 205: Biological Anthropology 5 Cr Quarters: F, W, S Thisclassoffersanintroductiontothebiological development of Homo sapiens. It explores our place in nature, studying our relationship to other primates, our biological and cultural adaptations, and development through time. Attention is given to the principles and mechanics of evolution and to the methods of physical/ biological anthropology. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Natural Sciences Yakima Valley Community College, 2015-2016 83 84 Art Art is both a mirror and a shaper of the individual, society, and culture. Art is a fundamental human experience and behavior that crosses all boundaries. The Department of Visual Arts (DoVA) fosters an awareness of the making of art, the interpretation of art, the understanding of art across cultures and time, and the relevance of art to daily experience. Students are exposed to the vocabulary and craft of art through the department’s various classes. Stress is given to the development of technical skills and the communication of concepts and expression within traditional and contemporary issues, techniques, and technologies. DoVApreparesanddisplaysartworkfromitsofferings in an exhibit at the YVCC Larson Gallery during May of each academic year. Note: Permission to enroll in studio classes that require a prerequisite that has not been met can only be given by DoVA faculty members and only with a portfolio review of pertinent work.Someschedulingconflictswithstudioclassesmaybe resolved in consultation with the art instructors. Art Transfer Students considering the visual arts as a major or minor at a four-year transfer academy or university should consult with art faculty about planning their curriculum at YVCC. For those interested in pursuing a standard Associate in Arts degree with a visual arts emphasis, the following courses are strongly recommended within the Humanities and Elective distribution areas. Humanities Courses Credits ART 101 Deign I or ART 104: Drawing I 4 PHOTO 103 Digital Photography 5 HUM 102 Introduction to Humanities I or HUM 103: Introduction to Humanities II or HUM 104: Introduction to Humanities III 5 Electives/Core Electives Credits ART 101 Deign I or ART 104: Drawing I 4 ART& 100 Art Appreciation 5 Concentration area credits (two classes: clay, painting, drawing, photography, design, art history) 8-10 Courses ART& 100: Art Appreciation 5 Cr Quarters: F, W, S, SR Introductory course in visual art incorporating lectures, demonstrations, and active learning projects. Students will gain an awareness of the creative process, the various roles of art, and ways of viewing and responding to artworks. Prerequisite: YVCC placement into ENGL 095 Distribution for DTA: Humanities ART 101: Design I 4 Cr Quarters: F, W, S Introduction to the development of two-dimensional design processes. Emphasis is on the art elements (line, shape, value, space, texture, color) and visual problem-solving. Distribution for DTA: Humanities ART 102: Design II 4 Cr Quarters: W, S Continuation of the development of two-dimensional design processes. Emphasis is on art principles (e.g. emphasis, unity, variety, rhythm, etc.) and visual problem-solving. Distribution for DTA: Humanities - Performance Yakima Valley Community College, 2015-2016 ART 104: Drawing I Quarters: F, W, S, SR 4 Cr Beginning drawing. Introduction to the basics of drawing as an extension of visual understanding. Emphasis is given to the handling of various materials, development of skills and ideas, and the creation of successful compositions. Attention is given to perception of form, shading, and working with line and tone. Distribution for DTA: Humanities ART 105: Drawing II 4 Cr Quarters: F, W, S, SR Intermediate drawing. Continuation of elements and principles from beginning drawing, with greater emphasis on the development of personal visual statements as well as a more in-depth understanding of the materials and concepts of visual communication. Prerequisite: ART 104 Distribution for DTA: Humanities - Performance ART 107: Drawing III 4 Cr Quarters: S Life drawing, an intensive, drawing-based introduction to the formofthehumanfigurethroughtheuseofvariousdrawing strategies and techniques. The class gives the student an understandingofthehumanfigureasanaestheticobject,as a vehicle of personal expression, and as an image of historic and cultural importance. Prerequisite: ART 104 Distribution for DTA: Humanities - Performance ART 121: Western Traditions of Art 5 Cr Quarters: O This course is an introduction to the art history of the Western tradition beginning with the Sumerians and extendingtothepresent.Thesignificantartandartists within each of the major Western historical periods will be examined, including Egyptian, Greek, Roman, Medieval, Renaissance, Baroque, Modern, and Post-Modern. Prerequisite: YVCC placement into ENGL& 101 or completion of or concurrent enrollment in ENGL 095 Distribution for DTA: Humanities ART 122: Non-Western Traditions of Art 5 Cr Quarters: O This course is an introduction to the art history of the non-western tradition beginning with the Egyptians and extendingtothepresent.Thesignificantartandartistswithin each of the major non-western cultures will be examined, including Africa, Oceania, the Americas, India, Islam, Southeast Asia, China, and Japan. Prerequisite: YVCC placement into ENGL& 101 or completion of or concurrent enrollment in ENGL 095 Distribution for DTA: Humanities ART 150: Introduction to Clay 4 Cr Quarters: F, S A broad introduction to basic ceramic techniques and materials. Students will develop fundamental forming and surface techniques including essential skills for the potter’s wheel, coil and slab construction, and various decorative and glazed surfaces. Distribution for DTA: Humanities - Performance ART 190, 191: Co-op Field Experience I, II Variable Cr Quarters: O Fieldworkexperienceinaspecificart-relateddiscipline.May be repeated for credit. Prerequisite: Portfolio review, workplace placement ART 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in art. ART 199, 299: Individual Study in Studio Art Variable Cr Quarters: F, W, S Independent projects in studio work. May be repeated for credit. Prerequisite: Permission of instructor and prior studio class ART 211: Painting II 4 Cr Quarters: F, W, S Intermediate painting. Continuation of emphases from beginning painting with introduction of more varied techniques, philosophies, and approaches, stressing the development of pictorial concepts and personal development. Prerequisite: ART 210 Distribution for DTA: Humanities - Performance ART 201: Functional Pottery 5 Cr Quarters: F, W, S An introduction to fundamental skills for the potter’s wheel, basicfiringprocesses,andfunctionalglazingtechniques. Includes basic functional and visual design in utilitarian pottery. Distribution for DTA: Humanities - Performance ART 212: Painting III 4 Cr Quarters: F, W, S Advanced painting. Individual creative approach is stressed, allowing students to select or devise a style of painting based upon experience in previous painting classes. Prerequisite: ART 211 Distribution for DTA: Humanities - Performance ART 202: Clay I: Handbuilding 4 Cr Quarters: W Exploration of three dimensional form in clay using pinch, coil, slab, and simple molded construction with a variety of surface treatments. Emphasis on creativity and sculptural form. Distribution for DTA: Humanities Performance ART 280: Art History I 5 Cr Quarters: O Ancient to medieval. The development of western visual expression in painting, sculpture, architecture, and related art forms from its prehistoric beginnings through Egyptian, Mesopotamian, Greek, and Roman cultures (c. 1500 BCE to 530 CE). Lecture. Prerequisite: YVCC placement into ENGL& 101 Distributionfor DTA: Humanities ART 203: Clay II: Intermediate Wheelthrowing 4 Cr Quarters: W, S Advanced technique and form on the potter’s wheel with emphasis on craftsmanship and development of a personal sense of direction in skill and artistry; also an introduction to glazemixingandtheprinciplesofkilnfiring. Prerequisite: ART 201 Distribution for DTA: Humanities - Performance ART 204: Clay II: Intermediate Handbuilding 4 Cr Quarters: F, W, S Students learn and explore advanced hand-building techniques for sculptural ceramic art with an emphasis on craftsmanship and development of a personal sense of directioninskillandartistry.Studentswillrefinesurface decorating and glazing techniques and be introduced to principlesofkilnfiring. Prerequisite: ART 202 with a C or better Distribution for DTA: Humanities - Performance ART 205: Advanced Clay 2 Cr Quarters: O Exploration of a personal direction in clay for experienced students who are not yet prepared to work independently. Instruction on the wheel or in handbuilding involving in-class and arranged work time. Emphasis on artistic content, stylistic maturity, and craftsmanship. May be repeated for credit. Prerequisite: ART 203 or permission of instructor Distribution for DTA: Humanities - Performance ART 210: Painting I 4 Cr Quarters: F, W, S Beginning painting. Introduction to the techniques, philosophies, and various approaches to easel painting in either oil or acrylic. Subject matter ranges from perceptual still lives to abstract paintings. Recommended: ART 104 Distribution for DTA: Humanities - Performance ART 281: Art History II 5 Cr Quarters: O Medieval to late Renaissance. The development of western visual expression in painting, sculpture, architecture, and related art forms from the Early Christian period through the Byzantine, Medieval, Romanesque, Gothic, Renaissance, and Late Renaissance developments (c. 530 CE to 1600 CE). Lecture. Prerequisite: YVCC placement into ENGL& 101 Distribution for DTA: Humanities ART 282: Art History III 5 Cr Quarters: O Baroque to post-modern. The development of Western visual expression in painting, sculpture, architecture, and related art forms from the Baroque period through Rococo, Neoclassical, Romantic, Impressionist, Expressionist, Cubist, Abstract Expressionist, and Post-Modern developments (c. 1600 CE to present). Lecture. Prerequisite: YVCC placement into ENGL& 101 Distribution for DTA: Humanities ART 283: Asian Art History 5 Cr Quarters: W A survey of the prominent styles of India, China, Southeast Asia, and Japan from the earliest artifacts to the development of Buddhist Art, ca. 3000 BCE to 1000 CE. This course explores the exchange and adaptation of artistic elements betweenAsianculturesandtheeffectofintroducedreligions on indigenous subjects and symbolism. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 85 86 Astronomy Courses ASTR& 100: Survey of Astronomy 5 Cr Quarters: F, W, S, SR For the student who wants to gain a familiarity with the universe, solar system, characteristics and motions of stars, nebulae and galaxies, time systems, and celestial coordination. Distribution for DTA: Natural Sciences Automotive Service Technology, Master The Automotive Service Technology, Master (AST) program provides a quality, easily-accessible education, utilizing theory, design, application, and live work to prepare students for entry-level employment as dynamic, high-tech automotive technicians. Students are encouraged to reach their highest potential in the development of skills and professional integrity. The ability to think and reason, troubleshoot problems in a sequential order, and cooperate with coworkers is an integral part of the curriculum. Students practice skills and diagnostic procedures on late-model vehicles in all eightASEautomotiveareasofcertificationwhichinclude transmissions, engine performance and repair, brakes, steering/suspension, electrical, and heating and air conditioning. Technologicaladvancesintheautomotivefieldrequirea highly-skilledrepairtechnician.TheYVCCASTprogramoffers training in all areas of automotive diagnostics and repair with emphasis on electronic and computer-integrated systems found on today’s automobiles. Students will train in a large, modern facility with state-of-the-art equipment, and all instructorsareAutomotiveServiceExcellence(ASE)certified. The Automotive Service Technology, Master program requires a minimum of two years to complete. Enrollment is open to those who qualify at the beginning of Fall, Winter, and Spring quarters of each academic year. An Associate of Applied Science degree is awarded upon successful completion of the program with a minimum GPA of 2.0. TheASTprogramhasbeenevaluatedandcertifiedatthe highest level of and by the National Automotive Technicians Education Foundation (NATEF) and is an Automotive Service Excellence (ASE) Master Training Program. For program accreditation information, visit www.NATEF.org Program Outcomes Students who successfully complete the Automotive Service Technology Master program will be able to gain employment within the automotive industry. Students can qualify for positions as service technicians with new car dealerships, independent repair facilities, franchise operations, as well asgovernmentandfleetrepairfacilities.Studentscanalso qualify for positions with sale of automotive parts and service equipment. Opportunities exist at the manufacture level for technical support, training, and operations of new car dealerships. Careers Graduates will be prepared for entry-level employment, and students will be prepared to take the national ASE certificationtestsinalleightautomobileandlighttruck certificationareas.Careeropportunitiesintheautomotive repair industry are better than ever, as there is a shortage of qualifiedautomotivetechnicians.Competent,highlytrained, and motivated automotive service technology students are in demand. For more information on current employment trends, check with the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is available at the following websites: www.Access.wa.gov or www.WorkforceExplorer.com The YVCC Automotive Service Technology Master program has a collaborative program with YV-TECH. High school students can take one or two years of classes during their high school years. An extra year of YVCC classes is required to meet the degree requirements to graduate with an Associate of Applied Science degree. See a YV-TECH or YVCC advisor for more information. Yakima Valley Community College, 2015-2016 Degrees Associate of Applied Science in Automotive Service Technology Required Courses Credits AST 111 Engine Repair Lecture 8 AST 112 Engine Repair Lab 8 AST 121 Electrical/Electronic Systems Lecture 8 AST 122 Electrical/Electronic Systems Lab 8 AST 131 Steering/Suspension Systems Lecture 4 AST 132 Steering/Suspension Systems Lab 4 AST 141 Brake Systems Lecture 4 AST 142 Brake Systems Lab 4 AST 211 Engine Performance I: Ignition & Computer Systems Lecture 8 AST 212 Engine Performance II: Ignition & Computer Systems Lab 8 AST 221 Engine Performance II: Hybrid/Diesel Lecture 2 AST 222 Engine Performance II: Hybrid/Diesel Lab 2 AST 231 Heating & Air Conditioning Lecture 4 AST 232 Heating & Air Conditioning Lab 4 AST 241 Automatic Transmissions & Transaxles Lecture 6 AST 242 Automatic Transmissions & Transaxles Lab 6 AST 251 Manual Transmissions/Transaxles Lecture 4 AST 252 Manual Transmissions/Transaxles Lab 4 BA 220 Human Relations in the Workplace 2 PTECH 115 Applied Mathematics 3 or MATH& 107: Math in Society or MATH& 141: Precalculus I or MATH 111: Algebra Appl. to Bus. Econ 5 BA 138 Written Business Communications or ENGL& 101: English Composition I or PTECH 120: Technical Writing 5 Total Degree Credits 106-108 Certificates Certificatesprovidefirst-yearautomotivestudentswith entry-level skills in the specialized area aimed to assist them with gaining entry-level employment in those specialized automotive industries and begin to gain experience during theASTprogram.Combiningbothcertificateswillbe advantageous to the student by expanding the opportunities of employment in the industry. Note: Students seeking to gaineligibilityforthecertificatesneedtocontacttheAST programadvisorpriortoenrollmentasfinancialaidcanbe affected. Automotive Electrical and Electronic Systems StudentsintheirfirstyearoftheASTprogramcanobtaina certificateinthespecializedASEareaofAutomotiveElectrical andElectronicSystems(A6).Thecertificatewillbeawarded to the student who successfully completes the following coursework with a C+ (2.5) GPA or better. Required Courses Credits AST 121 Electrical/Electronic Systems Lecture 8 AST 122 Electrical/Electronic Systems Lab 8 Total Certificate Credits 16 Steering/Suspension and Brake Systems StudentsintheirfirstyearoftheASTprogramcanobtain acertificateinthespecializedASEareasofAutomotive Steering/Suspension Systems (A4) and Brake Systems (A5).Thecertificatewillbeawardedtothestudentwho successfully completes the following coursework with a C+ (2.5) GPA or better. Required Courses Credits AST 131 Steering/Suspension Systems Lecture AST 132 Steering/Suspension Systems Lab AST 141 Brake Systems Lecture AST 142 Brake Systems Lab 4 4 4 4 Total Certificate Credits 16 Courses AST 111: Engine Repair Lecture 8 Cr Quarters: F This course is a study of the theory, design, and operation of gasoline engines. Students will learn proper diagnosis, removal, and service procedures for cylinder heads and short blocks. Service and repair of the lubrication and cooling systems will be discussed. Students will create a personalized engine diagnostic strategy and a generic outline of engine removal and installation. AST 112: Engine Repair Lab 8 Cr Quarters: F This course allows students to practice engine diagnostic and repair procedures for internal combustion engines. Students will remove, disassemble, and repair internal engine components. All common engine machining processes and repair procedures will be practiced. Prerequisite: Completion of or concurrent enrollment in AST 111 AST 121: Electrical & Electronic Systems Lecture 8 Cr Quarters: W Students in this course will learn automotive electrical and electronic computer principles and fundamentals including wiring diagrams, circuits, analog and electronic instrumentation, and electrical and computer-controlled accessories. AST 122: Electrical & Electronic Systems Lab 8 Cr Quarters: W This course allows students to apply and practice electrical and computer system theory, diagnostic analysis, and repair procedures learned in AST 121. Students will practice electrical diagnostics of lighting circuits, analog instrumentation, indicator lights and warning devices, electrical and computer-controlled accessories, and electronic instrumentation on simulators, bench units, and live vehicles. Prerequisite: Completion of or concurrent enrollment in AST 121 AST 131: Suspension & Steering Lecture 4 Cr Quarters: S Students in this course will study front and rear suspension and steering system design and operation. They will also learn alignment geometry and dynamics related to computerized four-wheel alignment systems as well as tire construction, design, and grading. AST 132: Suspension & Steering Lab 4 Cr Quarters: S This course allows students to practice steering and suspension system and alignment geometry diagnostic and repair procedures learned in AST 131. Students will remove, disassemble, and repair steering and suspension components and perform four-wheel alignments on modern, computerized equipment. Prerequisite: Completion of or concurrent enrollment in AST 131 AST 141: Brake Systems Lecture 4 Cr Quarters: S Students in this course will study theory, design, and operation of brake systems. They will learn hydraulic operations, disc and drum brake system combinations, ABS modes of operation, and ABS diagnostics using modern diagnostic equipment. Yakima Valley Community College, 2015-2016 87 88 AST 142: Brake Systems Lab 4 Cr Quarters: S This course allows students to apply and practice brake system theory, diagnostic analysis, and repair procedures learned in AST 141. They will remove, disassemble, and repair disc and drum brake components as well as ABS hydraulic, electrical, and electronic components. Students will also perform diagnostic procedures, including machining and rebuilding of hydraulic and mechanical components. Prerequisite: Completion of or concurrent enrollment in AST 141 AST 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S Prerequisite: Permission of instructor AST 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in automotive service technology. AST 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor AST 211: Engine Performance I: Lecture 8 Cr Quarters: F Students will understand the principles, operations, and diagnostic techniques of the modern automotive computer-controlled gasoline engine systems. The students willunderstandidentification,diagnosis,andrepairofthe automotive powertrain systems including fuel delivery and fuel injection, ignition, and the electronic control systems. Prerequisite: AST 121 and AST 122 and concurrent enrollment in AST 212 AST 212: Engine Performance I: Lab 8 Cr Quarters: F In this lab, students will apply the theory and operations presenting in AST 211. The student will identify, diagnose, and repair problems associated with the computer-controlled automotive powertrain, its systems, and components. These systems include fuel delivery, fuel injection, ignition, and electronic control. Prerequisite: AST 121 and AST 122 and concurrent enrollment in AST 211 AST 221: Engine Performance II: Fuels and Emissions Lecture 4 Cr Quarters: W Students will learn the theory, principles of operation, and diagnostic procedures of automotive emission systems. This course will also introduce students to diesel systems, alternative fuels, and alternative powertrains/hybrids. Prerequisite: AST 121 and AST 122 and concurrent enrollment in AST 222 AST 222: Engine Performance II: Fuels and Emissions Lab 4 Cr Quarters: W Students in this course will demonstrate the operations and diagnosis of fuels and emission components using a practical application. Students will perform these applications in a shop environment using information presented in AST 221. This course will also introduce the student to diesel and hybrid technology, diagnostics, service, and repair. Prerequisite: AST 121 and AST 122 and concurrent enrollment in AST 221 Yakima Valley Community College, 2015-2016 AST 231: Heating & Air Conditioning Lecture 4 Cr Quarters: S This course is a study of the basic theory of air conditioning, system circuits, system diagnosis, and service procedures. Students will learn proper recovery, handling, storage, and recycling of R-12 and R-134a systems, and will be trained andmaybecomeEPAcertifiedinA/Csystemshandlingand storage. Prerequisite: AST 121 and AST 122 AST 232: Heating & Air Conditioning Lab 4 Cr Quarters: S Students in this course will learn the basic diagnostic, service, and repair procedures for air conditioning system circuits. They will practice on bench test systems and “live” vehicles using dual stage recovery systems and electronic hand-held test equipment. Prerequisite: AST 121, AST 122, and completion of or concurrent enrollment in AST 231 AST 241: Automatic Transmissions & Transaxles Lecture 4 Cr Quarters: W Students in this course will learn the operating principles of the automatic transmission and transaxle and their application in automobiles. Subassemblies, component, hydraulics, electronics, and diagnosis of the modern automatic transmission will be taught. All-wheel and four-wheel drive systems are included in this course. Prerequisite: AST 121, AST 122, and concurrent enrollment in AST 242 AST 242: Automatic Transmissions & Transaxles Lab 4 Cr Quarters: W Students in this lab course will apply theory and operation introduced in AST 241 to inspect, perform maintenance, diagnose, test, and repair modern electronically controlled automatic transmissions and transaxles. This course will also include the application of theory, diagnosis, inspection, service, and repair of all-wheel and four-wheel drive systems. Prerequisite: AST 121, AST 122, and concurrent enrollment in AST 241 AST 251: Manual Transmissions & Transaxles Lecture 4 Cr Quarters: S Students in this course will learn the principles and operation of manual transmissions, clutches, manual transaxles, and drivelines as well as rear axle systems. They will calculate ratios,torque,andRPMoftransmissiongearsandfinaldrive gearsetandtracepowerflowthroughthegears. Prerequisite: AST 121, AST 122, and concurrent enrollment in AST 252 AST 252: Manual Transmissions & Transaxles Lab 4 Cr Quarters: S Students in this course will diagnose and repair manual transmission/transaxles, clutches, drive axles/lines, and differentials.Theywillcalculateratios,torque,andRPMof transmissiongearsandfinaldrivegearsetandtracepower flowthroughthegears. Prerequisite: Completion of or concurrent enrollment in AST 251 AST 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S Prerequisite: Permission of instructor Biology BIOL 117: Oral Histology/Embryology 4 Cr Quarters: W This course is for dental hygiene students only. The study of the development and microscopic structure of the tissue in the oral cavity. Prerequisite: BIOL 230, BIOL 231, BIOL 232, and admission to the Dental Hygiene program Courses BIOL 124: Plants and Wildlife of Washington 5 Cr Quarters: O This course is intended for non-science majors seeking a lab science course. The main emphasis will be on the plants and wildlife of Washington, especially those found locally. Students will learn to recognize common species and understand the special adaptations that each organism has for survival. Other topics covered will include ecosystem processes,climate,geology,andhumaninfluences(both past and present). NOTE: Field trips are required as part of this course and often involve hiking over uneven terrain. Anyquestionsregardingfieldtripsshouldbedirectedto the instructor. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab The Biology program provides courses in introductory biology and fundamental courses preparing students for careers in allied health as well as transfer to other institutions in the life sciences. Most biology courses require lecture, laboratory work, and discussion groups. BIOL 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Workshops, short courses, and individual study in biology. BIOL 102: Environmental Biology 5 Cr Quarters: O This is an introductory environmental science course intended for non-majors. The course emphasizes the scientificmethod,principlesofecology,diversityoflife,and current natural resource issues. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab BIOL 105: Biology for Non-majors with Lab 5 Cr Quarters: O A basic course with lab in biological sciences with an emphasis on current issues, trends, and applications concerning biological concepts. This course is intended for non-majors and will not serve as a prerequisite for other biology courses. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab BIOL 107: Introduction to Plant Science 5 Cr Quarters: F An introductory course presenting principles of anatomy, morphology,physiology,andgrowthofplants.Theeffects of environmental conditions, cultural practices, and management techniques on plant growth, development, yield, and quality are discussed. Students are introduced to important crops of Washington as well as varying plant propagation and quality evaluation principles. This course is cross disciplined. Credit cannot be given for both BIOL 107 and AGSCI 101. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab BIOL 109: General Biology 5 Cr Quarters: F, W, S, SR An introductory course integrating the fundamental concepts of biology, including basic chemistry, cell biology, genetics, evolution, and energy transfers. The course is primarily for students intending to continue in dental hygiene, nursing, radiologic sciences, or veterinary technology but is not a course for biology majors. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Natural Sciences - Lab BIOL 116: Head & Neck Anatomy 3 Cr Quarters: F Broad survey of human head and neck anatomy with special emphasis on the oral cavity. Prerequisite: Enrollment in Dental Hygiene program BIOL 140: Marine Biology 5 Cr Quarters: S An introductory course with lab with an emphasis on current issues, trends, and applications concerning marine biology. Includes a survey of marine life and marine ecosystems. This course is intended for non-majors and will not serve as a prerequisite for other biology courses. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 Distribution for DTA: Natural Sciences - Lab BIOL 190: Co-op Field Experience I Variable Cr Quarters: O Cooperative education integrates the students’ classroom study with work experience in cooperating employer organizations. The students’ education is shared between employer, supervisors, and YVCC faculty. BIOL 200: Bridge to Biology for Majors 2 Cr Quarters: F This course is intended for students who have taken BIOL 109 and who wish to take the Biology Majors sequence (BIOL 211 and BIOL 221). This two-credit course covers photosynthesis, and population/genetics/evolution (topics covered in BIOL 201, but not in BIOL 109) and prepares student to enter BIOL 211 without having to take BIOL 201. Prerequisite: BIOL 109 with a C+ (2.3) or better BIOL 201: Biology I: Cells & Molecules 5 Cr Quarters: F This course is intended for transfer science majors and is thefirstinathree-quartersequence.Thetopicscoveredare the nature of biological science, evolution, energy transfer, ecology, cellular reproduction, and genetics. Prerequisite: Eligibility for ENGL& 101 and MATH 095 and completion with a C or better of 1 year of high school chemistry or concurrent enrollment or completion of CHEM 100 with a C or better or permission of instructor Distribution for DTA: Natural Sciences - Lab Yakima Valley Community College, 2015-2016 89 90 BIOL 211: Biology II: Diversity of Life 5 Cr Quarters: W This course is intended for transfer science majors and is the second in a three-course sequence in biology. The course explores the diversity of life by examining the origin of life, control of gene expression, origins of genetic diversity, genetic control of development, scaling, biomes and climate, phlogenetics and systematics, and the major lineages of life. Prerequisite: Completion with a C or better of one of the following biology pathways: BIOL 201 or BIOL 109 and BIOL 200 and successful completion of or concurrent enrollment in CHEM& 141 and CHEM& 151 or permission of instructor Distribution for DTA: Natural Sciences - Lab BIOL 232: Microbiology 5 Cr Quarters: F, W, S An overview of microorganisms (bacteria, viruses, fungi, and protozoa), including their structure, how they grow, how theyareclassified,howtheycausedisease,andhowthey are transmitted and maintained in the human population and the environment. This course is intended for students intending to continue in dental hygiene or nursing. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: CHEM 100 or one year of high school chemistry and BIOL 231 all with a grade of C (2.0) or better Distribution for DTA: Natural Sciences - Lab BIOL 221: Biology III: Organismal Physiology 5 Cr Quarters: S This course is intended for transfer science majors and is the third in a three-quarter sequence. The topics covered include anatomy and physiology of plants and animals, the relationship between form and function, and the relationship between an organism and its environment. Prerequisite: BIOL 211 with a grade of C or better and successful completion or concurrent enrollment in CHEM& 142 and CHEM& 152 or permission of instructor Distribution for DTA: Natural Sciences - Lab BIOL 297: Research in Biology Variable Cr Quarters: O This course provides undergraduate students the opportunity to engage in authentic academic research. Students will collaborate with the research instructor through all research phases, including the proposal of a research topic, selecting and implementing a research method, gathering and analyzing data, and drawing conclusionsbasedonthefindings.Studentswillthenbe expected to present, defend, and possibly publish their findings. Prerequisite: Permission of instructor BIOL 229: Anatomy & Physiology Prep Class 2 Cr Quarters: O This course is intended to prepare students for the anatomy and physiology courses BIOL 230 and 231 by teaching effectivestudyskills,reviewingimportantbiological concepts, and familiarizing students with basic histology, anatomy, and physiology. It is not a prerequisite for BIOL 230 but is intended to improve student success in BIOL 230. Prerequisite: Current enrollment in or successful completion of BIOL 109 BIOL 230: Human Anatomy & Physiology I 5 Cr Quarters: F, W, S Basic human anatomy and physiology covering histology and the integumentary, skeletal, muscular, nervous, and endocrine systems. This course is intended for students intending to continue in dental hygiene, nursing, radiologic sciences, or veterinary technology. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: BIOL 109 or BIOL 201 with a grade of C+ (2.3) or better Distribution for DTA: Natural Sciences - Lab BIOL 231: Human Anatomy & Physiology II 5 Cr Quarters: F, W, S Basic human anatomy and physiology covering the cardiovascular, immune, respiratory, digestive, urinary, and reproductive systems. This course is intended for students intending to continue in dental hygiene, nursing, or radiologic sciences. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: BIOL 230 with a grade of C (2.0) or better Distribution for DTA: Natural Sciences - Lab Yakima Valley Community College, 2015-2016 The Washington State Board for Community and Technical Collegesdefinesappliedlearning/laboratorymodesof instruction as follows: “Conduct of the instruction is continually under the direct supervision of the instructor. This mode includes learning activities in laboratories, clinics, or workplaces where students receive hands-on learning experience continually supervised by the instructor. Work is normally completed in the learning environment but may include out-of-class assignments.” Transfer Biology courses with lab may be evaluated to determine if they meet the State Board for Community and TechnicalCollegesdefinitionofappliedlearning/laboratory mode of instruction. Laboratory credit will only be given if the course included adequate hours of hands-on learning under continual and direct supervision of an instructor. Business Administration Through business and professional partnerships and student-centered education, the Business department provides career and enrichment opportunities to equip students with skills, abilities, and extended learning for the changing work environment. The department is comprised ofthreespecificareas:BusinessAdministration,Business Technology, and Information Technology. The Business Administration program is designed to equip students with basic knowledge and skills for transferring to a four-year college, entering the business workforce, or updating workplace skills. Students can select courses from a variety of business programs: accounting, businessmanagement,businessofficetechnology,and information technology. SincetheBusinessdepartmentoffersmanychoices,be sure to check each program for its degree options. Program Outcomes Upon successful completion of this program the student should be able to: • Communicateeffectivelyandefficiently,applying interpersonal and cultural awareness to business settings. • Utilize critical thinking skills to analyze and problem solve in business situations. • Apply quantitative reasoning to solve accounting and financialproblemsthatoccurinbusiness. • Identify and apply ethical principles as they relate to contemporary business organizations. • Identify and apply information tools and resources within organizations. • Explain core marketing principles and their use in managerial decision making and developing business strategy. • Understand and apply basic legal business concepts within the environment of how business is conducted. Careers Since business and its administration are the heartbeat of industry, retail sales, education, and manufacturing, career opportunities are excellent. Salaries in entry-level positions remain very competitive. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is available at the following websites: www.Access.wa.gov or www.WorkforceExplorer.com Degrees Associate of Applied Science Degrees YVCC’sBusinessAdministrationdepartmentoffersthese Associate of Applied Science degrees: • Accounting • Agribusiness • Business Management, Marketing Specialty • Business Management, Entrepreneurship Speciality Full-time students are generally able to complete a degree in approximately two years. Although many of the courses listed in these degrees are transferable, the degrees themselves are not intended to transfer to a four-year institution. Degrees are awarded upon completion of required degree courses with a minimum GPA of 2.0. Students earning an AAS degree may go on to earn a Bachelor of Applied Science (BAS) in Business Management from Yakima Valley Community College. If you are interested, check with your advisor to see how your AAS lines up with this program. Students intending to major in business and transfer to a four-year institution should pursue the Associate in Business DTAdegree(see“DegreesOffered”section). Students are strongly encouraged to contact business administration advisors for more detailed information. Note: Students are strongly advised to have word processing skills for the BA classes. While not required, it is the student’s responsibility to apply correct keyboarding skills and written communication formats. Accounting The Accounting degree option is designed to prepare students for entry-level accounting positions as full-charge bookkeepers, accounting assistants, and accounting clerks. Thisprogramoffersinstructioninaccountingprinciples combined with a general college education. Instruction in computers,officemachines,communications,andother related subjects is provided as part of the program. Required Classes Credits ACCT& 201 Principles of Accounting I 5 ACCT& 202 Principles of Accounting II 5 ACCT& 203 Principles of Accounting III 5 BA 115 Business Math 5 BA 137 Payroll/Tax Accounting 5 BA 138 Written Business Communication 5 BA 154 Computerized Accounting 5 BA 160 Supervision Techniques 5 BA 180 Consumer Financial Planning 5 BA 225 Career Management 5 BA 260 Principles of Income Tax I 5 BT 140 Electronic Business Math Applications 5 BUS& 101 Introduction to Business 5 BUS& 201 Business Law 5 ECON 101 Introduction to Economics 5 IT 100 Introduction to Computers 3 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 221 Spreadsheets Advanced 4 Approved Elective 5 Total Credits 91 Agribusiness ThisdegreeoptionisofferedjointlywiththeAgriculture department. Students will develop an understanding of basic business management and agriculture production principles which they can apply to management and operation of agribusinessfirms. For more information on this Associate of Applied Science degree, see the Agriculture department listings. Business Management The Business Management degree is designed to give students a basic background in business and an opportunity to specialize in the area of marketing or entrepreneurship, if desired. In consultation with a Business Administration program advisor, students will develop an individual training plan for the Business Management degree. The degree includes a 75-credit core plus 15 credits either from the marketing specialty, the entrepreneurship speciality, or from the approved electives list.* Check the YVCC website at www. YVCC.edu for more information on available classes. Required Classes for Business Core ACCT& 201 Principles of Accounting I ACCT& 202 Principles of Accounting II ACCT& 203 Principles of Accounting III BA 115 Business Math BA 138 Written Business Communication BA 139 Technical Writing & Presentations BA 156 Marketing BA 158 Principles of Management BA 160 Supervision Techniques Credits 5 5 5 5 5 5 5 5 5 Yakima Valley Community College, 2015-2016 91 92 BA 205 BA 225 BUS& 101 BUS& 201 ECON 101 IT 100 IT 111 Small Business Management Career Management Introduction to Business Business Law Introduction to Economics Introduction to Computers Spreadsheets Introduction Total Core Approved Electives* Total Credits Specialty: Entrepreneurship BA 105 Entrepreneurship BA 137 Payroll/Tax Accounting BA 259 Fundamentals of E-commerce Total Specialties Credits 5 5 5 5 5 3 2 75 15 90 5 5 5 15 Specialty: Marketing BA 159 Sales Management 5 BA 170 Introduction to Advertising 5 BA 259 Fundamentals of E-commerce 5 Total Specialties Credits 15 *Approved Electives for AAS degrees: Any BA, BUS&, and IT courses; BT 101, BT 140; CMST 103, CMST 280; CMST& 101, CMST& 102, CMST& 210, CMST& 220; ECON& 201, ECON& 202 Certificates Studentscanobtaincertificatesinspecializedareas of business including Accounting, Accounting Clerk, Management,Marketing,RetailManagement.Certificates are intended to assist students who plan to enter the job marketafteronlythreeorfourquarters.Certificatesare also available in Business Technology and Information Technology. See those sections for a complete list. Accounting Required Courses Credits ACCT& 201 Principles of Accounting I 5 ACCT& 202 Principles of Accounting II 5 ACCT& 203 Principles of Accounting III 5 BA 115 Business Math 5 BA 137 Payroll 5 BA 138 Written Business Communication 5 BA 225 Career Management 5 BA 260 Principles of Income Tax 5 BT 140 Electronic Business Math Applications 5 BUS& 201 Business Law 5 ECON 101 Introduction to Economics 5 IT 100 Introduction to Computers 3 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 Total Credits 62 Accounting Clerk Required Courses Credits ACCT& 201 Principles of Accounting I 5 BA 115 Business Math 5 BT 140 Electronic Business Math Applications 5 IT 100 Introduction to Computers 3 Total Credits 18 Management Required Courses BA 115 Business Math BA 138 Written Business Communication BA 158 Principles of Management BA 160 Supervision Techniques BA 205 Small Business Management BA 225 Career Management BUS& 201 Business Law IT 100 Introduction to Computers Yakima Valley Community College, 2015-2016 Credits 5 5 5 5 5 5 5 3 IT 102 IT 111 IT 221 Windows Spreadsheets Introduction Advanced Spreadsheets Total Credits 2 2 4 46 Marketing Required Courses BA 115 Business Math BA 138 Written Business Communication BA 156 Marketing BA 159 Sales Management BA 160 Supervision Techniques BA 170 Introduction to Advertising BA 225 Career Management BA 259 Fundamentals of E-commerce IT 100 Introduction to Computers IT 102 Windows IT 120 PowerPoint Total Credits Credits 5 5 5 5 5 5 5 5 3 2 2 47 Retail Management Required Courses ACCT& 201 Principles of Accounting I BA 115 Business Math BA 138 Written Business Communication BA 156 Marketing BA 157 Retail Management BA 158 Principles of Management BA 161 Human Resource Management BA 220 Human Relations in the Workplace CMST& 101 Introduction to Communication IT 100 Introduction to Computers Total Credits Credits 5 5 5 5 5 5 5 2 5 3 45 Courses Accounting ACCT& 201: Principles of Accounting I 5 Cr Quarters: F, W, S, SR Introduction to the theory and practice of accounting, includingfinancialstatements. ACCT& 202: Principles of Accounting II 5 Cr Quarters: F, W, S Depreciation, payroll taxes, partnerships, and corporations. Prerequisite: ACCT& 201 ACCT& 203: Principles of Accounting III 5 Cr Quarters: W, S, SR ACCT& 203 introduces students to the procedures and techniques with which managers use accounting information to make decisions. The course includes departmental and cost accounting. Prerequisite: ACCT& 201 and ACCT& 202 Business Administration BA 075: Pre-Business Math 5 Cr Quarters: F, W, S, SR An introduction to the study of business mathematics. Topics include integers, fractions, decimals, percents and percentages, equations, invoices, trade discounts, cash discounts, and markups and markdowns. Prerequisite: Eligibility for MATH 049C or MATH 050 BA 076: Community Service 0 Cr Prerequisite: Permission of instructor Quarters: F, W, S BA 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor BUS& 101: Introduction to Business 5 Cr Quarters: F, W, S This survey course covers the basics of business formation, industryterminology,operations,internalfunctions,conflict management, social responsibility, ethics, and corporate culture. BA 105: Entrepreneurship 5 Cr Quarters: O Thiscourseisdesignedtointroducestudentstothefield ofentrepreneurship.Studentswillexplorethedefinition of entrepreneurship and study some of the common characteristics of entrepreneurs. In addition to learning what entrepreneurs should accomplish before the organization is formed, students will identify and discover their own entrepreneurial ability. BA 115: Business Math 5 Cr Quarters: F, W, S, SR Provides students with a comprehensive study of business mathematics. Topics include solving business equations, markups and markdowns, payroll, simple interest, promissory notes, compound interest, present value, annuities, consumer and business credit, mortgages, financialstatementsandratios,inventory,depreciation,and taxes. Prerequisite: Eligibility for MATH 085 or successful completion of BA 075 BA 117: Customer Service 3 Cr Quarters: O This course explores the essentials of professionalism in thefieldofcustomerservice.Topicsincludethehistoryof the customer service profession, models of service delivery, positive verbal and nonverbal communication, active listening, behavioral styles, and the use of technology in the profession. BA 118: Customer Service II 3 Cr Quarters: O This course is a continuation of BA 117 and explores the essentialsofprofessionalisminthefieldofcustomerservice. Topicsincludecommunication,difficultsituations,customer diversity, stress management, time management, customer loyalty, service breakdowns, and the future of the profession. Prerequisite: BA 117 BA 119: Success in Sales 3 Cr Quarters: O This course will explore the concepts of selling and marketing as a factor in the distribution of goods and services with particular focus on the profession of call center sales and customer service. Prerequisite: BA 117 BA 137: Payroll/Tax Accounting 5 Cr Quarters: S This course will acquaint the student with basic payroll systems, accounting methods used in computing wages, and timekeeping systems. Prerequisite: ACCT& 201 with a grade of C or better, or permission of instructor BA 139: Technical Writing and Presentations 5 Cr Quarters: S An advanced workshop for technical writing, applying theprinciplescoveredinBA138,specificallytotechnical presentations for nontechnical audiences. The course focuses on writing styles appropriate for user manuals as wellasoralpresentations,andofferstraininginplatform skills, audiovisual technologies, and other strategies needed to make technical information understood by business managers, end-users, and the public. Prerequisite: BA 138 and IT 100 BA 154: Computerized Accounting 5 Cr Quarters: F This course covers a computerized approach to accounting systems (service and merchandising), accounts receivable, accounts payable, general ledger, payroll, and inventory. Prerequisite: ACCT& 201 with a grade of C or better, or permission of instructor BA 156: Marketing 5 Cr Quarters: F, S Covers marketing and business activities concerned with the planning of product, place, promotion, and distribution of goods and services. Fundamental principles and business cases are combined so that the students may understand more clearly the functioning of marketing in our economy and the movement of goods and services from the producer to the consumer. BA 157: Retail Management 5 Cr Quarters: S The principles and practices of retailing will be discussed. Specifictopicscoveredwillincludetypesoftraditionaland non-traditional retail outlets, franchising, policies, store location, layout, organization, buying and selling functions, pricing,profitplanning,staffing,andcontrolling. BA 158: Principles of Management 5 Cr Quarters: F, W, S This is an introductory course in modern management theory and practice. Topics include the contemporary management roles and responsibilities including planning, organizing, leading, and controlling. Subjects within these areasofstudyincludestaffing,motivating,teams,culture, change, and ethics. BA 159: Sales Management 5 Cr Quarters: S Covers selling as a factor in the distribution of goods and services, analysis of customers and their wants, getting and holding customers, and wholesale and direct-selling principles and practices. BA 160: Supervision Techniques 5 Cr Quarters: W, SR This course will examine the professional responsibilities of supervisors and managers in business and industry. Decision-makingandcommunicationeffortsrelatedto organizational productivity and employee motivation are emphasized. BA 138: Written Business Communication 5 Cr Quarters: F, W, S, SR Students in this course will learn basic techniques and approachesforwritingeffectivebusinessdocuments. Prerequisite: YVCC placement into ENGL 095 or higher Yakima Valley Community College, 2015-2016 93 94 BA 161: Human Resources Management 5 Cr Quarters: W This is an introductory course outlining the principles and procedures of personnel activites. Some of the areas of study include the competitive, legal, and global environments of HR. Other subject areas include job analysis,jobdescription,jobspecifications,employee turnover, recruitment, selection ,testing, placement, promotion, compensation, labor-management relations, and equal employment opportunities. The safety, health, and well-being of employees are also discussed. BA 170: Introduction to Advertising 5 Cr Quarters: S A comprehensive introduction to the principles of advertising. Concepts covered will include the role of advertisingintheeconomy,itsinfluenceonsociety,and characteristics and use of various media. Also included are the appropriate strategies used to plan and create an effectiveadvertisingcampaign. BA 180: Consumer Financial Planning 5 Cr Quarters: S The course focuses on personal money management and consumerfinancialeducation.Topicsarebudgets,loansand consumer credit, bank services, life and casualty insurance, homepurchaseandfinancing,incometaxpreparation, savings and investments, and consumer purchases. Students notpursuingadegreeorcertificatemayenrollinthecourse on a pass/fail basis. BA 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Cooperative eduction integrates the student’s classroom study with work experience in cooperating employer organizations. Students usually alternate periods of college study with extended employment periods in appropriate fieldsofbusiness,industry,government,socialservices,and the professions. The student’s education, therefore, is shared between the employer, supervisors, and YVCC faculty. Prerequisite: Permission of instructor BA 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in business administration. BUS& 201: Business Law 5 Cr Quarters: F, W, S, SR This course is a study of the American legal system as it pertains to business transactions. Topics include formation and performance of contracts, sales, business entities, real property, agency, employer/employee relations, and legal responsibilities. Prerequisite: Successful completion of a minimum of 24 collegelevel credits, 2.0 GPA or better, or permission of instructor BA 205: Small Business Management 5 Cr Quarters: W This course is for students who either have already started a business or who intend to work for a small business. The course pulls together concepts of marketing, operations, and financialmanagementforsmallbusinesses.Itwillbebased on current research, theory, and practice. Materials will be presented from a “how-to” perspective, with many practical examples and applications from the business world. Yakima Valley Community College, 2015-2016 BA 220: Human Relations in the Workplace 2 Cr Quarters: W, S This course explores how the employment requirements of business,agribusiness,andindustryinfluencetheeducation and training of individuals. Professional expectations in the workplace, career and life goals, and the balance of work-life issues within a formal organization are emphasized. BA 225: Career Management 5 Cr Quarters: F, W, S This course explores areas of personal and professional development crucial for success in the student’s selected careerfields.Topicsincludedevelopingconfidence,effective communication, analyzing strengths and weaknesses, goal setting, managing time, working within a team setting, workingthroughconflict,andtheemploymentseeking process. BA 256: Statistics 5 Cr Quarters: F, W, S, SR This introductory course applies descriptive and inferential statistical methods and probability theory to common business and economic situations. The development of analytical problem-solving skills is also emphasized. Prerequisite: Math 094 or 095 or permission of instructor BA 259: Fundamentals of E-commerce 5 Cr Quarters: F The purpose of this course is to provide students with the tools and technologies needed for electronic commerce. Business opportunities, challenges, and strategies for use of the information superhighway will be explored. Electronic commerce technology will be introduced. Prerequisite: Competency in the Windows environment and internet basics BA 260: Principles of Income Tax 5 Cr Quarters: W This course is an introduction to the U.S. federal income taxation of individuals. Stress is placed on the U.S. tax structure and tax reporting. Prerequisite: ACCT& 201 or permission of instructor BA 270: Business Ethics 3 Cr Quarters: F, S An examination of the ethical challenges facing individuals and businesses in modern society. The course will use case studies of professionals working in various areas of business as well as the moral reasoning of ethics. BA 275: Wine Marketing 5 Cr Quarters: W Provides a study of wine marketing and sales from the perspective of the Washington State wine industry. The course examines industry standards and emerging trends relating to wine packaging, promotion, pricing, and distribution. Emphasizes strategic branding, consumer behavior, and marketing plans for wineries and wine products. Recommended: BA 156 BA 280: Fundamentals of Investing 3 Cr Quarters: O This course is intended to provide students with the fundamental knowledge necessary for making wise investment decisions. Topics covered include how free markets work; stocks and bonds; economic indicators; diversification,assetallocation,risk,andtime;tax-deferred investing;andsourcesoffinancialinformation. BA 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Work experience in cooperating employer organizations. Students usually alternate periods of college study with extendedemploymentperiodsinappropriatefieldsof business, industry, government, social services, and the professions. The student’s education, therefore, is shared between the employer, supervisors, and YVCC faculty. Prerequisite: Permission of instructor Business Technology The Business Technology (BT) program provides an interactive business and professional partnership to enhancestudent-centerededucationforcareeroffice opportunities that match business needs to student outcomes. Program faculty members constantly update curriculumandcourseofferingstomeetstudentand industry needs. Bilingual degrees are also available. Most classesareoffereddailyintheclassroomorinacombination ofonlineandclassroom;afewareofferedentirelyonline. The objective of the Business Technology (BT) program istopreparestudentstoentervariousofficepositions.The BTprogramoffersthefollowingAssociateofAppliedScience degrees: • Business Technology - Administrative Assistant • BusinessTechnology-BilingualAdministrativeOffice Assistant • BusinessTechnology-LegalOfficeAssistant • BusinessTechnology-BilingualLegalOfficeAssistant • BusinessTechnology-MedicalOfficeAssistant • BusinessTechnology-BilingualMedicalOfficeAssistant While obtaining one of these degrees, students will learn the following skills: typing, ten-key electronic math, word processing,filing,officeprocedures,spelling,andEnglish grammar. Teamwork, critical thinking, problem solving, and human relations are a focus of the program and are integrated into the curriculum. Certificatesarealsoavailablethatleadtoward employment and can be a pathway to one of the BT Associate ofAppliedSciencedegrees.Currentcertificatesavailable include: • BusinessTechnology-BilingualOfficeAssistant(70 Credits) • BusinessTechnology-GeneralOfficeAssistant(65 Credits) • Business Technology - Legal Receptionist (15 Credits) • Business Technology - Medical Receptionist (15 Credits) Toobtainacertificateordegree,studentsmustearnat least a grade of C- (1.7) in all required classes. The degree or certificatewillbeawardediftheoverallGPAfortherequired classes is a 2.0 (C) or higher. Courses taken outside the degreeorcertificaterequirementsarenotconsideredinthe 2.0 (C) GPA or C- (1.7) requirements. Additionally, students must complete the keyboarding competencyof45wpm(wordsperminute)forfiveminutes with four or fewer errors in order to be awarded an Associate in Applied Science degree in BT. Students who do not meet the keyboarding competency will be eligible for a BT certificate.Certificateapplicantsdonotneedtomeetthis keyboarding competency. Students may take BT 103 twice in order to met their competency. AllBTdegreeandcertificatestudentsshouldcompleteBT 100 before enrolling in their 21st credit toward a BT degree or certificate. Studentsshouldbeawarethatlegalandmedicaloffices often require criminal background checks. Program Outcomes Upon successful completion of this program, the student should be able to: • Type by touch. • Use the 10-key appropriately to solve a variety of business-related math calculations. • Use Microsoft Word to prepare various documents to include correspondence, mail merge, tables, charts, and reports. • UsetheMicrosoftOfficeSuitetocompleteavarietyof officetasks. • Compose and transcribe basic business Yakima Valley Community College, 2015-2016 95 96 • • correspondence using appropriate business English and spelling. Demonstrateroutineofficeproceduressuchasfiling, answering the phone and taking messages, greeting customers, and customer service. Apply appropriate soft skills related to teamwork, critical thinking, problem solving, and human relations. Degrees Business Technology - Administrative Assistant The Administrative Assistant degree option is designed topreparestudentsforemploymentinavarietyofoffice settingssuchasinsuranceoffices,educationalservices, governmentoffices,orprivately-ownedbusinesses. Required Courses Credits ACCT& 201 Principles of Accounting I 5 BA 138 Written Business Communication 5 BA 158 Principles of Management 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT 260 Word Processing 5 BT 270 Integrated Business Applications II 5 BT272 OfficeProcedures 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 BT 290-293 Advanced Co-op Field Experience 2 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 IT 221 Spreadsheets Advanced 4 IT 222 Outlook 2 Approved Electives 5 Total Degree Credits 93 Business Technology - Bilingual Administrative Office Assistant TheBilingualAdministrativeOfficeAssistantdegreeis designed to prepare students for employment in a variety ofbilingualofficesettingssuchasinsuranceoffices, educationalservices,governmentoffices,orprivately-owned businesses. Required Courses Credits ACCT& 201 Principles of Accounting I 5 BA 138 Written Business Communication 5 BA 158 Principles of Management 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT 260 Word Processing 5 BT 270 Integrated Business Applications II 5 BT272 OfficeProcedures 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 BT 290-293 Advanced Co-op Field Experience 2 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 IT 222 Outlook 2 Native Spanish Speakers Yakima Valley Community College, 2015-2016 SPAN 231 Second-Year Spanish for Professional Speaking 5 SPAN 232 Second-Year Spanish for Academic Writing 5 SPAN 233 Second-Year Spanish for Academic Reading 5 Native English Speakers SPAN 201 Spanish I Second Year** 5 SPAN 202 Spanish II Second Year** 5 SPAN 203 Spanish III Second Year** 5 Total Degree Credits 99 Business Technology - Bilingual Legal Office Assistant Required Courses Credits ACCT& 201 Principles of Accounting I 5 AH 119 Medical Terminology 5 BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT250 LegalOfficeTechnology 5 BT251 LegalOfficeProcedures 5 BT 260 Word Processing 5 BT 270 Integrated Business Applications II 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 BT 290-293 Advanced Co-op Field Experience 2 BUS& 201 Business Law 5 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 Native Spanish Speakers SPAN 231 Second-Year Spanish for Professional Speaking 5 SPAN 232 Second-Year Spanish for Academic Writing 5 SPAN 233 Second-Year Spanish for Academic Reading 5 Native English Speakers SPAN 201 Spanish I Second Year** 5 SPAN 202 Spanish II Second Year** 5 SPAN 203 Spanish III Second Year** 5 Total Degree Credits 107 Business Technology - Bilingual Medical Office Assistant TheBilingualMedicalOfficeAssistantdegreeisdesigned to prepare students for a variety of bilingual careers in the medicalfieldsuchasmedicaloffices,clinics,andhospitals. Required Courses Credits AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AHBC 101 Introduction to Medical Coding 3 AHBC 102 Introduction to Medical Billing 2 AHBC 121 Health Care Reimbursement Issues I 3 AHBC 133 ICD-10-CM Coding 3 BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT 260 Word Processing 5 BT272 OfficeProcedures 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 BT 290-293 Advanced Co-op Field Experience 2 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 Native Spanish Speakers SPAN 231 Second-Year Spanish for Professional Speaking 5 SPAN 232 Second-Year Spanish for Academic Writing 5 SPAN 233 Second-Year Spanish for Academic Reading 5 Native English Speakers SPAN 201 Spanish I Second Year** 5 SPAN 202 Spanish II Second Year** 5 SPAN 203 Spanish III Second Year** 5 Total Degree Credits 108 Business Technology - Legal Office Assistant TheLegalOfficeAssistantdegreeisdesignedtoprepare students to work in a variety of legal settings such as law firms,realestateorgovernmentoffices,aswellasthecourt system. Required Courses Credits ACCT& 201 Principles of Accounting I 5 AH 119 Medical Terminology 5 BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT250 LegalOfficeTechnology 5 BT251 LegalOfficeProcedures 5 BT 260 Word Processing 5 BT 270 Integrated Business Applications II 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 BT 290-293 Advanced Co-op Field Experience 2 BUS& 201 Business Law 5 CJ& 110 Criminal Law 5 or CJ 111: Criminal Evidence IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 IT 222 Outlook 2 Total Degree Credits 99 Business Technology - Medical Office Assistant TheMedicalOfficeAssistantdegreeisdesignedtoprepare studentsforcareersinthemedicalfieldworkinginmedical offices,clinics,andhospitals. Required Courses Credits AH 110 Human Body in Health & Disease I 5 AH 119 Medical Terminology 5 AH 120 Human Body in Health & Disease II 5 AHBC 101 Introduction to Medical Coding 3 AHBC 102 Introduction to Medical Billing 2 AHBC 121 Health Care Reimbursement Issues I 3 AHBC 133 ICD-10-CM Coding 3 BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 170 Integrated Business Applications I 5 BT 260 Word Processing 5 BT 270 BT272 BT 273 BT274 BT 290-293 IT 102 IT 111 IT 115 IT 120 IT 222 Integrated Business Applications II 5 OfficeProcedures 5 Transcription & Document Processing 5 OfficeDynamics 5 Advanced Co-op Field Experience 2 Windows 2 Spreadsheets Introduction 2 Database Introduction 2 PowerPoint 2 Outlook 2 Total Degree Credits 100 *BT 103 is required for students who do not meet the keyboarding competency (45 wpm/5 min./4 or fewer errors) in BT 102. Students may take the class twice. If the competency is still not met after taking the class twice, studentswillbeeligibleforaCertificateinGeneralOffice instead of the Associate of Applied Science degree. **These courses are currently unavailable at YVCC . At the time of printing, these classes are available at Lower Columbia Community College. See your BT advisor. ***Students must complete BT 100 before enrolling in their 21stcredittowardaBTdegreeorcertificate. Certificates Business Technology - Bilingual Office Assistant Required Courses Credits BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 260 Word Processing 5 BT272 OfficeProcedures 5 BT274 OfficeDynamics 5 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 Native Spanish Speakers SPAN 231 Second-Year Spanish for Professional Speaking 5 SPAN 232 Second-Year Spanish for Academic Writing 5 SPAN 233 Second-Year Spanish for Academic Reading 5 Native English Speakers SPAN 201 Spanish I Second Year** 5 SPAN 202 Spanish II Second Year** 5 SPAN 203 Spanish III Second Year** 5 Total Credits 70 Business Technology - General Office Assistant Required Courses Credits ACCT& 201 Principles of Accounting I 5 BA 138 Written Business Communication 5 BT 100 Introduction to Business Technology*** 2 BT 102 Intermediate Keyboarding* 5 BT 130 Basic Business Essentials 5 BT131 OfficeReferenceProceduresI 5 BT132 OfficeReferenceProceduresII 5 BT 140 Electronic Business Math Applications 5 BT 260 Word Processing 5 BT272 OfficeProcedures 5 BT 273 Transcription & Document Processing 5 BT274 OfficeDynamics 5 IT 102 Windows 2 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 Total Credits 65 Yakima Valley Community College, 2015-2016 97 98 Business Technology - Legal Receptionist Required Courses BT 102 Intermediate Keyboarding BT131 OfficeReferenceProceduresI BT250 LawOfficeTechnology Total Credits Credits 5 5 5 15 Business Technology - Medical Receptionist Required Courses Credits AH 119 Medical Terminology 5 BT 101 Beginning Keyboarding 5 BT131 OfficeReferenceProceduresI 5 Total Credits 15 *BT 103 is required for students who do not meet the keyboarding competency (45 wpm/5 min./4 or fewer errors) in BT 102. Students may take the class twice. If the competency is still not met after taking the class twice, studentswillbeeligibleforaCertificateinGeneralOffice instead of the Associate of Applied Science degree. **These courses are currently unavailable at YVCC . At the time of printing, these classes are available at Lower Columbia Community College. See your BT advisor. ***Students must complete BT 100 before enrolling in their 21stcredittowardaBTdegreeorcertificate. Courses BT 098, 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in business technology. BT 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor BT 100: Introduction to Business Technology*** 2 Cr Quarters: F, W Students will be introduced to a variety of Business Technology career topics that will be covered in more depth through various required courses. These topics include: skill requirements, diversity and sensitivity, business ethics, wardrobe development, work ethic, and oral and written communication requirements. BT 101: Beginning Keyboarding 5 Cr Quarters: F, W, S, SR This course is an introduction to keyboarding by touch. The course also explores basic document development and focuses on developing speed and accuracy using word processing software. BT 102: Intermediate Keyboarding* 5 Cr Quarters: F, W, S Students will be prepared in the development of speed, accuracy, and production keyboarding using proper keyboarding and word processing techniques. (BT 103 is required for BT degree candidates who do not meet the keyboarding competency (45 wpm/5 min./4 or fewer errors) in BT 102. Students may take the class twice. If the competency is still not met after taking the class twice, studentswillbeeligibleforaCertificateinGeneralOffice instead of the Associate of Applied Science Degree.) Prerequisite: BT 101 with a grade of C- (1.7) or better or high school equivalent BT 103: Keyboarding Competency* 3 Cr Quarters: F, W, S Students will be prepared in the development of keyboarding speed and accuracy. Prerequisite: BT 102 with a grade of C- (1.7) or better or equivalent Yakima Valley Community College, 2015-2016 BT 121: Human Relations 4 Cr Quarters: O Students will study personnel management, teamwork, leadership, and the link between human relations skills and communications skills. BT 122: Ten-Key Calculator 2 Cr Quarters: O This course provides a thorough review of basic arithmetic operations, addition, subtraction, multiplication, and division for electronic calculators. Students will develop ten-key, touch method techniques for operating calculators and will complete numerous application problems. BT 123: Recordkeeping 5 Cr Quarters: O Students will learn principles and procedures of payroll, accounts receivable, and accounts payable to include control, methods, and systems of recordkeeping management. Prerequisite: BT 122 BT 124: Office Applications 5 Cr Quarters: O Students will learn proper punctuation, communication methods, and written language skills to use in job search as they prepare their resumes, cover letters, and thankyou letters. They will practice interview techniques as well as the correct responses to interview questions. Practice willbeprovidedintelephoneetiquetteandfilingpractices employeeswillneedinaproductivebusinessoffice. Prerequisite: BT 127 BT 125: Learning the Keyboard 2 Cr Quarters: O This course introduces keybaording by touch and explores techniques for improving speed and accuracy using document processing software. BT 126: Keyboarding Document Format 3 Cr Quarters: O This course introduces the development of language artsandappropriatedocumentformattingtoeffectively communicate with keyed business documents. This course continues to emphasize speed and accuracy. Prerequisite: BT 125 BT 127: Intermediate Keyboarding I* 3 Cr Quarters: O Students will receive practice in the development of keyboarding speed, accuracy, and production formatting of documents using document and word-processing software. Prerequisite: BT 126 BT 128: Intermediate Keyboarding II* 2 Cr Quarters: O Students will continue to develop keyboarding speed and accuracy and develop more advanced formatting of documents using document and word processing software. Prerequisite: BT 127 BT 130: Basic Business Essentials 5 Cr Quarters: F, W Students will be introduced to business vocabulary and morestohelpbecomeproficientinusingterminologyand pronunciationprevalentinbusinessoffices.Emphasiswill include speaking, listening, reading, and writing. Prerequisite: Eligibility for ENGL 090T Recommended: Successful completion of or concurrent enrollment in BT 101 BT 131: Office Reference Procedures I 5 Cr Quarters: F, S Students will practice using various resources to produce correct business documents. This course will cover correct usage of commas, semi-colons, colons, hyphens, capitalization, and numbers. Prerequisite: Eligibility for ENGL 095 Recommended: Successful completion of or concurrent enrollment in BT 101 BT 132: Office Reference Procedures II 5 Cr Quarters: F, W Students will continue to use various resources to correctly produceandfilebusinessdocuments.Documentswillbe produced through multiple phases: composing, editing, proofreading,mailing,filing,andretrieving.Studentsare expected to apply the rules and processes presented in BT 131. Prerequisite: BT 131 with a grade of C- (1.7) or better and completion of BT 101 or equivalent BT 140: Electronic Business Math Applications 5 Cr Quarters: F, S This course provides a thorough review of basic arithmetic (fundamental operations, multiplication and division, estimation, special functions and operations with electronic calculators, the metric system, and business and consumer economics application problems for electronic calculators), careful introductions to principles, self-assessments and branching instructions, guidelines for operating calculators, and numerous application problems. Prerequisite: BA 075 with a grade of C (2.0) or better or equivalent YVCC placement BT 160: Word Processing Short Course 2 Cr Quarters: F, W, S, SR Studentswilllearntocreate,save,andmodifyfilesand to produce attractive documents while at the same time learning how this word processing software works. Recommended: BT 101 or equivalent BT 161: Word Processing Completion Course 3 Cr Quarters: F, W, S Students will master the beginning features and commands of Microsoft Word to perform word processing projects on a job. Students will build on the skills learned in the Introduction to Word Processing class (BT 160) as they create tables and charts, apply styles, and complete mail merge documents. Prerequisite: BT 160 with a grade of C- (1.7) or better BT 170: Integrated Business Applications I 5 Cr Quarters: F, S IntegratedBusinessApplicationsIusesMicrosoftOffice applications: word processing, spreadsheets, database, electronic presentations, e-mail, fax, internet, and the web to prepare students for the project-based activities of Integrated Business Applications II. Prerequisite: BT 102, BT 260, IT 111, IT 115, and IT 120 BT 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Cooperative education integrates the student’s classroom study with work experience in cooperating employer organizations. Students usually alternate periods of college study with extended employment periods in appropriate fieldsofbusiness,industry,government,socialservices,and the professions. The student’s education, therefore, is shared between the employer, supervisors, and YVCC faculty. Prerequisite: Permission of instructor BT 250: Legal Office Technology 5 Cr Quarters: W Students will prepare various legal documents using the appropriate legal procedures, legal terminology, and technologiesprevalentinlegaloffices.Studentswillbeusing two word processing software applications. Students will strive to reach and retain a production keyboarding speed of55wordsperminutewithfourorfewererrorsonafiveminute timed write. Prerequisite: BT 102 and BT 131 BT 251: Legal Office Procedures 5 Cr Quarters: S Students will prepare various legal documents while applying proceduresusedinthelegalofficetoday.Studentswill also apply correct legal terminology while conducting legal research. Prerequisite: BT 250 BT 260: Word Processing 5 Cr Quarters: F, W, S Students will master the use of beginning features and commands of Microsoft Word that will be needed to perform word processing projects on a job. Prerequisite: BT 102 with a grade of C- (1.7) or better BT 270: Integrated Business Applications II 5 Cr Quarters: F, S This course consists of project-based, in-basket activities usingadvancedintegratedMicrosoftOfficesoftware. Students are expected to complete a variety of simulated officeactivitiestodemonstratecomprehensionofuseof MicrosoftOfficeapplications. Prerequisite: BT 170 and either BT 131 or BA 138 BT 272: Office Procedures 5 Cr Quarters: W Students will apply procedures for scheduling, making travel arrangements,telephoneetiquette,inter-officerelations, andcustomerrelationsfortheoffice.Studentswilldevelop organizational skills, work habits, and human relations as theyprepareforofficepositions. Prerequisite: BT 102, BT 132, and IT 111 BT 273: Transcription and Document Processing 5 Cr Quarters: F, W Students will obtain the necessary skills to apply the correct document processing feature and format when transcribing avarietyofofficedocuments.Studentswillalsostrengthen their grammar and punctuation usage skills. Prerequisite: BT 102 and BT 131 BT 274: Office Dynamics 5 Cr Quarters S This course explores areas of personal and professional development helpful for career success. Topics include the employment-seeking process; discovering values, directions, and goals; analyzing personal strengths and weaknesses; managingtime;developingconfidence;fittingintoan organization;managingfinances;anddealingwithoffice politics. Prerequisite: BT 102, BT 130, BT 132 all with a grade of C- (1.7) or better Yakima Valley Community College, 2015-2016 99 100 BT 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: O Cooperative education integrates the student’s classroom study with work experience in cooperating employer organizations. Students usually alternate periods of college study with extended employment periods in appropriate fieldsofbusiness,industry,government,socialservices,and the professions. The student’s education, therefore, is shared between the employer, supervisors, and YVCC faculty. Prerequisite: Permission of instructor Chemical Dependency Studies The Chemical Dependency Studies department is committed to serving a diverse community of students. The department values and emphasizes student-centered learning as well as lifelong learning and fosters community partnerships. The Chemical Dependency (CD) Studies program is committed to preparing a diverse population of students to workinthefieldofchemicaldependencycounseling.The program values and emphasizes student-centered learning, fosters community partnerships, and is dedicated to offeringessentialskillstoempowerstudentsforsuccessful, professional career placement. Theprogramofferstwocoursesofstudy;anAssociate of Applied Science degree in Chemical Dependency Studies andacertificateprogramforpersonswhoalreadyhavea minimum of either a two-year degree or 35 college credits. Program Outcomes Upon successful completion of this program the student should be able to: • Begin training in the workforce as interns in the chemicaldependencyfield. • Communicateeffectively,applyinginterpersonal skills and cultural awareness to addiction treatment settings. • Utilizewell-definedprofessionalskillstoperformbasic procedures and approaches to help patients heal. • Understand and communicate the history and evolutionoftheaddictiontreatmentfield. • Utilize and refer to community resources available to thosesufferingfromchemicaladdiction. Careers Studentsmaystartworkinginthefield,completingthe experience component, prior to completing the educational componentforcertificationasaChemicalDependency Professional. Graduates from the Chemical Dependency Studies program at YVCC should be prepared to meet Washington State’s educational requirements for Department of Health certificationasChemicalDependencyProfessionals. Career options include employment in alcohol and drug treatment facilities, hospitals, correctional institutions, employee assistance programs, other community socialservice agencies, and as school counselors. Degrees Associate of Applied Science in Chemical Dependency Required Courses Credits CD 160 Survey of Chemical Dependency 5 CD 170 CD and Health 2 CD 180 Co-occurring Disorders in CD Counseling 2 CD 250 Youth CD Assess and Counseling 5 CD 260 CD and the Family 3 CD 261 Physio Actions of Alcohol & Drugs 3 CD 262 CD and the Law 3 CD 263 Case Manage and Recordkeeping 4 CD 264 Ethics for CD Counselors 3 CD 270 CD Counseling Techniques 5 CD 271 Group Process in CD Treatment 5 CMST& 220 Introduction to Public Speaking 5 ENGL& 101 English Composition I 5 ENGL 102 English Composition II 5 ETHS 101 American Ethnic Minorities 5 BA 115 Business Math 5 PSYC& 100 General Psychology 5 PSYC& 200 Lifespan Psychology 5 Total Required Credits 75 Approved Electives 15 Total Credits 90 Yakima Valley Community College, 2015-2016 Certificates Certificate in Chemical Dependency Studies Personseligibleforthiscertificatemustcompleteallofthe following courses and have already earned a minimum of a two-year degree or have earned an additional 35 collegelevel credits. Required Courses Credits CD 160 Survey of Chemical Dependency 5 CD 170 CD and Health 2 CD 180 Co-occurring Disorders in CD Counseling 2 CD 250 Youth CD Assess & Counseling 5 CD 260 CD and the Family 3 CD 261 Physio Actions of Alcohol & Drugs 3 CD 262 CD and the Law 3 CD 263 Case Manage and Recordkeeping 4 CD 264 Ethics for CD Counselors 3 CD 270 CD Counseling Techniques 5 CD 271 Group Process in CD Treatment 5 ETHS 101 American Ethnic Minorities 5 PSYC& 100 General Psychology 5 PSYC& 200 Lifespan Psychology 5 Total Credits 55 Admission Program Standards All persons admitted to the Chemical Dependency Studies program or taking courses in the program are expected to comply with the following standards: 1. Abstinence from the misuse of alcohol and other chemical substances. 2. No alcohol or other drug use (except drugs prescribed by a physician) immediately prior to attendance in CD studies program classes or assignments. 3. Persons in recovery from addiction must remain free of alcohol and other drugs (except those drugs prescribed by a physician) at all times. Department of Health Certification CertificationasaChemicalDependencyProfessionalby the Department of Health is threefold. Persons must meet an educational requirement, an experience requirement, and must pass an exam administered by the Department of Health.Thisprocessisgovernedbylaw,specificallyChapter 246-811 of the Washington State Administrative Code (WAC). Graduates from the Chemical Dependency Studies program at YVCC will meet Washington State’s educational requirementsforDepartmentofHealthcertificationasa Chemical Dependency Professional. The experience component of the WAC requires persons toworkunderthesupervisionofacertifiedChemical Dependency Professional. The number of hours required during the experience component is dependent upon one’s level of formal education. The experience component is not completed at YVCC, nor is it part of the curriculum of the Chemical Dependency Studies program. Washington State Background Check Employers may require a Washington State background check as a condition of employment. Information received as a result of the background check may determine employment eligibility. Courses CD 160: Survey of Chemical Dependency 5 Cr Quarters: F A basic survey course covering the history of addiction treatment and recovery in America. Coursework will cover the evolution of addiction treatment with emphasis on current research and treatment methodology. CD 170: Chemical Dependency and Health 2 Cr Quarters: W A survey of health issues of particular interest to the chemical dependency professional. Basic information about various infectious and noninfectious diseases will be discussed. Topics will include HIV/AIDS, TB, hepatitis, FAS/FAE Syndrome, and others. CD 180: Co-occurring Disorders in CD Counseling 2 Cr Quarters: F A course to help chemical dependency professionals effectivelymeetthediverseandcomplexneedsofclients who are Mentally Ill and Chemically Abusing (MICA). Mental health diagnosis, the Diagnostic and Statistical Manual IV criteria, medications, referral, and community resources will be reviewed. Emphasis will be on how to work collaboratively with other health-care professionals. CD 250: Youth CD Assessment & Counseling 5 Cr Quarters: SR This course is a basic review of adolescent chemical use and dependency. Assessment tools and counseling techniques specifictoyouthwillbeexplored.Areasoffocuswillinclude the impact substance use has on adolescent development, maladaptive stress responses, low frustration tolerances, and compulsive disorders. CD 260: Chemical Dependency & Family 3 Cr Quarters: S Anin-depthlookattheeffectsofchemicaldependency on both the individual and the family. The development of unhealthy behavioral patterns in the family will be studied as well as how family members seek to cope and prevent destruction of the family. Treatment options will be examined. CD 261: Physiological Actions of Alcohol and Drugs 3 Cr Quarters: F This course explores Addiction Disorders including but not limited to: substance use and behavioral addictions, thehistoryandclassificationofpsychoactivesubstances, thephysicalandpsychologicaleffectsofpsychoactive substances, the progression of addiction disorder, physiology of the brain as it relates to addictions, the complexity of co-occurring disorders and in-depth discussions of behavioral health treatment models. CD 262: CD & The Law 3 Cr Quarters: S A survey course covering historical and social antecedents and laws from the earliest known times to the present as they relate to chemical dependency. Current laws and regulations applicabletothefieldofchemicaldependencytreatment will be studied, including an overview of DUI-deferred prosecution, drug courts, and an analysis of privacy and confidentialityregulations. CD 263: Case Management & Record Keeping 4 Cr Quarters: W Students will practice the necessary skills for and become familiar with the professional tools for documentation and record-keeping activities in a chemical dependency treatment facility. The principles of treatment planning of the American Society of Addiction Patient Placement Criteria will be examined. Prerequisite: CD 160 or permission of program advisor Yakima Valley Community College, 2015-2016 101 102 CD 264: Chemical Dependency Ethics 3 Cr Quarters: W Teaches the student to understand health care ethics and the skills that support ethical practice among chemical dependency professionals. Violations of ethical practice are characterized by the potential for misuse of power and influence.Utilizinglectures,roleplaying,andguestspeakers, students will establish parameters of behavior that promote the responsible use of leadership. CD 270: Chemical Dependency Counseling Techniques 5 Cr Quarters: S A course to provide persons with an opportunity to learn basic chemical dependency interviewing and counseling skills. Prerequisite: CD 160 or permission of program advisor CD 271: Group Process in Chemical Dependency Training 5 Cr Quarters: SR Techniques used for basic alcoholism and drug addiction counseling will be presented and demonstrated. These skills will involve the elements of a counseling relationship, the problem-solving process, crisis intervention, and approaches unique to addiction counseling. Prerequisite: CD 270 CD 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in chemical dependency. Chemistry Chemical substances are the very building blocks of life, and, as such, the study of chemistry provides insight into mostscientificareasofstudy.CoursesatYVCCaredesigned tosupportstudyinalliedhealthfieldsaswellasprovidea foundation for further study in chemistry. Courses CHEM 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor CHEM 100: Introduction to Chemistry 5 Cr Quarters: F, W, S, SR Designed to acquaint the non-science major with chemical principles and serve as the prerequisite for those students wishing to continue with CHEM 109 or CHEM& 141, but who have not had high school chemistry. CHEM 100 is a onequarter introduction to chemistry. The instruction methods include lecture, small group discussion, and presentation. 5 lecture hours, no lab. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: MATH 084 or 085 or YVCC placement into MATH 095 or above Distribution for DTA: Natural Sciences CHEM 109: Principles of Chemistry Lecture 4 Cr Quarters: F, W, S CHEM 110: Principles of Chemistry Lab 1 Cr Quarters: F, W, S A one-quarter survey of the principles of general chemistryincludingscientificmethod,atomicstructure, chemical bonding, periodic properties, physical states of matter, solutions, acids/bases, and nuclear chemistry. The instruction methods consist of lecture, small group discussion, class presentation, and individual and team experiments. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Prerequisite: CHEM 100 or one year of high school chemistry and MATH 085 or placement into MATH 095 and concurrent enrollment in CHEM 109 and CHEM 110 Distribution for DTA: Natural Sciences - Lab CHEM& 110: Chemical Concepts with Lab 5 Cr Quarters: F/W/S An introduction to chemical principles for non-science major. This topic-based course with the topic varying each quarter will be used to introduce the student to chemistry, the scientificmethod,anddataanalysis. Prerequisite: Eligibility for MATH 084 or MATH 085 and eligibility for ENGL 095. Distribution: Natural Science - Lab CHEM& 139: General Chemistry Preparation 5 Cr Quarters: F/S This is an introduction to chemical principles and calculations for student who have not had a year of high school chemistry and who are intending on becoming science majors. This will prepare student to take general chemistry (CHEM& 141). Prerequisite: Eligibility for MATH 095 Distribution for DTA: Natural Sciences Yakima Valley Community College, 2015-2016 CHEM& 141: General Chemistry I Lecture 3 Cr Quarters: F, W CHEM& 151: General Chemistry I Lab 2 Cr Quarters: F, W Thefirstquarterofathree-quartersequenceingeneral chemistry for science and engineering majors. The topics include the atomic nature of matter, atomic structure and subatomic particles, quantum concepts, the electromagnetic spectrum, the periodic table and periodic trends, types of bonding, Lewis structures, molecular geometry, hybridization, molecular orbitals, and chemical equations. The instruction methods consist of lecture, small group discussion and problem solving, and class presentation during three one-hour lecture sessions per week. Students must register for both CHEM& 141 and CHEM& 151. Prerequisite: CHEM 100 or one year of high school chemistry and concurrent enrollment in MATH 095 or YVCC placement into MATH& 141 and concurrent enrollment in CHEM& 141 and CHEM& 151 Distribution for DTA: Natural Sciences - Lab CHEM& 142: General Chemistry II Lecture 3 Cr Quarters: W, S CHEM& 152: General Chemistry II Lab 2 Cr Quarters: W, S The second quarter of a three-quarter sequence in general chemistry for science and engineering majors. The topics include solutions, thermodynamics, chemical kinetics, chemical equilibrium, and acid-bases. The instruction methods consist of lecture, occasional small-group work, individual and team experiments during three one-hour lecture sessions and two two-hour laboratory sessions per week. Students must register for both CHEM& 142 and CHEM& 152. Prerequisite: CHEM& 141 and CHEM & 151 or equivalent and concurrent enrollment in CHEM& 142 and CHEM& 152 Distribution for DTA: Natural Sciences - Lab CHEM& 143: General Chemistry III Lecture 3 Cr Quarters: F, S, SR The third quarter of a three-quarter sequence in general chemistry for science and engineering majors. Topics include electrochemistry, nuclear chemistry, descriptive chemistry of the elements, and complex formation. The instruction methods include lecture and occasional small-group work. Prerequisite: CHEM& 142 and CHEM& 152 or equivalent Distribution for DTA: Natural Sciences CHEM& 153: General Chemistry III Lab 2 Cr Quarters: F, S, SR The lab portion of a three-quarter sequence in general chemistry for science and engineering majors. Topics include descriptive chemistry of the elements, complex formation, semi-micro qualitative analysis for common cations, and quantitative analysis by colorimetric titration. Instruction methods include small-group work. Prerequisite: CHEM& 142 and CHEM& 152 or equivalent Distribution for DTA: Natural Sciences CHEM 190: Co-op Field Experience Variable Cr Quarters: O Cooperative education integrates the student’s classroom study with work experience in cooperating employer organizations. The student’s education is shared between employer, supervisors, and YVCC faculty. CHEM 209: Introduction to Organic/Biochemistry Lecture 4 Cr Quarters: F, W, S CHEM 210: Introduction to Organic/Biochemistry Lab 1 Cr Quarters: F, W, S This is a one-quarter survey of organic chemistry with an introduction to metabolic pathways. The instruction methods include lecture, small-group discussion, class presentation, and individual and team experiments. Students are allowed to repeat this course only once. See the High Demand Course Repeat Rule. Students must register for both CHEM 209 and CHEM 210. Prerequisite: CHEM 109 and CHEM 110 or equivalent or CHEM& 142 and CHEM& 152 and concurrent enrollment in CHEM 209 and CHEM 210 Distribution for DTA: Natural Sciences - Lab CHEM& 241: Organic Chemistry I Lecture 4 Cr Quarters: F Organic chemistry for the student majoring in science or whose career path requires organic chemistry. This is part one of a three-quarter sequence in organic chemistry. Subjects covered will be an introduction to organic structures; nomenclature; stereo chemistry; and the chemistry of alkanes, alkenes, and alkynes. Prerequisite: CHEM& 143 and CHEM& 153 Distribution for DTA: Natural Sciences CHEM& 242: Organic Chemistry II Lecture 3 Cr Quarters: W Organic chemistry for the student majoring in science or whose career path requires organic chemistry. This is part two of a three-quarter sequence in organic chemistry. This course will cover functional group transformations, additions, elimination and substitution, and oxidation/ reduction reactions as well as spectroscopic techniques. Chemistry of alkyl halides, alcohols, ethers, and carbonyl compounds will be emphasized. Prerequisite: CHEM& 241 Distribution for DTA: Natural Sciences CHEM& 243: Organic Chemistry III Lecture 3 Cr Quarters: S Organic chemistry for the student majoring in science or whose career path requires organic chemistry. This is part three of a three-quarter sequence in organic chemistry. This course will cover functional group transformations, additions, elimination and substitution, and oxidation/ reduction reactions as well as spectroscopic techniques. Chemistry of carbonyl compounds, conjugated and aromatic compounds, amines, and heterocycles as well as a variety of biomolecules will be discussed. Prerequisite: CHEM& 242 Distribution for DTA: Natural Sciences CHEM& 251: Organic Chemistry I Lab 3 Cr Quarters: W This course is designed to accompany the second quarter of the three quarter sequence in organic chemistry for majors. Students taking this course will gain skills and knowledge from working with appropriate glassware and instrumentation used in organic chemistry. Students will perform basic experiments in melting point determination, separationandpurificationofchemicalcomponents, preparationoforganicsubstances,andidentificationof chemicals using spectroscopic techniques. Prerequisite: CHEM& 241 or concurrent enrollment in CHEM& 242 Distribution for DTA: Natural Sciences - Lab Yakima Valley Community College, 2015-2016 103 104 CHEM& 252: Organic Chemistry II Lab 3 Cr Quarters: S This course builds upon the laboratory experiences from CHEM& 251. The student will gain enhanced experience in synthetic methods on an individual basis and in a group environment. Students will plan, implement, acquire data/ observations, and critically analyze their laboratory results. Avarietyofpurificationandspectroscopictechniqueswillbe used during the course. Prerequisite: CHEM& 241, CHEM& 242, and CHEM& 243 (concurrent enrollment is acceptable) and successful completion of CHEM& 251 Distribution for DTA: Natural Sciences - Lab Chican@ Studies Please note that the symbol “@” represents the education industry standard, replacing “a/o.” The Chican@ Studies (CHST) program focuses on the history, contributions, and contemporary experiences of people of predominantly Mexican heritage in the U.S. It is aninterdisciplinaryacademicfieldwhichbridgestraditional academic boundaries by drawing from areas of scholarly inquiry such as history, sociology, political science, arts and humanities, education, literature, and women’s studies. Intensive community involvement and the training of future leaders are also emphasized. Students may complete courses to meet YVCC distribution requirements in the Social Sciences and the Humanities or to obtain an Associate in Arts degree with a focus in Chican@ Studies. New courses in this program will continually be developed. Check with an advisor periodically for new course and transfer information. Courses CHST 112: Chican@ Experience in Contemporary Society 5 Cr Quarters: F, W, S This course examines contemporary, Chican@ and Latin@ experiences in the U.S. within a socioeconomic, political, cultural, and historical context. The purpose of the course is to provide students with a broader knowledge of the forces that shape the lives of Mexican- and other Latin@descended peoples in U.S. society. The course will highlight Chican@ history, the role of women, workers, the elite, the middle classes, trans-nationalism and their interaction in the development of the Chican@/Latin@ community. Includes the importance of social activism and social change in understanding contemporary issues in the Chican@/Latin@ community. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences CHST 115: La Chicana 5 Cr Quarters: O This course introduces students to interdisciplinary approaches to investigating the role and status of Chicanas/ Mexicanas in contemporary U.S. society. The course will use scholarshipreflectingChicanasocial,intellectual,historical, and artistic achievements with special emphasis on their historical role; the political, economic, and social institutions thathaveaffectedtheirstatus;andtheircontributionsto society and their community. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences CHST 120: Chican@s Art & Culture 5 Cr Quarters: F, S Assesses the folklore and cultural development of the Chican@ community. Opportunity will be provided for intensive study of the literary, cultural, and artistic achievements of the Chican@. Distribution for DTA: Humanities CHST 198, 199: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in Chican@ studies. Yakima Valley Community College, 2015-2016 CHST 220: Chican@ Community Studies 5 Cr Quarters: O This course is a seminar that introduces students to contemporary political, social and cultural ideologies, theories and methods for conducting Chican@ Studies community research. Students will review and analyze various quality of life indicators of Chican@ communities in the United States. They will have the option to perform eitherlibraryorfieldresearchprojectaboutChican@sinthe Northwest, especially the Chican@/Mexican@ population in the Yakima Valley. Study of community formation and leadership development as these intersect with race, class, and gender issues will be emphasized. Prerequisite: CHST 112, CHST 115, SOC& 101, POLS& 101, PSYC& 100, ANTH& 206, or HIST& 214 with a grade of C or better Distribution for DTA: Social Sciences College Academic Skills Courses CAS 098, 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in college academic skills. CAS 105: Freshman Seminar 2 Cr Quarters: O An academic class designed to improve the success of first-yearstudents.Taughtbyfacultyrepresentingavariety of disciplines, the course examines factors known to improvethelikelihoodofsuccessamongfirst-yearstudents. Freshman Seminar explores the dynamics that pertain to student retention, critical thinking, and enriched learning. Credit will not be granted for both CAS 105 and CAS 106. CAS 106: College Seminar 3 Cr Quarters: F, W, S Anacademicclassdesignedtoimprovethesuccessoffirstyear students. Taught by faculty representing a variety of disciplines, the course examines factors known to improve thelikelihoodofsuccessamongfirst-yearstudents.Firstquarter college students only. Distribution for DTA: Communications CAS 120: Supplemental Instruction 2 Cr Quarters: F, W, S Instructionalsupportofferedforstudentswhoareenrolled in courses taught by instructors who participate in the YVCC Supplemental Instruction Program. Enrollees for Supplemental Instruction (SI) can also include those who havesuccessfullyfinishedsuchcoursesandhavebeen hired as SI leaders. This course will familiarize students withdifferentlearningstyles,studyskills,andtheSocratic method of questioning. Students will model the group dynamics approach during the SI sessions as opposed to the lecture method of lesson presentation. Diversity in learning, studying, and processing styles will be recognized and fostered. Prerequisite: Permission of instructor CAS 158: Introduction to eLearning 2 Cr Quarters: F, W, S, SR A survey course designed to orient new and prospective students to eLearning. This course addresses the factors and skills necessary for successful completion of online Internet classes. Prerequisite: Eligibility for ENGL 095 CAS 180: Library Literacy in the 21st Century 5 Cr Quarters: F, W, S, SR This course develops a framework for research in the online environment and helps students to build skills and techniques for success as an online learner. Through a quarter-long research project on a global issue, participants will examine various strategies for locating, evaluating, and applying information resources in the research process with attention to information issues like intellectual property, censorship, and freedom of information. This is an online class. A computer with Internet access and Microsoft Word is required as well as basic computer skills such as emailing and word processing. Prerequisite: Eligibility for ENGL& 101 CAS 190, 191: Co-op Field Experience I, II Variable Cr Prerequisite: Permission of instructor Quarters: O CAS 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 105 106 CAS 210: Intro to Internet & Educational Technology 2 Cr Quarters: F, W, S, SR This is a two-credit introductory course to learn about the World Wide Web and to use PowerPoint as a presentation tool. Theory will be provided in lecture, and skills will be applied in independent laboratory practice and classroom demonstration. Communication Studies Mass Communication Today’s methods of mass communicating information through the print and electronic media require developing proficiencyinthetraditionalskillsofwrittenandvisual presentations as well as exploring new techniques and new media. The impact of 24-hour cable news, satellite radio, web-based newsletters, web newspapers, and global systems requires today’s Mass Communication major to bebothspecificallyandbroadlyeducated.CoursesatYVCC offerthefuturemediaemployeeopportunitiestomeetthese needs while completing an Associate of Arts degree. The majority of these courses directly transfer to most senior institutions. Speech Communication Speech Communication courses are designed to teach and to allow students to practice the skills and understanding necessarytocommunicateeffectivelyone-on-one,in small groups, and in public speaking, while using digital technologies for PowerPoint business presentations. Courses are designed for majors and for all wishing to improve their personal and professional communication skills or to gain personal enhancement. These skills are consistently listed as those thought by employers to be among the most important qualities for hiring and success in advancement and promotion. Courses Mass Communication CMST& 102: Introduction to Mass Media 5 Cr Quarters: F, W, S, SR A survey of mass communications—newspapers, broadcasting, cinema, and magazines. Emphasis on structure,content,audiences,effects,andsocialsetting. Distribution for DTA: Social Sciences CMST 115: Newswriting 5 Cr Quarters: O This course will introduce students to the fundamentals of news gathering and writing, the credibility of information, news judgment, libel law, and basic methods of researching and writing. Students also will learn to use traditional and online and other cyber sources to obtain and sift information for the purpose of writing news articles and reports, specifically,forpublicationinanonlineperiodical. Prerequisite: YVCC placement into ENGL& 101 Distribution for DTA: Humanities CMST 140: Feature Writing 3 Cr Quarters: F, W, S, SR Nonfictionarticlewriting,techniquesofwriting,manuscript preparation, and selling techniques. Credit will be given for Communications or Humanities distribution but not both. Prerequisite: ENGL& 101 or permission of instructor Distribution for DTA: Communications or Humanities but not both CMST 190, 191: Co-op Field Experience I, II Variable Cr Quarters: O Cooperative education integrates the students’ classroom study with work experience in cooperating employer organizations. Prerequisite: Permission of instructor CMST 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in communications. Yakima Valley Community College, 2015-2016 CMST 202: Intro to Social Media & Online Communication 5 Cr Quarters: F Thiscoursesurveysuses,effects,andimpactofonline communication through social media including study of a variety of popular social media sites and blogs. Topics include thehistoryofthesocialmediaindustry,itsuses,andeffects of social media in social movements, politics, news, business, andourpersonallives.Studentwilllearntowriteeffectively for the use of online communication. Prerequisite: Eligibility for ENGL& 101 Speech Communication CMST 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, non-credit course. CMST 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Speechcoursesmaybepreparedandofferedtomeet specialized communication needs of students and community groups. Prerequisite: Permission of instructor CMST& 101: Introduction to Communication 5 Cr Quarters: F, W, S,SR This course emphasizes and provides experience in applying the basic principles of human perception and communicationinfiveareas:interpersonal,smallgroup, public speaking, mass communication, and technological speech communication. Students will study and increase their understanding and skills in audience and occasion analysis, developing subject and purpose through critical thinking and gathering and organizing material. Students will learn and apply communication and cross-cultural and global perspective skills with special emphasis on interpersonal and small group and audience-centered communication. Credit will be given for Communications or Humanities distribution but not both. Prerequisite: Eligibility for ENGL 095 Distribution for DTA: Communications or Humanities but not both CMST 103: Workplace Communications 3 Cr Quarters: O This is a communications course designed to meet the needs of career-minded students. The course will include assignmentsindiversity-awareness,listening,conflictresolution, teamwork, and mock interviewing, combined with various presentations to showcase learning. CMST 141: Effective Listening 2 Cr Quarters: O The course is designed to acquaint students with their listening behaviors and habits as well as provide avenues for improvement of listening abilities and maintenance of effectivelisteningskills. CMST& 210: Interpersonal Communication 5 Cr Quarters: F, W, S, SR This vital career skills course helps students communicate successfullyininterpersonalrelationshipswhethertheyfind themselvesinbusinessormedicalfieldsorwithfamilyand friends. Students will learn and practice communication skills such as perception checking, paraphrasing, non-defensive communication,andconflictresolution.Thesenewskillswill enable students to succeed with colleagues and customers and help improve their personal relationships. Credit will be given for Communications or Humanities distribution but not both. Prerequisite: Eligibility for ENGL 095 Distribution for DTA: Communications or Humanities but not both CMST& 220: Public Speaking 5 Cr Quarters: F, W, S, SR Surveys the basic principles of communicating in the public format of human communication. The course emphasizes researching, organizing, presenting, and analyzing speech presentations. Students will study verbal and nonverbal elements of communication as well as audience analysis, topic and purpose development, outlines, source citation, and style and delivery. Major speeches include informative and persuasive speeches as well as a presentation concerning a historical or contemporary sociopolitical issue. Credit will be given for Communications or Humanities distribution but not both. Prerequisite: Eligibility for ENGL 095 Distribution for DTA: Communications or Humanities but not both CMST& 230: Small Group Communication 3 Cr Quarters: O A course concerned with improving the student’s ability toparticipateeffectivelyinsmallgroups.Emphasisison the nature of communicating in groups, the development ofeffectivetechniquesforinteractionandmethodsof removing roadblocks to communication. CMST 250: Advanced Public Speaking 3 Cr Quarters: O An advanced course in the use of techniques for persuasion and the use of ethos, audience emotions, and logic in dealing with audiences in varied speech-communication settings. Prerequisite: CMST& 101 or permission of instructor CMST 280: Intercultural Communication 5 Cr Quarters: F, W, S, SR This course is designed to give a theoretical understanding of the process and role of communication when faced with cultural plurality. Provides a background of classical theories in intercultural communication and in interdisciplinary areas of cultural studies and gender studies. Discussions focus on the changing cultural terrain in the United States and on the globalizationofmassorpopularcultureasitinfluencesother parts of the world. Prerequisite: Eligibility for ENGL 095 Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 107 108 Criminal Justice As a pathway to dynamic professional careers and continuing education for lifelong learning, the Criminal Justice program promotes collaboration and innovative teamwork, critical thinking, problem-solving, and community involvement in public service. The Criminal Justice program exists for the preparation ofstudentsforemploymentaslawenforcementofficers, corrections/detentionofficers,privatesecurityofficers,and many other positions within the criminal justice profession. Program Outcomes Upon successful completion of this program the student should be able to: • Compete for entry level positions in the criminal justice field. • Analyze the criminal justice system recognizing its impact on our lives and in a global community. • Utilize critical thinking skills and apply them in various criminal justice settings. • Communicate and collaborate within teams to accomplish tasks in a professional manner. • Communicate within the discipline using words and phrasesspecifictocriminaljustice. • Utilize and demonstrate problem solving skills. • Identify attributes of successful criminal justice professionals. Students from the Criminal Justice program have been hired as trooper cadets with the Washington State Patrol, as local lawenforcementofficersinmanycities,asdeputysheriffsin manycounties,ascorrectionsofficersatthelocalandstate levels,andasdetentionofficers. Upon completion of the Associate of Applied Science degree in Criminal Justice, students will be prepared to compete for entry-level employment in criminal justice positions including law enforcement, institutional corrections, police support personnel, and loss prevention. Students are cautioned that career opportunities in the criminaljusticefieldmightbelimitedbycriminalconvictions, physical requirements, medical history, drug or alcohol use, orotherbonafideoccupationalqualificationsordisqualifiers established and determined by employers. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is available at the following websites: www.WA.gov/ CareerGuide.asp or www.WA.gov/Esd/lmea Degrees Associate of Applied Science in Criminal Justice The Associate of Applied Science in Criminal Justice degree is designed for students who intend to enter the job market upon completion of the two-year degree. Courses within the program assist students in the development ofoccupationallyspecificabilitieswithemphasison interpersonal skills, group dynamics, problem-solving, and critical thinking. The purpose of the program is to meet the needs of criminal justice employers by preparing students for the challenges of working in a dynamic profession. Members of the Criminal Justice Advisory Committee represent a variety of employment positions within the profession including law enforcement, the courts, institutional corrections, community corrections, and private sector employment as well as local, state, and federal government. Recommendations and information from the Advisory Committee aid in preparing students for employment. Students may also desire to further their education with additional schooling and have many options to do so. The YVCC Criminal Justice program has articulation agreements Yakima Valley Community College, 2015-2016 with four-year institutions that take the Associate of Applied Science in Criminal Justice degree and upon completion ofspecificcourses,thestudentearnsaBachelordegree. The YVCC Associate of Applied Science in Criminal Justice degree can also be used for a Bachelor's of Applied Science degree. YVCC students have the opportunity to complete a BAS degree here on campus or attend any of the multiple communitycollegesand/oruniversitiesthatofferBAS degrees. Should a student wish to earn the Associate of Arts DTA degree at YVCC, Criminal Justice courses should be used tofulfillthatdegree'selectives. Many colleges and universities accept YVCC's Criminal Justice courses as part of their degree programs. Students who will be transferring are advised to consult the requirements of the transfer institution. Required Courses Credits BA 115 Business Math 5 CJ& 101 Introduction to Criminal Justice 5 CJ& 105 Introduction to Corrections 5 CJ& 106 Juvenile Justice 5 CJ& 110 Criminal Law 5 CJ 111 Criminal Evidence 5 CJ& 112 Criminology 5 CJ 190-193, 290-293 Co-op Field Experience 5 CJ 203 Criminal Investigations 5 CJ 204 Arrest, Search and Seizure 5 CJ 210 Administration and Supervision 5 CJ 212 Criminal Justice Technical Writing 3 CJ 214 Criminal Justice Professional Development 2 ENGL& 101 English Composition I 5 ETHS 101 American Ethnic Minorities 5 IT 100 Introduction to Computers 3 SOC& 101 Introduction to Sociology 5 Approved Electives* 18 Total Credits 96 *Students choose 18 credits from the following courses in atleastthreedifferentdisciplines:AH155;BIOL100;BT101; CHEM 100; CJ 121, 220; CJ& 240; CAS 106; ENGL 102; HIST 275; IT 101, 102, 104, 111, 115, 120, 124; PHIL& 101, 106; PHOTO 101, 102; PE 180, 181, 182, 184; POLS& 101, 202, PLSCI 205; PSYC& 100, PSYCH 220; READ 105; SOC 110; SPAN 101, 102, 103, 201, 202, 203; and CMST& 101, 210, 220; CMST 141 Certificates Communications/Call Taker Certificate TheCommunications/CallTakercertificatewillbeawarded to students who successfully complete the following course work with a 2.0 or better GPA. Required Courses Credits CJ& 101 Introduction to Criminal Justice 5 CJ 214 Criminal Justice Professional Development 2 BT 101 Beginning Keyboarding 5 IT 100 Introduction to Computers 3 AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 Total Credits 17 Correctional Certificate Studentscanobtainacertificateinaspecializedareaof corrections.TheCorrectionalcertificatewillbeawarded to students who successfully complete the following coursework with a 2.0 GPA or better. Required Courses Credits CJ& 105 Introduction to Corrections 5 CJ 190-193 Co-op Field Experience I, II, III, IV or CJ 214: CJ Professional Development 2 CJ121 OffenderPopulations 2 CJ 212 Technical Writing CJ 220 Correctional Law PE 180-183 Wellness for Life I, II, III, IV Total Credits 3 5 1 18 Crime Scene Investigation Certificate Studentscanobtainacertificateinaspecializedareaof investigations.TheCrimeScienceInvestigationcertificate will be awarded to students who successfully complete the following coursework with a 2.0 GPA or better. CJ 111: Criminal Evidence 5 Cr Quarters: F, W This course is designed to provide students with a working knowledge of the rules of criminal evidence and how these rules apply to the criminal trial process. Some of the subjectstobecoveredaredefiningthetypesofevidence, whenevidenceisadmissible,specificproceduresforthe use of evidence, and how evidence has an impact on one’s constitutional rights. Major court decisions and their impact will be evaluated. Required Courses CJ 111 Criminal Evidence CJ 203 Criminal Investigation CJ 212 Technical Writing CJ& 240 Introduction to Forensic Science Total Credits Credits 5 5 3 5 18 CJ& 112: Criminology 5 Cr Quarters: F, S This course explores the crime problem, its context, and the causes of crime. Major theories of causation will be examined, taking into consideration new developments in thefieldofcriminology. Police Clerk/Support Specialist Certificate ThePoliceClerk/SupportSpecialistcertificatewillbeawarded to students who successfully complete the following course work with a 2.0 or better GPA. CJ 121: Offender Populations 2 Cr Quarters: S Thiscoursefocusesontheoffenderandtheoffender’s conduct within the correctional setting. Special emphasis isondealingwithoffendermanipulationofcorrectional employees. Required Courses CJ& 101 Introduction to Criminal Justice CJ& 110 Criminal Law BT 101 Beginning Keyboarding IT 100 Introduction to Computers Total Credits Credits 5 5 5 3 18 Courses CJ& 101: Introduction to Criminal Justice 5 Cr Quarters: F, W Introductory course designed to provide students with an overview of the criminal justice system in the United States. Students will examine the roles and responsibilities of the major players in the system, i.e. law enforcement, courts, and corrections. Course covers the philosophy and history of the criminal justice system; identifying types of crime and how it is measured; organization and jurisdiction of the agencies in the system; and the administration of the justice process, fromthecommissionofacrimeuntilfinaldisposition. CJ& 105: Introduction to Corrections 5 Cr Quarters: F, S Introductory course designed to provide students with an overview of the corrections system in the United States. Students will examine the role of corrections as it evolved as a system, its philosophy, and society’s attempt to control crime and its structure. Contemporary issues and alternatives to corrections will be explored. CJ& 106: Juvenile Justice 5 Cr Quarters: W, S An examination of the juvenile justice system emphasizing the role that the family, school, courts, law enforcement, corrections, and the broader community play in the life of a juvenile. The historical and philosophical developments of the juvenile justice system will be covered. CJ& 110: Criminal Law 5 Cr Quarters: W, S This course is designed to introduce the student to the history,concepts,theory,andspecificsofcriminallaw.This includesspecificcrimes,thelawsofWashington,andwhat elements are needed for formal charges and conviction. CJ 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Cooperative education integrates students’ classroom studies with work experience in cooperating employer organizations. The students’ education, therefore, is shared between employer, supervisors, and YVCC faculty. Prerequisite: Permission of instructor CJ 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in criminal justice. CJ 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor CJ 203: Criminal Investigation 5 Cr Quarters: F Establishes the actual workings of criminal investigations fromthebasicreporttothefinishedinvestigation.Reports, case organization, crime scene processing, interviewing, and case management are a few of the subjects covered in this course. Prerequisite: CJ 111 or permission of instructor CJ 204: Arrest Search & Seizure 5 Cr Quarters: S This course covers the nature and extent of the individual rights guaranteed by the U. S. Constitution with emphasis on the Fourth Amendment, which constitutes the heart of the law of criminal procedure. Students will be able to apply the law of arrest, search, and seizure to particular fact situations, identifying the individual’s rights in issue and how it comes intoconflictwithlawenforcementfunctions. Prerequisite: CJ 111 or permission of instructor CJ 210: Administration & Supervision 5 Cr Quarters: W Examinespoliceorganizationsandtheeffectsof administrationonfirst-linesupervisionthrough organizational structures, budget, training, and communication. The student will learn to appreciate theauthorityandresponsibilitiesallocatedtofirst-level supervisors for achieving the organizational philosophy, vision, and mission. Yakima Valley Community College, 2015-2016 109 110 CJ 212: Criminal Justice Technical Writing 3 Cr Quarters: S Offersateam-teachingapproachtotechnicalwritingforlaw enforcement,communitycorrections,andsecurityofficers. Emphasis will be placed on writing documents that will be acceptable in the criminal justice system. CJ 214: Criminal Justice Professional Development 2 Cr Quarters: S This course explores the requirements in criminal justice employmentandrelatedfields.Itoffersthestudentthe opportunity to develop skills required in the workplace, including human relations, communication, career choices, testing, attributes of successful candidates, selling yourself on paper, preparing for getting or not getting the job, jobseeking strategies, and interviewing. CJ 220: Correctional Law 5 Cr Quarters: S This course examines the law in the correctional setting with emphasis on prisoner’s rights and the legal obligations of correctionalofficers. CJ& 240: Introduction to Forensic Science 5 Cr Quarters: W Introductory course designed to provide students with an overview of forensic science and the role of forensic scientists in criminal justice. Students will be exposed to the manydifferentspecialtyareasofforensicscienceandlearn the basic applications used in crime scene investigation Prerequisite: CJ 111 and CJ 203 CJ 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor Dental Assisting Dental Assisting is a collaborative program with YV Tech. Studentscompletingthisone-yearcertificateprogramwill trainforawidevarietyofdentalofficefunctions. Students in the Dental Assisting program follow the YV Tech class calendar. Fall quarter start the end of August. Classes are typically Monday through Thursday, 3:00 to 6:10 p.m. For more information on the Dental Assisting program, please call the Dental Assisting numbers listed in the front of the catalog or visit www.YVCC.edu/DentalAssisting Program Outcomes Upon successful completion of this program the student should be able to: • Obtain entry-level employment as chair-side dental assistants. • Obtain entry-level employment as dental hygiene assistants. • Communicateeffectively,applyinginterpersonalskills, and cultural awareness to interact with dental patients, other dental health care professionals, and the various outsideagenciesinvolvedinthefieldofdentistry. • Utilizewell-definedprofessionalskillstoassistthe dentist in the delivery of optimum dental treatment to patients while maintaining a safe and infection-free environment. • Understand and practice high ethical standards and the HIPPA laws required to protect patient personal health information and maintain professional confidentiality. • Utilize professional skills to promote excellent oral health and hygiene to both dental patients and to the community. Careers Upon completion, dental assisting students should be prepared to pass the Dental Assisting National Board’s Infection Control Exam and the Radiation Health Safety Exam. Besides classes at YV Tech, students complete YVCC coursesrequiredforallcertificateprograms. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.Access. wa.gov or www.WorkforceExplorer.com Admissions Dental Assisting students are admitted Fall quarter, subject tothenumberofqualifiedstudentsandspaceavailable. The Dental Assisting program start every Fall quarter only. Students must have: • A high school diploma or GED. • COMPASS exam scores indicating eligibility for ENGL 101, MATH 075, and college-level reading. • Completed a YVCC application (www.YVCC.edu/ Admission) • Completed a YVCC Dental Assisting application (deadline date is July 17 of each year) • Immunizations for Hepatitis B, measles, mumps, rubella, tetanus, and a tuberculosis skin test. Yakima Valley Community College, 2015-2016 Certificate Courses Fall Quarter DA 101 Dental Assisting I PTECH 115 Applied Mathematics II Winter Quarter BA 138 Written Business Communication DA 102 Dental Assisting II Spring Quarter DA 103 Dental Assisting III IT 102 Windows Summer Quarter DA 193 Co-op Field Experience IV Credits 8 3 5 8 8 2 5 Courses DA 101: Dental Assisting I 8 Cr Quarters: F The student will become oriented to the profession of dentistry; identify and describe the structures, development, system and functions of the human body, the head and neck and oral cavity; measure and record patient vital signs; chart oral conditions and restorations; identify diseases of concern to dentistry and how they are transmitted and prevented in a clinical environment. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 075 DA 102: Dental Assisting II 8 Cr Quarters: W The student will continue to build upon the basic dental sciences covered in DA 101, by learning infection control in the clinical environment, hazard communication, dental radiography, alginate impressions and study models, dental instruments and tray set-ups, and beginning chair-side dental assisting. Prerequisite: DA 101 with a minimum grade of C+ and permission of instructor DA 103: Dental Assisting III 8 Cr Quarters: S The student will continue applying and practicing knowledge and skills learned in DA 102, by gaining knowledge and skill with dental anesthetics, dental materials, preventative dentistry, operative and cosmetic dentistry, pediatric dentistryandfixedandremovableprosthdontics. Prerequisite: DA 101 and DA 102 with a minimum grade of C+ and permission of instructor DA 193: Dental Assisting Co-op Field Experience IV 5 Cr Quarters: O The dental assisting program is a four-quarter program designed to prepare the student for entry-level employment as chair-side dental assistant. During the summer quarter, the student will receive on-the-job training by participating in the dental assistant internship program. The student will have the opportunity to apply the knowledge gained and to practice the skills acquired during the previous three quartersinarealdentalofficeenvironment. Prerequisite: DA 101, DA 102, and DA 103 all with a minimum grade of C+ and permission of instructor Dental Hygiene Dental Hygiene is the science and practice of the recognition, treatment, and prevention of oral diseases. The dental hygienist is a preventive oral health professional who has graduated from an accredited dental hygiene program in an institution of higher education; is licensed in dental hygiene; and provides educational, clinical research, administrative, and therapeutic services supporting total health through the promotion of optimal oral health. In practice, dental hygienists integrate the roles of clinician, educator, advocate, manager, and researcher to prevent oral diseases and promote health. The Dental Hygiene curriculum includes general education, biomedical sciences, dental sciences, and dental hygiene sciences. Dental hygienists work in private dental hygiene offices;privatedentaloffices;hospitals;managedcare organizations; federal, state, and municipal health facilities; long-term care facilities; nursing homes; correctional facilities; and schools. The graduate will be prepared for the full scope of dental hygiene practice including professionalism and patient care as well as health promotion and disease prevention. The curriculum in the Dental Hygiene program consists of six quarters of professional education and clinical experience preceded by a demanding program of prerequisite courses. An Associate of Applied Science degree in Dental Hygiene is earned upon graduation. The Yakima Valley Community College program in Dental Hygiene is accredited by the Commission on Dental Accreditation and has been granted the accreditation status of “Approval without Reporting Requirements.” The Commission is a specialized accrediting body recognized by the United States Department of Education. The Commission on Dental Accreditation can be contacted at 312.440.4653 or at 211 East Chicago Avenue, Chicago, IL 60611-2678. The Commission’s web address is: http://www.ADA.org/en/ coda. Program Outcomes Upon successful completion of this program the student should be: • Prepared for the full scope of dental hygiene practice in Washington State. • Able to conduct professional activities and develop professional relationships in responsible ways. • Able to make appropriate decisions and actions as health care providers guided by ethical principles and core values. • Eligible to take the Western Regional Examination Boards and upon successful completion, to apply for licensing in the western regional participating states, including Washington state, and for other regional and state licensing. Careers The profession of dental hygiene is an excellent career choice for both women and men. Upon completion of the program, the entry-level dental hygiene graduate will be prepared for the full scope of dental hygiene practice in Washington State. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.Access. wa.gov or www.WorkforceExplorer.com Admission Selection Procedure A limited number of student positions are available in the Dental Hygiene program. Yakima Valley Community College, 2015-2016 111 112 To be eligible for selection consideration, eight prerequisitecourses(toincludefivemath/science prerequisite courses) must be completed by the end of Winter quarter of the year of application. Subsequent to program application, selection is based on cumulative GPA in Dental Hygiene prerequisite courses (historically, above a 3.5 GPA), number of prerequisite courses completed, dental experience and education, ability in a second language, and appropriate standardized tests. Dental Hygiene students must possess skills essential to performing dental hygiene functions as outlined in the Dental Hygiene application information packet. The selection process is reviewed each year. For upto-date selection information, refer to the current Dental Hygiene application information packet or to the website at www.YVCC.edu/DentalHygiene. Supplemental information is available in the Dental Hygiene department. Admission Requirements Completion of prerequisite courses does not guarantee admission into the Dental Hygiene program. Application forms and all required records listed below mustbepostmarkedbythefirstFridayinFebruaryforan applicant to be considered for Fall entry. Each applicant must meet all college admissions requirements as well as follow all college policies and procedures. The following prerequisite course requirements have been established: Required Prerequisite College Courses BIOL 230 Human Anatomy & Physiology I Note: BIOL 109 is required for BIOL 230. BIOL 231 Human Anatomy & Physiology II BIOL 232 Microbiology CHEM 109/110 Principles of Chem Theory w/ Lab Note: CHEM 100 is required for CHEM 109/110 if no high school Chemistry was taken. CHEM 209/210 Intro to Organic Biochem w/ Lab CMST& 101 Introduction to Communication or CMST& 210: Interpersonal Communications or CMST 280: Intercultural Communication or CMST& 220: Introduction to Public Speaking ENGL& 101 English Composition I ENGL 102 English Composition II MATH& 146 Statistics NUTR& 101 Nutrition PSYC& 100 General Psychology SOC& 101 Introduction to Sociology or ANTH& 206 : Cultural Anthropology 5 5 5 5 5 5 5 5 5 5 5 5 CourseslistedarecoursenumbersofferedatYVCC.Courses from other colleges which appear to be equivalent may be accepted with approval. A 2.5 cumulative GPA must be achieved in the prerequisite courses. Applicants must receive a minimum of a C (2.0) in each prerequisite course (Pass/Fail or Credit/No Credit grades are not acceptable). All prerequisite courses must be completed prior to entry into the Dental Hygiene program. Retakes of prerequisite Dental Hygiene courses are limited. The following courses must have been completed within fiveyearsofentranceintotheprogram:CHEM109,110,209, 210; BIOL 230, 231, 232; and NUTR& 101 Documents Required • Officialcollegetranscript(s)induplicate. • OfficialhighschooltranscriptorGEDcertificate. • Dental Hygiene program Application. • A completed prerequisite course plan form. • Work experience and/or observation forms. • Specificstandardizedtestasrequiredbythe department. Yakima Valley Community College, 2015-2016 • • • Secondlanguageverification,(AltaTest)ifapplicable. Other documents supporting application are optional. $25 Dental Hygiene Application fee (non-refundable). After acceptance into the program, the student must submit evidence of good health indicated by: • Physical examination by a licensed physician. • Professionaleyeexaminationmeetingspecified essential skills. • Tuberculin test or chest x-ray. • Hepatitis B vaccination. • An investigative background check is also required. Degree Associate of Applied Science in Dental Hygiene Academic and clinical courses must be passed with a minimum of 1.7 (C-) GPA and completed in consecutive sequence. (Exception: one D (1.0) may be earned in one clinical course.) A cumulative 2.5 GPA or above is required to continue in the curriculum and to graduate from the program. Graduates will earn an Associate of Applied Science degree in Dental Hygiene. Suggested Program of Study First Year - Fall Credits BIOL 116 Head & Neck Anatomy 3 DH 150 Dental Anatomy 3 DH 156A Safety & Infection Control I 3 DH 157A DH Fundamentals I Theory 4 DH 157B DH Fundamentals I Lab 3 DH 174 Preventive Dentistry 2 DH 178 Anesthesiology/Dental Emergency 2 Total Credits 20 First Year - Winter BIOL 117 Oral Histology/Embryology 4 DH 153 Oral Roentgenology 4 DH 158A DH Fundamentals II Theory 4 DH 158B DH Fundamentals II Lab 4 DH 171 Dental Materials/Restorative Dentistry I 3 DH 177 General Pathology 2 DH 271 Nitrous Oxide Analgesia 2 Total Credits 23 First Year - Spring DH 154 Clinical Roentgenology 2 DH 159 Dental Hygiene Theory 3 DH 160 Clinical Dental Hygiene 4 DH 165 Restorative Dentistry II 4 DH 173 Pharmacology 2 DH 176 Introduction to Periodontics 2 DH 273 Anesthesiology 4 Total Credits 21 Second Year - Fall DH 156B Safety & Infection Control II 3 DH 200 Second Year Seminar I 1 DH 270 Oral Pathology 2 DH 279 Advanced Periodontics I 2 DH 284 Restorative Dentistry III 4 DH 295 DH Practice I 8 Total Credits 20 Second Year - Winter DH 201 Second Year Seminar II 1 DH 276 Introduction to Perio Seminar 1 DH 280 Advanced Periodontics II 2 DH 281 Ethical Decisions and Professional Responsibility in Dental Hygiene 1 DH 282 Community Dental Health 3 DH 286 Restorative Clinic I 4 DH 296 DH Practice II 8 Total Credits 20 Second Year - Spring DH 202 Second Year Seminar III 1 DH 277 Periodontology Seminar 2 DH 283 Leadership & Research in Community DH 289 DH 297 Health Dentistry Restorative Clinic II DH Practice III Total Credits Total Program Credits 2 2 8 15 119 Courses Registration in Dental Hygiene courses requires acceptance into the Dental Hygiene program. All Dental Hygiene courses are sequential. Satisfactory performance in each course is a prerequisite for registration in subsequent courses within the Dental Hygiene curriculum. DH 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, non-credit course. DH 150: Dental Anatomy/Restorative Dentistry I 3 Cr Quarters: F This course encompasses the study of tooth morphology involved with the maxillary and mandibular arches. Extensive, detailed material is presented on primary and permanent dentition, tissues of the teeth, dental formulas, dental anomalies, and descriptive terminology. Content relates to the practical application of knowledge during lab sessions and serves as a critical foundation for subsequent restorative and traditional courses. DH 153: Oral Roentgenology 4 Cr Quarters: W Theory and practical application of the fundamentals of intra-oral and radiographic technique. Includes exposing, processing, and interpreting dental radiographs. Prerequisite: Completion of the first quarter of the Dental Hygiene curriculum DH 154: Clinical Roentgenology 2 Cr Quarters: S This course applies the knowledge and skills learned in DH 153toclinicalpatients.Emphasisonrefinementofexposure techniques and interpretive skills. Seminar presentation by group. Prerequisite: First two quarters of Dental Hygiene curriculum DH 156A: Safety & Infection Control I 3 Cr Quarters: F An introductory didactic and clinical course providing the student with current safety and infection control information and techniques used in the clinical practice of dental hygiene. Prerequisite: First quarter enrollment as a first-year student DH 156B: Safety & Infection Control II 3 Cr Quarters: F A yearly review of the didactic and clinical safety and infection control course providing the student with current safety and infection control information and techniques used in the clinical practice of dental hygiene. Prerequisite: Completion of the first-year curriculum for the second-year student DH 157A: Dental Hygiene Fundamentals I: Theory 4 Cr Quarters: F An introductory lecture course to provide the student with information used in the clinical practice of the dental hygienist. Each student is expected to recall and apply pertinent didactic information for application in laboratory procedures. Prerequisite: Enrollment in the Dental Hygiene program and concurrent enrollment in DH 157B DH 157B: Dental Hygiene Fundamentals I: Lab 3 Cr Quarters: F An introductory laboratory course to provide the student with techniques used in the clinical practice of the dental hygienist. Each student is expected to recall pertinent didactic information and apply it to laboratory procedures. Prerequisite: Enrollment in the Dental Hygiene program and concurrent enrollment in DH 157A DH 158A: Dental Hygiene Fundamentals II: Theory 4 Cr Quarters: W The second of six lecture courses to provide the student with additional information, skills for comprehensive patient examination, and fundamental instrumentation techniques necessary for the detection and removal of calculus. Prerequisite: Completion of the first quarter of the Dental Hygiene curriculum DH 158B: Dental Hygiene Fundamentals II: Lab 4 Cr Quarters: W The second of six laboratory courses to provide the student with additional techniques for comprehensive patient examination and fundamental instrumentation techniques necessary for the detection and removal of calculus. Prerequisite: Completion of the first quarter of the Dental Hygiene curriculum DH 159: Dental Hygiene Theory 3 Cr Quarters: S A lecture course to provide the student with information used in the clinical practice of the dental hygienist. Each student is expected to recall and apply pertinent didactic information for application in laboratory procedures. Prerequisite: Completion of the first two quarters of the Dental Hygiene curriculum DH 160: Dental Hygiene Clinic 4 Cr Quarters: S Clinicalcourseindentalhygienedesignedtoprovidethefirstyear student with learning experiences, enabling treatment of clinical patients. Prerequisite: Completion of the first two quarters of the Dental Hygiene curriculum DH 165: Restorative Dentistry II 4 Cr Quarters: S This course presents working knowledge and restorative techniques involved in the placement of more complex amalgam and composite restorations. Prerequisite: DH 150 and DH 171 DH 171: Dental Materials/Restorative Dentistry I 3 Cr Quarters: W A course designed to provide the didactic, clinical knowledge and the practical skills associated with the selection and application of dental materials involved in both traditional procedures and restorative expanded functions along with the working knowledge and restorative techniques involved in the placement of amalgam and composite restorations. Prerequisite: Completion of the first quarter of the Dental Hygiene curriculum DH 173: Pharmacology 2 Cr Quarters: W This course provides the student an understanding of drug groups, mechanisms of action, dosage, indications for use, adverseeffects,toxicology,anddruginteractions.Drugsthat may have a direct impact on dental hygiene practice and the dental hygienist’s responsibility for pre-screening, managing, and educating the patient are emphasized. Prerequisite: Completion of the second quarter of the Dental Hygiene curriculum Yakima Valley Community College, 2015-2016 113 114 DH 174: Preventive Dental Health 2 Cr Quarters: F This course includes the study of facts, concepts, and procedures enabling the student to create a preventionoriented outlook. Oral physiotherapy aids, techniques and products,fluorides,nutrition,plaque,saliva,andpatient motivation will be studied to gain a preventive philosophy for the Dental Hygiene student. Prerequisite: Enrollment in the Dental Hygiene program DH 176: Introduction to Periodontology 2 Cr Quarters: S Thefirstofaseriesofdidacticcoursesdesignedtoprovide the student with background knowledge of periodontal disease, including detailed anatomy of the periodontium, microbiological and etiological factors, and systemic influencesinperiodontaldisease. Prerequisite: Completion of the first two quarters of the Dental Hygiene curriculum DH 177: General Pathology 2 Cr Quarters: S The consideration of disease as a disruption of normal physiologic processes is a focus of this course. The body’s responses to a variety of pathological stressors are examined, and the role of the dental hygienist in assessing and intervening for clients with various disease processes is emphasized. Prerequisite: Completion of the first quarter of the Dental Hygiene program DH 178: Anesthesiology/Dental Emergency 2 Cr Quarters: F A lecture course consisting of subject matter dealing with pain, preanesthetic considerations, local anesthetic solutions, vasoconstrictors, and dental emergencies. The course is designed to assure maximum safety to student partners and to patients in the delivery of local anesthetics. Prerequisite: Enrollment in the Dental Hygiene program DH 200: Second-Year Seminar I 1 Cr Quarters: F DH200isthefirstinaseriesofthreesecond-yearseminar courses. The weekly seminar course is designed to provide the second-year Dental Hygiene student time to address the clinical schedule, review and analyze clinical principles, facilitatestudent/faculty/staffcommunication,andreview current literature. Prerequisite: Completion of the first three quarters of the Dental Hygiene curriculum DH 201: Second-Year Seminar II 1 Cr Quarters: W DH 201 is the second in a series of three second-year seminar courses. The weekly seminar course is designed to provide the second-year Dental Hygiene student time to address the clinical schedule, review and analyze clinical principles, facilitatestudent/faculty/staffcommunication,andreview current literature. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 202: Second-Year Seminar III 1 Cr Quarters: S DH 202 is the third in a series of three second-year seminar courses. The weekly seminar course is designed to provide the second-year Dental Hygiene student time to address the clinical schedule, review and analyze clinical principles, facilitatestudent/faculty/staffcommunication,andreview current literature. Prerequisite: Completion of the first five quarters of the Dental Hygiene curriculum Yakima Valley Community College, 2015-2016 DH 270: Oral Pathology 2 Cr Quarters: F The study of oral disease and oral manifestations of systemic disease. Course content provides the dental hygiene student with a basic foundation for clinical pathologic correlations and referral of oral disease. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 271: Nitrous Oxide Analgesia 2 Cr Quarters: W Introducing nitrous oxide sedation and analgesia in order to prepare dental hygienist students for the performance of their legal function, which is administration of nitrous oxide while under the supervision of a dentist. Prerequisite: Completion of the first quarter of the Dental Hygiene curriculum DH 273: Clinical Anesthesiology 4 Cr Quarters: S A lecture, laboratory, and clinical course introducing the administration of local anesthesia. This course consists of techniques used in the administration of local anesthetics in dentistry and anatomic relationships of the head and neck. Prerequisite: Completion of the first two quarters of the Dental Hygiene curriculum DH 276: Introduction to Perio Seminar 1 Cr Quarters: W Study of advanced periodontics for comprehensive care and management of patients who exhibit moderate to severe periodontal disease. Includes periodontal prognosis, consideration of treatment planning for periodontal treatment modalities, referral of periodontal pathology, and supportive periodontal therapy. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 277: Periodontology Seminar 2 Cr Quarters: S A seminar course facilitated by a dental hygienist and a periodontist/implant specialist. After completion of initial therapy, the student will prepare a case work-up and write an analogous research paper for one of two required periodontal seminar-type patients. Oral presentations will be included in the periodontal seminar course. Prerequisite: Completion of the first five quarters of the Dental Hygiene curriculum DH 279: Advanced Periodontics I 2 Cr Quarters: F DH279isthefirstinaseriesoffouradvancedperiodontics courses. The didactic course includes information related to powerscalers, antimicrobials, occlusion, bone loss patterns, advanced dental hygiene therapeutic concepts, and other information relevant to the study of advanced periodontics. Prerequisite: Completion of the first three quarters of the Dental Hygiene curriculum DH 280: Advanced Periodontics II 2 Cr Quarters: W A didactic course designed to facilitate understanding of advanced concepts related to periodontal pathology. Includes the study of various gingival and periodontal infections, gingival curettage, root morphology, and advanced instrumentation techniques. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 281: Ethical Decisions and Professional Responsibility in Dental Hygiene 1 Cr Quarters: W Study of the principles of ethical reasoning, ethical decision making, and professional responsibility as they pertain to the academic environment, research, patient care, and dental hygiene practice management. Includes a review of the laws and state practice acts which guide judgement and action of the dental hygienist. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 282: Community Dental Health 3 Cr Quarters: W Community Dental Health provides insight into the opportunities for dental hygienists to work in community settings and public health. This course supplies information regarding the principles of public health programming throughclassroomandfieldexperience.Through presentationinthefieldandparticipationinacommunity service event, the student will be made aware of dental needs in the community, broaden skills as a planner and educator to serve these needs, and develop dedication to promotion of total health through the prevention of oral disease. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 283: Leadership & Research in Community Health Dentistry 2 Cr Quarters: S A lecture course introducing leadership and the research process in advanced community health dentistry. This course includes an introduction to the research process and application of community dental health principles with an emphasis on evidence based practices. Prerequisite: Completion of the first five quarters of the Dental Hygiene curriculum DH 295: Dental Hygiene Practice I 8 Cr Quarters: F First course in a series of three clinical courses designed to provide learning experiences enabling the student to achieve clinical competence in assessing, implementing, and evaluating treatment for the prevention and control of oral disease, thereby facilitating oral wellness. Prerequisite: Completion of the first three quarters of the Dental Hygiene curriculum DH 296: Dental Hygiene Practice II 8 Cr Quarters: W Second course in a series of three clinical courses designed to provide learning experiences enabling the student to achieve clinical competence in assessing, implementing, and evaluating treatment for the prevention and control of oral disease, thereby facilitating oral wellness. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 297: Dental Hygiene Practice III 8 Cr Quarters: S Third course in a series of three clinical courses designed to provide learning experiences enabling the student to achieve clinical competence in assessing, implementing, and evaluating treatment for the prevention and control of oral disease, thereby facilitating oral wellness. Prerequisite: Completion of the first five quarters of the Dental Hygiene curriculum DH 284: Restorative Dentistry III 4 Cr Quarters: F The course provides further working knowledge and restorative techniques involved with amalgam and composite restorations, as well as the introduction of other tooth-colored restoratives and complex bonded amalgams. Prerequisite: Completion of the first three quarters of the Dental Hygiene curriculum DH 286: Restorative Clinic I 4 Cr Quarters: W The course is comprised of clinical sessions with patients and laboratory dentoform experiences designed to facilitate the student’s knowledge of various restorative materials and procedureswithfurtherdevelopmentandrefinementof manipulative skills. Prerequisite: Completion of the first four quarters of the Dental Hygiene curriculum DH 289: Restorative Dentistry Clinic II 2 Cr Quarters: S The course encompasses clinical restorative sessions with patients which facilitate and further enhance the student’s knowledge of various restorative materials, procedures, and development of manipulative skills with added experience in special predodontic sessions. Prerequisite: Completion of the first five quarters of the Dental Hygiene curriculum Yakima Valley Community College, 2015-2016 115 116 Drama Drama is a two-year transfer program designed for theatre majors and non-majors alike. Courses focus on performance, production, and general appreciation of theatre as a major fineartandasamajorchannelofculturalcommunication. Three main stage productions from a range of genres, including musicals, the classics, and experimental theatre, are prepared and performed each year. There are also opportunities for faculty-mentored, student-directed productions in our “black box” theatre. The program meets the proposed accreditation standards of the American Theatre Association. The department is an active member of the Kennedy Center American College Theatre Festival and the Association for Theatre in Higher Education. Drama Transfer Drama transfer students should follow the requirements of the associate in arts degree with faculty advisement. Courses DRAMA 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. DRAMA 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor DRMA& 101: Introduction to Theatre 5 Cr Quarters: F, W, S DRMA& 101 is an examination of the dramatic arts from the classicaleratopresentday.Keyworksfromspecificeras of theatre are used to increase students’ awareness of the role of drama in our culture and society and to serve as a basis for creating and performing collaborative pieces for public viewing. The goal of the course is to expose students to common processes involved in creating live theatre and to make them more informed and appreciative consumers of theatrical events. Designed for the theatre newcomer and the serious theatre student in mind. Prerequisite: Eligibility for ENGL 095 Distribution for DTA: Humanities DRAMA 161: National Cinemas 5 Cr Quarters: F An in-depth look at classics from the cinematic production of various nations and an examination of the cultural milieu fromwhichthefilmsarose.Includesaselectionoffilmsbya variety of directors and covers the silent era to more modern productions. Country chosen varies by quarter. May be repeated twice for credit. Distribution for DTA: Humanities DRAMA 180: Acting Beginning 3 Cr Quarters: F, W Theory and practice of the fundamentals of acting based on the principles of Stanislavski and Boal. Emphasis on self-exploration of the voice, body, mind, and imagination in order to develop expressiveness and an approach to creating roles for performance. Exploration through exercises, improvisations, monologues, partner scenes, and group scenes. Distribution for DTA: Humanities - Performance DRAMA 181: Acting Intermediate 4 Cr Quarters: S A continuation of the theory and practice of the fundamentals of acting through a physical approach to character. Development of vocal, physical, and emotional skills through improvisation, solo and scene work, and application. Prerequisite: DRAMA 180 or permission of instructor Distribution for DTA: Humanities - Performance DRAMA 182: Acting Advanced 4 Cr Quarters: S Analysis and study of the Stanislavski method and theory applied directly to play text analysis, scenes, and productions. Prerequisite: DRAMA 181; CMST 130 recommended Distribution for DTA: Humanities - Performance DRAMA 115: Rehearsal/Performance Technology 2 Cr Quarters: F, W, S Acting in plays for public performance and the preparation of acting roles to the best degree possible in theatre tradition. Admission by audition only. May be repeated for credit. Distribution for DTA: Humanities - Performance DRAMA 184: Playwriting 4 Cr Quarters: F At the center of the playwriting course is class time, where student pieces are given readings and then extensively critiqued. The course is structured to help the playwright produceworkinavarietyofstyles.Thefirstpartofthe course will help students to develop the original voice of the playwright through a combination of in-class work, assignments, and class texts. The second part of the class will focus on developing staging readings and production of the plays written, selected, directed, and performed by the students. Prerequisite: Eligibility for ENGL& 101 DRAMA 116: Theater Production 2 Cr Quarters: F, W, S Laboratory courses in technical theatre for students participating in drama productions. May be repeated for credit. Prerequisite: Permission of instructor DRAMA 188: Stage Makeup 3 Cr Quarters: W Basic theories, techniques, and equipment of stage makeup. Course emphasis is upon practical application of theories through in-class laboratory work. Distribution for DTA: Humanities - Performance DRAMA 150: Introduction to Cinema 3 Cr Quarters: W Ageneralsurveyoffilm,includingthehistory,techniques, andtypesoffilmasameansofartistic,aesthetic,andcreative expression. Thirty-minute lecture periods followed by the showingofmajormilestonesinthedevelopmentoffilmart. Distribution for DTA: Humanities DRAMA 189: Basic Stagecraft/Theater 4 Cr Quarters: F, W, S Basic course in craft of scenery construction and painting, set design, lighting, and decoration. Practical application of techniques studied. Distribution for DTA: Humanities - Performance Yakima Valley Community College, 2015-2016 DRAMA 190: Co-op Field Experience Variable Cr Prerequisite: Permission of instructor Quarters: O DRAMA 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in drama. DRAMA 201: Contemporary Theater 3 Cr Quarters: O A study of the dramatic changes in the theatre from 1959 to the present. Focus on radical theatre artists and groups (Living Theatre), performance art, contemporary plays, and Augusto Boal’s Theatre of the Oppressed. Distribution for DTA: Humanities DRAMA 202: Theater History I 5 Cr Quarters: O A survey of the origins of western drama and analysis of dramatic literature of Greek, Roman and Asian theatre. Drama of Aeschylus, Sophocles, Euripides, Aristophanes, Plautus, Seneca, and Noh included. Distribution for DTA: Humanities DRAMA 203: Theater History II 5 Cr Quarters: O A survey of the rise of modern drama from Roman tradition through the Renaissance. Traditions of the social eras and the literature of the times are covered. Drama of Seneca, Moliere, and Shakespeare included. Distribution for DTA: Humanities DRAMA 204: Theater History III 5 Cr Quarters: O A survey of the traditions of the 19th and 20th century western societies which gave rise to modernism in drama. Literature of Ibsen, Strindberg, O’Neil, and Brecht included. Distribution for DTA: Humanities DRAMA 205: 19th Century American Drama 5 Cr Quarters: O Survey of the American theatre in the 19th century. A study of the theatre traditions dominant in the USA during the 19th and 20th centuries. Traditions, styles, concepts of dramatic structure, and plays of the 100 years preceding O’Neil will be discussed. The center of the course will be the actual production of one such play in the style and tradition of the time. Distribution for DTA: Humanities DRAMA 282: Acting Seminar Advanced 4 Cr Quarters: O Advanced exercises in improvisation and character development with emphasis on styles and movement applicable to Realism and Expressionism. Distribution for DTA: Humanities - Performance Economics Economics is the study of how people and their social systems use scarce resources for the production, distribution, and consumption of goods and services. The study of economics has become particularly relevant for understandingthefinancial,political,andsocialchanges taking place daily in our modern world. Courses taught at YVCC are designed to provide introductory-level exposure to economic theory and practice relevant for degree-seeking and transfer students as well as for members of business and the community as a whole. Courses ECON 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Workshops, short courses, and individual study in economics. ECON 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in economics. ECON 101: Introduction to Economics 5 Cr Quarters: F, W, S This course introduces students to the study of Economics. Students will explore the most common principles associated with microeconomics and macroeconomics, themainfieldsofeconomics.Theseprinciplesmayinclude supply and demand, factors of production, economic growth, competitivemodels,unemployment,inflation,andeconomic policy. Students will utilize these principles to examine economic issues found in current economic events, and apply economic reasoning to understand our federal, state, and local economies. Prerequisite: Eligibility for ENGL& 101 or successful completion of BA 138 with a C (2.0) or better and eligibility for MATH 085 or successful completion of BA 115 with a C (2.0) or better Distribution for DTA: Social Sciences ECON& 201: Micro Economics 5 Cr Quarters: F, W, S This course focuses on the micro economic principles of the market system and allocating scarce resources. Introductory economic topics involving consumers and producers will becovered,likesupplyanddemand,efficiency,elasticity, utility,pricingandprofitability,andmarketmodelsrelatingto variouslevelsoffirmandindustrycompetition.Otherissues studied include economic growth and output productivity, the four factors of production, the market for resources and labor, and externalities. Prerequisite: Eligibility for ENGL& 101 or successful completion of BA 138 and eligibility for MATH 085 or successful completion of BA 115 Distribution for DTA: Social Sciences ECON& 202: Macro Economics 5 Cr Quarters: F, W, S This course examines the organization of and issues surrounding the modern U.S. macro economy. The conceptsexploredincludethebusinesscycle,inflation, unemployment, and economic growth. Other topics will include an introduction to the historical development of macro economic thought, government economic interventionthroughfiscalpolicy,andtherolesoftheFederal Reserve Banking system and monetary policy. Prerequisite: Eligibility for ENGL& 101 or successful completion of BA 138 and eligibility for MATH 085 or successful completion of BA 115 Distribution for DTA: Social Sciences Yakima Valley Community College, 2015-2016 117 118 ECON 205: Economic Geography 5 Cr Quarters: S An introduction to the spatial patterns of economic activity on both a regional and global scale. Focuses on the growth andintensificationofglobalties,thedistributionofresources and wealth, and the resulting inequalities and tensions. Topics include trade development; resource extraction; agriculture, manufacturing, and service sector economies; transportation; communication; and environmental impact. Credit cannot be given for both GEOG 205 and ECON 205. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences ECON 213: Economic History 5 Cr Quarters: W An introduction to the methods of economic interaction from antiquitytothepresent.Thiscourseoffersacomprehensive world survey, emphasizing important economic events— such as the invention of currency, the Industrial Revolution, and the development of economic thoughts—to include major economic thinkers and their contribution to the understanding of economic processes. Credit cannot be given for both HIST 213 and ECON 213. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences Education The Education department provides career and enrichment courseworkandfieldexperiencesthatbuildknowledge, skills, and competencies for providing education and care for children and families. The Education department is comprised of several differentareasofstudy:EarlyChildhoodEducation(ECE), School-Age Education, Special Education, and STARS training. Severalprogramsofstudyareoffered:EarlyChildhood Education, Education, Paraprofessional, Early Childhood Education-Children’s Studies, and Special Education InstructionalAssistant.Eachprogramhasdifferent admission criteria, coursework, and degree options ranging frominquiry/introductoryclassesandfieldexperiences to transfer degrees focused on teacher preparation and children studies related careers. The Early Childhood Education (ECE) program at YVCC is part of the Early Achiever program which includes the ECE Statecertificates.TheECEprogrambelievesthattheneeds of young children are best met by teachers and caregivers who are trained with a blend of classroom theory; interactive learning communities; and competency-based laboratory experiences, assignments, and projects. All training is based on the Washington State Core Competencies for early care and education professionals and NAEYC standards (National Association for Education of Young Children). Students learn through the course content and methods ofstudyhowcriticalthefirstfiveyearsoflifeareforchild development. Learning activities for the child must be developmentally appropriate for the age and stage of development while meeting the needs of the whole child physically, socially, emotionally, and cognitively. The child must be guided in developing independence, self-control, cooperation, and positive self-concept in a safe, healthy, and multi-culturallearningenvironmentwherestaffandfamily members play a critical role in the learning process. Upon successful completion of the program, the student will have demonstrated competency in the Washington State Competencies for early childhood professionals, school age professionals, or paraprofessionals. The students should be prepared for entry-level employment in the area for which thecertificateordegreehasbeenearned. Program Outcomes Upon successful completion of this program the graduate will be able to: • Question, research, search for meaning, and develop ideas that lead to action and critical thought in education based upon the Washington State Core Competencies for education and early childhood professionals. • Demonstrate a knowledge of diverse culture, ideas, and experiences and be able to examine their own attitudesandassumptionsinordertoworkeffectively and emphatically in a multicultural classroom. • Apply essential concepts, inquiry tools, approaches, and strategies to build curriculum which stimulates learning in children. • Promote child development and learning by using and articulating their understanding of childrens' needs to create healthy, respectful, supportive, and learning environments that are challenging and exciting. Careers Childcare, school-age care, preschool assistants, preschool teachers, parent educators, paraprofessionals, and elementary school teachers are in high demand throughout Washington State and the Yakima Valley. Employers include public and private childcare centers, preschools, K-8 schools, and child/family service organizations. In addition, many students operate their own home childcare Yakima Valley Community College, 2015-2016 businesses. Students are cautioned that career options in education might be limited by criminal convictions, physical requirements, history of drug or alcohol use, or other bona fideoccupationalqualificationsdeterminedbyemployers. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.Access. wa.gov or www.WorkforceExplorer.com. Admission Students must meet the course prerequisites before enrolling.AllstudentsenteringanyfieldofstudyinEducation or Early Childhood Education must take EDUC 111: Careers in Education & Early Childhood Education. This can be taken prior to or concurrently with any EDUC or ECED course. For further information, request the information packet from the Education Department. Criminal History Information Prior to enrolling in a practicum course, criminal history information will be requested of students enrolling in the education program practicums. Information obtained fromthisinquirywillbetreatedconfidentiallyandwill be considered in determining the student’s eligibility to complete clinical competencies. Inability to participate in clinical experience due to information obtained from the Washington State Patrol and DSHS criminal history and background inquiry may result in a student’s inability to satisfactorily complete program degree requirements.Formorespecificinformation,contactthe program coordinator at the phone number listed in the front of this catalog. Degrees Associate in Arts DTA (AA-DTA) The Education department recommends that a student planning to transfer to a four-year university or college to pursue a degree in K-8 or secondary education, early childhood education, or children studies earn an Associate in Arts degree. While earning the Associate in Arts degree, the student should take required coursework for teacher preparation and/or basic studies. Additional courses may be fully articulated with the transfer institution. Since requirements vary by four-year institution, please see an education advisor to ensure that courses taken will meet requirements. For additional information on teacher preparation programs, go to www.TeachWashington.org. All students planning to transfer to a four-year institution for teacher preparation must pass the WEST-B basic skills test prior to admission to a four-year education program. It is advisable to take the test before April if Fall admission will be sought. For information about the test, to download a study guide, or to sign up for the test visit www.Nesinc.com Children Studies and Human Development Students planning to transfer to a four-year university or college to earn a degree in Children Studies or Human Development are advised to earn an Associate in Arts degree. It is recommended that students concentrate Humanities and Social Sciences distribution courses in Sociology and Psychology courses that focus on family and human development and that they take elective credit for the degree fromEarlyChildhoodEducationcourseofferings. Associate of Applied Science (AAS, AAS-T) YVCC’sEducationdepartmentoffersAASdegreesinECE,ECE with a Preschool Special Education option, AAS-T Children’s Studies, and AAS Paraprofessional preparation. Students should be able to earn a degree in two years of full-time enrollment. Although many of the courses listed in these degrees are transferable, the degrees themselves are not intended to transfer. Associate of Applied Science degree in Early Childhood Education students who earn an AAS degree in ECE meet the requirements for the Associate in Arts degree and ECE Certificate/StateCredential.Asthestudentprogresses through the degree requirements, s/he will be awarded theECEInitialCertificate,theECEShortCertificateof Specialization,andtheECEStateCertificate.Besuretocheck with an Education department advisor to get the latest information. Required Coursework Basic Requirement Courses Credits ENGL& 101 English Composition I 5 PTECH 116 Applied Math II for Early Childhood Ed 5 or 100-level Math or above Humanities Courses CMST& 210 Interpersonal Communications 5 Additional 5 credits from distribution list 5 Natural Sciences Courses 5 credits required 5 BIOL 105 recommended Social Sciences Courses 10 credits required 10 PSYC& 100, PSYC& 200, ANTH& 206, SOC& 101, or SOC 250 recommended Professional/Technical Core Required for Early Child Ed Courses ECED& 100 Child Care Basics 3 ECED& 105 Introduction to Early Childhood Education 5 ECED 105 Child Abuse/Neglect 2 ECED 106 Math for Preschool Teachers 2 ECED& 107 Health, Safety, and Nutrition 5 ECED 107 Science for Preschool Teachers 2 ECED& 120 Practicum-Nurturing Relationships 2 ECED& 132 Infants & Toddlers-Nurturing Care or ECED 155: Infant/Toddler Curric. & Guidance 3 ECED& 134 Family Child Care or EDUC& 136: School Age Care or ECED& 139: Admin. of Early Learning Prgms. 3 ECED 156 Infant/Toddler Curric. & Guidance Practicum 1 ECED& 160 Curriculum Development 5 ECED 160 Preschool Instructional Asst. Practicum 2 ECED& 170 Environments for Young Children 3 ECED& 180 Language and Literacy Development 3 ECED& 190 Observation and Assessment 3 ECED 206 Professionalism and Portfolio 1 ECED 260 Vocational Preschool Teacher Practicum 4 EDUC& 115 Child Development 5 EDUC& 130 Guiding Behavior 3 EDUC& 150 Child, Family, and Community 3 READ 105 Critical Reading 5 SPED course (at least one): SPED 200, 201, or 202 5 Total Degree Credits 105 Students must earn a grade of C (2.0) or better in all required courses in order to receive this degree. Associate of Applied Science in Early Childhood Education with a Preschool Special Education Option The Associate of Applied Science degree in Early Childhood Education with a Preschool Special Education Option is designed to provide students with two areas of concentration: early childhood education and preschool special education. As the student progresses through the degree,theyareawardedanECEInitialCertificate,anECE ShortCertificateofSpecialization,anECEStateCertificate, and an ECE Special Education Instructional Assistant Certificate. Required Coursework Basic Requirements Courses Credits Yakima Valley Community College, 2015-2016 119 120 ENGL& 101 English Composition I 5 PTECH 116 Applied Math II for Early Childhood Ed or 100-level Math or above 5 Humanities Courses CMST& 210 Interpersonal Communications 5 Early Childhood Education Courses ECED& 100 Child Care Basics 3 ECED & 105 Introduction to Early Childhood Education 5 ECED 105 Child Abuse/Neglect 2 ECED 106 Math for Preschool Teachers 2 ECED& 107 Health, Safety, and Nutrition 5 ECED 107 Science for Preschool Teachers 2 ECED& 120 Practicum-Nurturing Relationships 2 ECED& 132 Infants & Toddlers Nurturing Care or ECED 155: Infant/Toddler Curric. & Guidance 3 ECED& 134 Family Child Care or EDUC& 136: School Age Care or ECED& 139: Admin. of Early Learning Prgrms. 3 ECED 156 Infant/Toddler Curric. & Guidance Practicum 1 ECED& 160 Curriculum Development 5 ECED 160 Preschool Instructional Asst. Practicum 2 ECED& 170 Environments for Young Children 3 ECED& 180 Language and Literacy Development 3 ECED& 190 Observation and Assessment 3 ECED 206 Professionalism and Portfolio 1 ECED 260 Vocational Preschool Teacher Practicum 4 EDUC& 115 Child Development 5 EDUC& 130 Guiding Behavior 3 EDUC& 150 Child, Family, and Community 3 READ 105 Critical Reading 5 Special Education Courses SPED 200 Intro. to Exceptionality in Early Childhood Ed. 5 SPED 201 Intervention Strategies for Infants/Toddlers 5 SPED 202 Inclusion in Early Childhood Education 5 Electives ECED 201 Issues & Trends 3 Additional 5 credits ECED /EDUC courses above 100 level or as approved by department. 5 Total Degree Credits 102 Students must earn a grade of C (2.0) or better in all required courses in order to receive this degree. Associate of Applied Science Transfer in Early Childhood Education - Transfer to Eastern Washington University The curriculum of this interdisciplinary program provides a strong holistic background in the study of children from birth to 18. Theory and practice from the disciplines of sociology, psychology, and education form the basis for this integrated curriculum. Childrens studies courses provide foundational and global perspectives of children and childhood. A choice of concentration areas, which culminate in a capstone experience and a senior portfolio, allows students to connect effectivelywithspecificcareeropportunities. Required Coursework for Completion at YVCC Basic Requirements Courses Credits ENGL& 101 English Composition I 5 MATH& 107 Math in Society 5 Humanities Courses CMST& 210 Interpersonal Communications 5 Natural Sciences Courses BIOL 105 Fundamental Biology w/Lab for Non-Majors 5 Social Sciences Courses SOC& 101 Introduction to Sociology 5 PSYC& 100 General Psychology 5 Early Childhood Education Courses ECED & 105 Introduction to Early Childhood Education 5 ECED 105 Child Abuse/Neglect 2 ECED 106 Math for Preschool Teachers 2 ECED& 107 Health, Safety, and Nutrition 5 ECED 107 Science for Preschool Teachers 2 ECED& 120 Practicum-Nurturing Relationships 2 Yakima Valley Community College, 2015-2016 ECED& 132 Infants & Toddlers Nurturing Care or ECED 155: Infant/Toddler Curric. & Guidance 3 ECED 156 Infant/Toddler Curric. & Guidance Practicum 1 ECED& 160 Curriculum Development 5 ECED 160 Preschool Instructional Asst. Practicum 2 ECED& 170 Environments for Young Children 3 ECED& 180 Language and Literacy Development 3 ECED& 190 Observation and Assessment 3 ECED 206 Professionalism and Portfolio 1 ECED 260 Vocational Preschool Teacher Practicum 4 EDUC& 115 Child Development 5 EDUC& 130 Guiding Behavior 3 EDUC& 150 Child, Family, and Community 3 READ 105 Critical Reading or PTECH 104: Technical Reading 5 SPED Course (at least one) SPED 200, 201, 202 5 5 Elective credits (ECED Courses) 5 Total Degree Credits 99 Students must earn a grade of C (2.0) or better in all required courses in order to receive this degree. Associate of Applied Science in Para-Educator Preparation Training ThePara-Educatordegreeand/orcertificateprogram prepares graduates for employment as assistant teachers in public and private schools. The curriculum is based on the Washington State Core Competencies for Para-Educators and the Washington State Skill Standards for Para-Educators. Students who complete the Para-Educator training are well prepared to support the learning of the diverse student population in inclusive educational settings. Required Courses Credits Basic Skills ENGL& 101 English Composition I 5 Natural Sciences NUTR& 101 Nutrition 5 Social Sciences PSYC& 100 General Psychology 5 Professional/Technical Core Courses AH 155 First Aid/CPR/Blood-Borne Pathogen Training 2 BT 101 Beginning Keyboarding 5 EDUC 101 Application of Critical Reading & Thinking in Children’s Literature for Professionals 5 EDUC 102 Parent Community & Volunteers 5 EDUC 103 Guiding Behavior: School-Age Child 5 EDUC 201 Development of the School-Age Child 4 or EDUC& 115: Child Development or 5 EDUC 202 Educational Linguistics 5 EDUC 210 Introduction to Becoming a Teacher 5 EDUC 250 Public School Practicum 4 PTECH 116 Applied Math II for Early Childhood Ed 5 SPED 200 Intro to Exceptionality in Early Childhood Ed 5 Electives ECED 105 Child Abuse & Neglect 2 READ 105 Critical Reading 5 Additional 18 credits ECED or EDUC courses above 100 level or as approved by department. 18 Total Credits 90/91 The Direct Transfer Agreement (DTA) in Elementary (K-8) & Early Childhood Education This program, in collaboration with Central Washington University(CWU),offersabaccalaureatedegreein elementary (K-8) education with a minor in Early Childhood Education. It provides a course of study for persons desiring to teach children in kindergarten through eighth grade in public and private schools. This program is unique in that the outstanding instructional strengths of two institutions are brought together to provide students a rare opportunity to experience learning at its best in the classroom and in the field.AllclassesareheldontheYVCCcampusinYakima. StudentsfirstcompleteanAssociateinArtsdegreewith education emphasis at YVCC. Admittance into the YVCC program does not ensure admittance into the teacher education program at CWU. Students must meet entrance requirements to the CWU program which includes an associate degree. Be sure to check with an Education department advisor or on the CWU website (www.CWU.edu) to get the latest information. WEST-B Information While working for the associate degree requirements, students must also prepare for and take the WEST-B test. This test is mandated for admission to all teacher preparation programs in the state of Washington. It is advisable to take this test before April if Fall quarter admission will be sought. For information about the test, to download a study guide, or to sign up for the test, visit www.Nesinc.com. Students must apply to CWU and the Teacher Preparation program separately by April 1 for Fall quarter admission. Entrance requirements include at least a 3.0 (B) GPA for the last 45 graded credits, all required applications and fees, admission to CWU and the Teacher Preparation program, successful completion of the WEST-B test, all required letters of support, and other items as required each year. Under the Direct Transfer Agreement (DTA), students are only admitted to CWU in the Fall at the Yakima campus, and these students stay together for the two years of teacher preparation. To download application materials for CWU, go to www.CWU.edu. To access information about CWU’s Teacher Preparation program, go to www.CWU.edu/~cert Students who complete the DTA program can apply to teach in the state of Washington with endorsements in elementary education (K-8) and in TBA. The courses are offeredbythecollaboratinginstitutions:YakimaValley Community College and Central Washington University. All classes are held on the YVCC campus. Yakima Valley Community College provides basic coursework in the areas of science, communication, math, and entry-level education. CWU provides a strong professional education sequence, an upper-division elementary curriculum, and student teaching. Admission to either of the two institutions does not guarantee admission to the program. Associate in Arts DTA, Transfer to CWU - Yakima Campus K-8 Teaching Certificate & TBA ThisprogramisajointeffortbetweenYVCCandCWUto provide coursework for earning a Baccalaureate degree in Elementary Education Special Education on the Yakima campus. It provides a course of study for persons desiring to teach children in kindergarten through eighth grade in public schools. Studentstakespecificcourseworkwhileearninga Associate in Arts DTA degree from YVCC. Courses must appear on the YVCC course distribution list to meet requirements. CWU requires a 3.0 (B) GPA for admittance in the Education program. Articulation - CWU Basic Requirements: 18 Credits Group A *ENGL& 101 English Composition I *ENGL 102 English Composition II Group B *MATH& 132 Mathematics for Elementary Education 2 Communication Requirement: 3-5 Credits Humanities: 15 Credits The following course is recommended but not required: CMST& 210 Interpersonal Communication 5 5 5 5 Natural Sciences : 15 Credits One course must be a lab science Social Sciences: 15 Credits PSYC& 100 General Psychology 5 Electives: 25-27 Credits Core Electives: 15-17 Credits Select from the distribution of courses listed in Quantitative/Symbolic Reasoning, Humanities, Social Sciences, and Natural Sciences. *PSYC& 200 Lifespan Psychology 5 General Electives: 10-12 Credits Any college level courses numbered over 100. These may include additional Core Electives as well as courses from the Restricted List .EDUC 111 Careers in Education/Early Childhood 2 Note: Prerequisite for All ECED/EDUC courses is EDUC 111 *EDUC 210 Introduction to Becoming a Teacher 2 *EDUC 201 Developmental School-Age Child 4 *EDUC 250 Public School Practicum 4 *MATH& 131 Mathematics for Elementary Education 1 5 (Prerequisite to MATH& 132) Total Credits 93 All Education courses must have a C (2.0) or better. * Required courses for entrance into the CWU program. Associate in Arts DTA, Transfer to CWU - CWU Campus Only; BA in Education: Early Childhood Education This part-time program is geared toward individuals who are seeking greater professional development in Early Childhood Education and are working with birth to preschool-age children.Thisbachelordegreesatisfiesstipulationsofthe Head Start Reauthorization Act of 2007 that at least 50% of Head Start teachers have a baccalaureate degree in Early Childhood Education by September of 2013. (Note: This programdoesnotleadtoK-12teachercertification.) Studentstakespecificcourseworkwhileearningan Associate of Arts DTA degree from YVCC. Courses must appear on the YVCC course distribution list to meet requirements. Articulation - CWU Basic Requirements: 18 Credits Group A *ENGL 101 English Composition I 5 *ENGL 102 English Composition II 5 Group B Any course meeting Group B distribution 5 Group C Any course meeting Group C distribution 3 Humanities: 15 Credits The following course is recommended but not required: CMST& 210 Interpersonal Communication 5 Natural Sciences : 15 Credits One course must be a lab science. Social Sciences: 15 Credits The following courses are recommended but not required: PSYC& 100 General Psychology 5 PSYC& 200 Lifespan Psychology 5 Core Electives: 15 Credits (from distribution list) Required General Electives: 17 Credits *ECED& 105 Introduction to Early Childhood Education 5 *EDUC& 115 Child Development 5 *ECED& 160 Curriculum Development 5 *ECED 160 Preschool Instructional Assistant Practicum 2 Total Credits 93 *Required courses for entrance into the CWU program. All early childhood education courses must have a C (2.0) or better grade, and the four required elective classes listed above must have been taken within the last 10 years to be accepted by YVCC. Additional elective credits must be in over 100-level courses, preferably Early Childhood courses or from the Yakima Valley Community College, 2015-2016 121 122 distribution list. Students must transfer 105 credits from YVCC for entrance into this program. Students must have at least 75 upper-division credits to graduate from CWU. Students with morethanfourclasseslefttofinishtheirDTAwillnotbeable to enroll at CWU until they are within at least four classes of finishingtheDTA. need additional coursework before admission to the Early Childhood Studies program. These additional courses may be taken at the Toppenish campus or through another accredited college or university. Students are encouraged to work with their community college and a Heritage Education advisor in developing a transfer plan. Associate in Arts DTA, Transfer to Heritage University; BA in Teacher Education YVCC students transferring to Heritage University are encouraged to earn an Associate of Arts DTA degree (AADTA). Earning this degree assures you have completed the required courses to enroll in education courses at Heritage Universityfirstsemester. Transfer candidates who do not have an AA-DTA, may need additional coursework before admission to the Teacher Eduction program. These additional courses may be taken at the Toppenish campus or through another accredited college or university. Students must also attempt the WEST-B Test as part of their requirements for admission to teacher preparation programs in the state of Washington. Students are encouraged to work with YVCC and a Heritage University advisor in developing a transfer plan. Articulation - Heritage University Basic Requirements: 18 Credits Group A ENGL& 101 English Composition I ENGL 102 English Composition II Group B MATH& 107 Math in Society Communication Requirement: 3 - 5 Credits Humanities: 15 Credits The following course is recommended but not required: HIST& 117 Western Civilization II Natural Sciences : 15 Credits One course must be a lab science - Heritage recommends two lab sciences (1 life science and 1 physical science). Social Sciences: 15 Credits The following courses are recommended but not required: HIST& 136 US History I PSYC& 100 General Psychology Core Electives: 15 - 17 Credits PSYCH 213 Human Lifespan I General Electives: 10 - 12 Credits (courses over 100) ECED 106 Math for Preschool Teachers ECED 107 Science for Preschool Teachers ECED& 107 Health, Nutrition, and Safety ECED& 160 Curriculum Development ECED& 180 Language & Literacy Development EDUC& 115 Child Development READ 105 Critical Reading All coursework must have a C (2.0) or better grade with a minimum accumulative 2.6 (C+) GPA. Articulation - Heritage University Basic Requirements: 15 Credits Group A *ENGL& 101 English Composition I 5 *ENGL 102 English Composition II 5 Group B *MATH& 132Mathematics for Elementary Eduvation 2 5 Communication Requirement: 3 - 5 credits Humanities: 15 Credits The following course is recommended but not required: HIST& 117 Western Civilization II 5 Natural Sciences : 15 Credits One course must be a lab science - Heritage recommends two lab sciences (1 life science and 1 physical science). CHEM 100 Introduction Chemistry 5 Social Sciences: 15 Credits The following courses are recommended but not required: HIST& 136 US History I 5 HIST& 137 US History II 5 PSYC& 100 General Psychology 5 Core Electives: 15 - 17 Credits (from distribution list) General Electives: 10 - 12 Credits (courses over 100) *MATH& 131 Mathematics for Elementary Education 1 5 (Prerequisite to MATH& 132) *READ 105 Critical Reading 5 Elementary Education *EDUC 210 Introduction to Becoming a Teacher 5 *EDUC 250 Public School Practicum 4 Total Credits 90 All coursework must have a C (2.0) or better grade with a minimum accumulative 2.6 (C+) GPA. *Required courses WEST-B Recommendations (www.est.nesinc.com) Recommend candidates take WEST-B writing test after ENGL 102 Recommend candidates take WEST-B math test after upperdivision math course Recommend candidates take WEST-B reading test after READ 105 Associate of Arts DTA , Transfer to Heritage University; BA in Early Childhood Studies YVCC students transferring to Heritage University are encouraged to earn an Associate of Arts DTA (AA-DTA). Earning this degree assures you have completed the required courses to enroll in education courses at Heritage Universityfirstsemester. Transfer candidates who do not have an AA-DTA may Yakima Valley Community College, 2015-2016 5 5 5 5 5 5 5 2 2 5 5 3 5 5 Articulation Agreements with WSU: Associate in Arts DTA, Transfer to WSU BA in General Human Development ThisprogramisajointeffortbetweenYVCCandWSUto provide coursework for earning a Baccalaureate degree inGeneralHumanDevelopment.Studentstakespecific coursework while earning an Associate of Arts - DTA (AADTA) from YVCC. Courses must appear on the YVCC course distribution list to meet requirements. This articulation agreement is currently under revision. Please see Education advisor for current information. This articulation agreement is currently under revision. Please see Education advisor for current information. Associate in Arts DTA, Transfer to WSU BA in Human Development: Preschool - Third Grade Certification (P-3) ThisprogramisajointeffortbetweenYVCCandWSUto provide coursework for earning a baccalaureate degree in HumanDevelopment.Studentstakespecificcoursework while earning an Associate of Arts - DTA (AA-DTA) from YVCC. Courses must appear on the YVCC course distribution list to meet requirements. Articulation - WSU Some WSU coursework after transfer must be taken at the Pullman campus. Basic Requirements :18 Credits Group A ENGL& 101 English Composition I 5 ENGL 102 English Composition II 5 Group B **MATH& 132 Mathematics for Elementary Education 2 5 Group C Any course meeting Group C distribution 3 Humanities: 15 Credits **CMST& 210 Interpersonal Communications 5 ENGL 203 The Research Paper 3 Natural Sciences: 15 Credits Students intending to transfer without earning the AA degree will need a physical science and biological science course in this distribution area. The following courses are recommended but not required: BIOL 105 Biology for Non-majors 5 ASTR& 100 Survey of Astronomy (suggested) 5 NUTR& 101 Nutrition 5 Social Sciences: 15 Credits **HIST& 136 US History I or HIST& 137: US History II 5 PSYC& 100 General Psychology 5 Electives: 19 Credits ** MATH& 131 Mathematics for Elementary Education 1 5 Note: Students are allowed to transfer 90 credits (60 semester credits). Therefore, 12 credits of the following will count toward transfer. ECED 202 Educational Linguistics 3 ECED 260 Vocational Preschool Teacher Practicum 4 ECED& 160 Curriculum Development 5 ECED& 190 Observation & Assessment 3 EDUC& 115 Child Development 5 Total Credits 98 **MustbetakentoapplyforcertificationintotheP-3 Certificateprogram. A minimum 2.7 GPA is required for application for certificationintheP-3program.Aminimum2.5GPAis required for all ECE courses listed above that will transfer to WSU to satisfy the human development degree requirements. WSU indicates the following: “The P-3 option is a selective degree option and transfer to the WSU department under this agreement does not qualify the student to be accepted into the P-3 degree option nor imply acceptance by the College of Education.” Certificates Criminal History Information Prior to enrolling in a practicum course, criminal history information will be requested of students enrolling in the education program practicums. Information obtained fromthisinquirywillbetreatedconfidentiallyandwill be considered in determining the student’s eligibility to complete clinical competencies. Inability to participate in clinical experience due to information obtained from the Washington State Patrol and DSHS criminal history and background inquiry may result in a student’s inability to satisfactorily complete program degree requirements.Formorespecificinformation,contactthe program coordinator. ECED Initial State Certificate Required Courses Credits ECED& 105 Introduction to Early Childhood Education 5 ECED& 107 Health, Safety, and Nutrition 5 ECED& 120 Practicum-Focus on Relationships & Communications 2 Total Credits 12 Students must earn a grade of C (2.0) or better in all courses inordertobeawardedthecertificate.Besuretocheck with an Education Department advisor to get the latest information. ECE Short Certificate of Specialization Required Courses InitialStateCertificateplus: Early Childhood Education (General) EDUC& 115 Child Development 5 EDUC& 130 Guiding Behavior 3 OR Infant-Toddler Care ECED& 132 Infants & Toddlers - Nurturing Care 3 EDUC& 115 Child Development 5 OR School Age Care EDUC& 115 Child Development 5 EDUC& 136 School Age Care 3 OR Family Child Care ECED& 134 Family Child Care Management 3 EDUC& 115 Child Development 5 OR Administration ECED& 139 Administration of Early Learning Programs 3 EDUC& 115 Child Development 5 Total Credits 20 Students must earn a grade of C (2.0) or better in all courses inordertobeawardedthecertificate.Besuretocheck with an Education Department advisor to get the latest information. State Early Childhood Education Certificate Required Courses Credits Initial&ShortCertificatesplus27creditsfromthefollowing: English 101 or above 5 Math Quantitative/Computational above 100 or designated “Q/SR” 5 ECED& 160 Curriculum Development 5 ECED& 170 Environments for Young Children or EDUC& 130: Guiding Behavior 3 ECED& 180 Language & Literacy 3 ECED& 190 Observation & Assessment 3 EDUC& 150 Child, Family & Community Total Credits 47 Students must earn a grade of C (2.0) or better in all courses inordertobeawardedthecertificate.Besuretocheck with an Education department advisor to get the latest information. STARS Training Washington State Training & Registry System Child care providers in homes, centers, and after-school programs must take the 20-hour basic training requirement andavarietyofothercoursesthatfulfillthe10-hour continuing education requirement. Courses for the 10-hour STARS requirement include the following: Courses Credits ECED 105 Child Abuse & Neglect 2 ECED 106 Math for Preschool Teachers 2 ECED 107 Science for Preschool Teachers 2 ECED 108 Developing Competence in Child Care 2 ECED 109 Health for Preschool Teachers 1 ECED113 ManagingDifficultBehaviors 1 ECED 114 Brain Development & Young Child 1 ECED 116 Kindergarten Readiness 1 ECED& 132 Infants & Toddlers - Nurturing Care 3 ECED&139 Administration of Early Learning Programs 3 ECED& 160 Curriculum Development 5 ECED& 180 Language & Literacy Development 3 New courses are in development. Consult the current scheduleforofferings.AnyoftheECEDcoursesatYVCCmay count toward the required STARS 10-hour yearly training requirement. Credits Yakima Valley Community College, 2015-2016 123 124 Courses Includes early childhood education, education track for K-8, school-age care, para-educator, and special education courses. Early Childhood Education ECED 098, 198, 298: Experimental/Exploratory Studies Variable Quarters: O Experimental/exploratory studies in early childhood education. ECED& 100: Child Care Basics 3 Cr Quarters: F, W, S This course is designed to meet the STARS 30-hour basic training outcomes for early childhood and school age professionals recognized in the MERIT system. Topics: child growth/development, cultural competency, guidance, and health/safety/nutrition. ECED 105: Child Abuse & Neglect 2 Cr Quarters: F, W, S This course will assist the participant in the development of skills for working with children from abusive or neglectful home environments. Using theory, research, and practice, participants will understand, recognize, and assess child abuse and neglect issues and become aware of prevention programs currently available and how these can be implemented in the classroom. ECED& 105: Introduction to Early Childhood Education 5 Cr Quarters: F, W, S, SR Explore the foundations of early childhood education. Examinetheoriesdefiningthefield,issuesandtrends, best practices, and program models. Observe children, professionals, and programs in action. ECED 106: Math for Preschool Teachers 2 Cr Quarters: F, W, S This is the math section of a series of early childhood courses designed to give discipline content and teaching methodology to preschool teachers to expand their knowledge and application of math concepts. ECED 107: Science for Preschool Teachers 2 Cr Quarters: F, W, S This is the science section of a series of early childhood courses designed to give discipline content and teaching methodology to preschool teachers to expand their knowledge and application of science. ECED& 107: Health, Safety, and Nutrition 5 Cr Quarters: F, W, S, SR Develop knowledge and skills to ensure good health, nutrition, and safety of children in group care and education programs. Recognize the signs of abuse and neglect, responsibilities for mandated reporting , and available community resources. ECED 109: Health for Preschool Teachers 1 Cr Quarters: F This course explores the health issues of the preschool child. The areas on which this class focuses are health forms and policies, communicable diseases, medication and safety, child abuse, dental, and other concerns. Referral services in Central Washington are explored. Yakima Valley Community College, 2015-2016 ECED 111: Curriculum for Childcare 1 Cr Quarters: O This course will provide a brief and basic overview of typical childdevelopmentfrombirthtofiveyearswhileintegrating developmentally-appropriate curriculum for children. It will emphasize the Washington State Core Competencies in creating curriculum for children. ECED 113: Managing Difficult Behavior 1 Cr Quarters: W This course will provide a basic understanding of guidance and discipline in the context of normally-developing children frombirthtofiveyearsofage.Thecoursewillemphasizethe National Association for the Education of Young Children’s codeofethicsindevelopingstrategiestomanagedifficult behaviors. ECED 114: Brain Development in Young Child 1 Cr Quarters: S This course analyzes current research that demonstrates how children’s earliest experiences and relationships make a significantdifferenceinthewaytheirbrainsdevelop. ECED 116: Kindergarten Readiness 1 Cr Quarters: F This course is designed to focus on the skills that help prepare children for a successful entry into kindergarten. Included are techniques and strategies to use when working with children, keeping in mind developmentally and culturally appropriate practices, the Washington State Essential Academic Learning Standards, and school district recommendations. This course also meets the ten-hour professional development requirement for STARS training. ECED 117: School-age Care for Child Care Providers 1 Cr Quarters: W This course is designed to focus on developmentally appropriate care for school-age children. It will include techniques and strategies to use when working with school-age children, keeping in mind developmentally and culturally appropriate practices, the Washington State Essential Academic Learning Standards, and school district recommendations. This course also meets the ten-hour professional development for STARS training. ECED 118: Multicultural Preschool Literature 1 Cr Quarters: F, S This course is designed from a constructionist framework. The students will preview and work with multicultural literature that is intended for preschoolers and discover a multitude of ways to incorporate literature into the preschool classroom. ECED& 120: Practicum-Focus on Relationships & Communication 2 Cr Quarters: F, W, S, SR In an early learning setting, apply best practice for engaging in nurturing relationships with children. Focus on keeping children healthy and safe while promoting growth and development. ECED& 132: Infants & Toddlers-Nurturing Care 3 Cr Quarters: F, W Examine the unique developmental needs of infants and toddlers. Study the role of the caregiver, relationships with families, developmentally appropriate practices, nurturing environments for infants and toddlers, and culturally relevant care. ECED& 134: Family Child Care 3 Cr Quarters: S Learn the basics of home/family child care program management. Topics include: licensing requirements; business management; relationship building; health, safety, and nutrition; guiding behavior; and promoting growth and development. ECED& 139: Administration of Early Learning Programs 3 Cr Quarters: S Develop administrative skills required to develop, open, operate, manage, and assess early childhood education and care programs. Explore techniques and resources available for Washington State licensing and National Association for the Education of Young Children (NAEYC) standard compliance. ECED 156: Infant/Toddler Curriculum and Guidance Practicum 1 Cr Quarters: W, S Thispracticumoffersthestudentanopportunitytoobserve and interact with infants and toddlers in a supervised and licensed childcare setting. Prerequisite: Successful completion of or concurrent enrollment in ECED 104 and permission of instructor ECED 160: Preschool Instructional Assistant Practicum 2 Cr Quarters: W, S Students observe and interact with young children in approved ECED settings. The emphasis is on professional teambehaviorandreflectiononthecharacteristicsof young children and their learning environments. Students participate in and direct early childhood activities with individuals and groups of young children. Prerequisite: Successful completion of or concurrent enrollment in ECED 101 and permission of instructor ECED& 160: Curriculum Development 5 Cr Quarters: F, W, S Investigate learning theory, program planning, and tools for curriculumdevelopmentpromotinglanguage,fine/gross motor, social-emotional, cognitive and creative skills, and growth in young children (birth-age 8). ECED 170: Child Development Associate I Preschool 5 Cr Quarters: W Thiscoursefulfillsthefirsthalfoftheeducationalcomponent requirement of the Council of Early Childhood Professional Recognition for obtaining national professional Child Development Associate (CDA) credentials. Students desiring CDA credentials are assessed, using the CDA national competency standards for preschool, which include the criteria used to evaluate a caregiver’s performance with children and families. This class will cover Competency Goals I (to establish a safe, healthy learning environment) and II (to advance physical and intellectual competence) and the collectionandorganizationofaresourcefileforCDAGoalsI, II, and III. ECED& 170: Environments for Young Children 3 Cr Quarters: F, W, S Design, evaluate, and improve indoor and outdoor environments which ensure quality learning, nurturing, experiences, and optimize the development of young children. ECED& 180: Language and Literacy Development 3 Cr Quarters: F, W, S, SR Develop teaching strategies for language acquisition and literacy skill development at each developmental stage (birth-age eight) through the four interrelated areas of speaking, listening, writing, and reading. ECED 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: O Students are required to make application for the class, be approved, and contract with their employer for college credit. Students will submit biweekly reports on the training process experienced throughout the quarter. An employer evaluation, appraising the student’s progress, will be required. Prerequisite: Permission of instructor ECED& 190: Observation and Assessment 3 Cr Quarters: F, W Collect and record observation of and assessment data in order to plan for and support the child, the family, the group,andthecommunity.Practicereflectiontechniques, summarizingconclusions,andcommunicatingfindings. ECED 199: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor ECED 201: Issues & Trends in Early Childhood Education 3 Cr Quarters: O This course will focus on current issues that impact early childhood education. The topics will include multicultural education and issues, including diversity and anti-bias curriculum; special-needs children (education) and inclusion; family systems today; and child abuse/violence. Emphasis will be placed on the current issues and trends in each area as well as resources available to ECED professionals. Prerequisite: Eligibility for ENGL 095 or eligibility for READ 105 ECED 206: Professionalism & Portfolio 1 Cr Quarters: S Focuses on the development of a professional portfolio that demonstrates the student’s achievement of skill standards inthefieldofearlychildhoodeducation.Worksamplesfrom ECED courses are selected, along with other supporting documents, and arranged professionally in a portfolio. Thestudentreflectsuponpersonalachievementofskill standards and presents the portfolio to a panel of early childhood education professionals. Prerequisite: Permission of instructor ECED 260: Vocational Preschool Teacher Practicum 4 Cr Quarters: W, S Students in this course apply knowledge of developmentally and culturally appropriate guidance and teaching techniques with preschool-age children. They plan, implement, and evaluate teaching and behavioral plans in early childhood settings.Studentsworkaspartofateachingstaffinan approved early childhood practicum site. Prerequisite: ECED 100, ECED 120, ECED 150, and ECED 160 and permission of instructor ECED 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: O This class creates a bridge between real work experiences and the college education curriculum. Co-op links the student’s academic program with career goals and interests. It extends the classroom and provides an educational experience that meets the various interests, needs, and abilities of the student. Students receive academic credit ranging from one to ten credits, and, in most cases, a salary from an employer. Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 125 126 Education EDUC 101: Application of Critical Reading & Thinking in Children’s Literature for Paraprofessionals 5 Cr Quarters: F Designed to teach paraprofessionals strategies in assisting students in becoming more critical readers of and thinkers about children’s literature. The strategies will support the Washington State Essential Academic Learning Requirements for each grade level represented by the literature for the grade level for the paraprofessional working in that classroom. Prerequisite: Eligibility for READ 105 EDUC 102: Parent Community & Volunteers 5 Cr Quarters: W This course will assist the participant in the development of skills for working with children, youth, their families, and the community. Using theory, research, and practice, participants will understand, recognize, and assess the importance,value,andbenefitsofthecollaborationof parents, communities, teachers, and volunteers working togethertoapplytheelementsofaneffectivelearning environment for optimal learning for children. Students will gain an understanding of the value of providing educational and support services to all children, youth, and their families in a diverse community. Prerequisite: Eligibility for ENGL 095 or eligibility for READ 105 EDUC 103: Guiding Behavior: School-Age Child 5 Cr Quarters: S This course examines the principles and theories that promote social competence, including how to develop effectivemethodsofcommunication,groupmanagement, positiveguidancetechniques,facilitationofconflict resolutions, social skill building, life skills, problem solving, the role of culture in guidance, observation techniques, and the building of meaningful relationships. Prerequisite: Eligibility for ENGL 090T or eligibility for READ 105 EDUC& 115: Child Development 5 Cr Quarters: O Build a functional understanding of the foundation of child development, prenatal to early adolescence. Observe and document physical, social, emotional, and cognitive developmentofchildren,reflectiveofcross-culturaland global perspectives. EDUC 111: Careers in Education/Early Childhood 2 Cr Quarters: F, W, S This course explores the foundation of careers in education and early childhood education. Students will explore the differentstateandfederalrequirementsinavarietyof careeroptionswithinthesefieldsofstudy.Itwillassurethat students choose and begin a seamless and clear education pathwaytowardscertificatesand/ordegreesoftheirchoice. EDUC 117: Multicultural Children’s Literature 1 Cr Quarters: F ThisisaSTARSclassandisintendedtoofferreaders, childcare providers, elementary school teachers, and parents an invitation to explore literature that presents and encourages a window to the diverse world we and the children we know live in. By looking at child readiness and materials available, we will work, explore, evaluate, and delight in the literature that brings the word and the world to life for our young. Yakima Valley Community College, 2015-2016 EDUC& 130: Guiding Behavior 3 Cr Quarters: F Examine the principles and theories promoting social competence in young children and creating safe learning environments.Developskillspromotingeffective interactions, providing positive individual guidance, and enhancing group experiences. EDUC& 136: School-Age Care 3 Cr Quarters: F, S Develop skills to provide developmentally appropriate and culturallyrelevantactivitiesandcare,specifically:preparing the environment, implementing curriculum, building relationships, guiding academic/social skill development, and community outreach. EDUC& 150: Child, Family, and Community 3 Cr Quarters: O Students working with children ages birth to eight years and their families will learn how to integrate the family and community contexts in which a child develops. The students will learn how to explore cultures and demographics of families in society, community resources, strategies for involving families in the education of their child, and tools for effectivecommunication. EDUC 201: Development of the School-Age Child 4 Cr Quarters: F, W, S This course is designed to give students a brief overview of the developmentally appropriate characteristics of children from birth to four years old. It will give students a more in-depth study of the development of school-age children fromfiveto14yearsold.Studentswillstudytheoristsand researchers and their theories of how children develop and learn during the school-age years. The course will also give anoverviewoftheinfluenceofcultureinthedevelopment of the child, family systems, and basic nutrition. Students will take a more in-depth look at pinpointing special needs and at-risk children. This course will also provide students with an awareness of how the role of play is important in the development and learning of a child. Prerequisite: Concurrent enrollment in ENGL 095 or eligibility for ENGL& 101 or eligibility for READ 105 EDUC 202: Educational Linguistics 5 Cr Quarters: F, W, S, SR This course is designed from a constructionist framework, emphasizing learning and language acquisition using a Vygotskian approach to aid in the teaching of reading in the K-8 grades in schools. Prerequisite: ENGL& 101 or eligibility for READ 105 EDUC 210: Introduction to Becoming a Teacher 5 Cr Quarters: F, W, S, SR Thiscourseisdesignedforstudentsinterestedinthefieldof education. It provides an overview of education in America, covering the historical, philosophical, and social foundations of education. Students will study current issues and trends in curriculum, instructional strategies, teaching as a profession, local concerns, and the future of education. They will also study a teacher’s role and function in the school, the characteristics of a good teacher, and preparation for professionalcompetenciesandcertification.Opportunities are provided for observation and integration of information as it relates to K-12 education. Prerequisite: Concurrent enrollment in ENGL 095 or eligibility for ENGL& 101 EDUC 250: Public School Practicum 4 Cr Quarters: W, S This course was designed for students wishing to enter the fieldofeducation.Studentswillbecomemorepedagogically diverse as they receive a hands-on approach to education while working directly with teachers, administrators, para-educators, clerical personnel, students, and parents. Students will learn the importance of teaching in a variety of environments that include changing cultures, increasing numbers of children living in poverty and facing health problems, homelessness, disrupted family lives, and increasing language diversity. This class is based on the constructivist learning model and philosophy. Prerequisite: Successful completion of or concurrent enrollment in ENGL& 101, successful completion of EDUC 210, and permission of instructor Special Education SPED 200: Intro to Exceptionality in Early Childhood Ed 5 Cr Quarters: F This course provides an introduction to normal and exceptional development, including causes and categories of disabilities and delays, the IFSP/IEP process, and an overview of the legislation behind early intervention and the prevention of delays and disabilities in young children. SPED 201: Intervention Strategies for Infants & Toddlers 5 Cr Quarters: W This course provides an overview of intervention strategies for infants and toddlers with developmental disabilities or developmental delays and for children who are at risk for developing delays and/or disabilities. A team approach to intervention strategies is emphasized. SPED 202: Inclusion in Early Childhood Education 5 Cr Quarters: S This course provides an overview of including children with developmental disabilities or delays in early childhood settings. The course provides students with strategies and techniques that will help them develop partnerships with parents; design, create, and adapt environments that support children with disabilities in early childhood settings; and develop their own philosophy on inclusion in early childhood. SPED 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor Engineering/CADD TheEngineeringprogramofferstwodifferentAssociate of Applied Science degrees, Construction Design/CADD Technology and Civil Engineering Technology. The Associate inScience-Transferdegree,Track2isalsoofferedfor engineeringtransferstudents.Twocertificates,Draftingand Machining Technology, are also available for all engineering students. Program Outcomes Upon successful completion of this program the student should be able to: • Ability to apply current knowledge and applications of mathematics, science, engineering, and technology. • Ability to identify, formulate, and analyze and solve technical and engineering problems. • Ability to use the techniques, skills, and modern engineering tools necessary for engineering practice. • Ability to function on multi-disciplinary teams. • Ability to communicate knowledge in written and oral form. Careers Employment opportunities for engineering transfer students who complete their bachelor’s degrees include all aspects of design and manufacturing. Students can choose from a wide variety of engineering disciplines including aeronautical, civil, environmental, mechanical, materials, electrical, and others. Engineering Technology students learn skills intended to help them seek jobs within the construction and manufacturing industries. Many local, state, and federal agencies that are responsible for our public infrastructures employ our graduates. Present trends indicate that the prospectforfutureemploymentisverybrightinanyfieldof engineering or engineering technology. Degrees YVCC’sEngineeringDepartmentoffersthesedegrees: • Associate of Applied Science in Construction Design • Associate of Applied Science in Civil Engineering Technology • Associate of Applied Science in Aerospace Machining Technology • Associate in Science - Transfer Track 2 Associate of Applied Science in Construction Design YVCCoffersanAssociateofAppliedScienceinConstruction Design degree. In this program, students will demonstrate professional-level skills on AutoCAD. They will also learn many skills essential to the light construction trade. Many CAD courses use a drawing studio format, and students create portfolios of their work as a basic course or program goal. With this degree, students will be highly competitive with respect to job placement in the construction designfield. Required Courses Credits BA 138 Written Business Communication 5 or PTECH 120: Technical Writing or ENGL& 101: English Composition I ENGR 101 Project Management 5 ENGR 104 Engineering Graphics 5 ENGR 110 CAD I 3 ENGR 111 Mechanical CAD 3 ENGR 112 3-D CAD 3 ENGR 115 Blueprint Reading & Drafting Standards 2 ENGR 118 Microstation 2-D 4 ENGR 132 Problem Analysis 5 *ENGR 190-193 Co-op Field Experience I, II, III, IV 4 ENGR 200 Plane Survey 3 ENGR 222 Regulatory Forms 2 Yakima Valley Community College, 2015-2016 127 128 *ENGR 230-232 Engineering Design Project 5 ENGR 251 Estimates & Costs 4 ENGR 260 Soils & Foundations 4 ENGR 263 Structures 4 ENGR 266 Advanced Surveying 2 ENGR 267 Geographic Information Systems (GIS) 2 ENGR 268 AutoCAD Civil 3-D 4 ENGR 282 Building Code 3 ENGR 283 Building Systems 3 ENGR 287 Microstation 3-D 3 ENGR 286 Structural CAD 4 MATH& 141 Precalculus I 5 MATH& 142 Precalculus II 5 PHYS 115 General Physics I Lecture 3 PHYS 125 General Physics I Lab 2 PHYS 116 General Physics II Lecture 3 PHYS 126 General Physics II Lab 2 **Elective 3 Total Credits 108 * Choose 9 credits from ENGR 230, 231, 232 or ENGR 190, 191, 192, 193. ** Choose 3 credits from ENGR 160,; IT 100, 111, 115, 221. ** Choose 4 credits from the following ENGR 160, 287; IT 100, 111, 115, 221. Associate in Science - Transfer Track 2 To begin the two-year engineering transfer emphasis program at YVCC, students should have completed the following courses or their equivalencies in high school: mathematics through precalculus, one year of chemistry, one physics course, two years of foreign language, and four years of English composition. Students who have not completed the courses listed above should take the following necessary equivalent preparation courses before beginning the transfer program: Associate of Applied Science in Civil Engineering Technology The Civil Engineering Technology program is designed for persons planning to enter the engineering profession at the technician level. The program is designed with input from a local engineering advisory board in order to best meet the needs of community employers. Technicians at YVCC learn specialized skills that include plan-reading, surveying, computer drafting, materials testing, estimating, scheduling, and using engineering design software. Promising careers exist with municipal, state, and federal agencies, engineeringandconstructionfirms,publicutilities,andlocal manufacturers. Courses Credits CHEM 100 Introduction to Chemistry 5 ENGL 095 Reviewing English Essentials II 5 MATH& 141 Precalculus I 5 MATH& 142 Precalculus II 5 YVCC’sEngineeringdepartmentoffersanAssociateof Science DTA, Track 2 degree which serves those students intending to complete the required coursework for the Bachelor of Science in Engineering programs at Washington State University, University of Washington, or similar programs at other universities. This Associate of Science DTA, Track 2 degree contains a concentration of coursework in math, physics, chemistry, and engineering. Students attempting the Associate of Science DTA, Track 2 degree are expected to follow the curriculum outlined belowwhichparallelsthefirsttwoyearsofstudyforseveral engineering disciplines at four-year institutions. Upon completion of the Associate of Science DTA , Track 2 degree, students should be able to enter with junior standing in the following programs: mechanical engineering, civil engineering, industrial engineering, materials engineering, environmental engineering. Required Courses Credits BA 138 Written Business Communication 5 or PTECH 120: Technical Writing or ENGL& 101: English Composition I ENGR 101 Project Management 5 ENGR 104 Engineering Graphics 5 ENGR 110 CAD I 3 ENGR 111 Mechanical CAD 3 ENGR 112 3-D CAD 3 ENGR 115 Blueprint Reading & Drafting Standards 2 ENGR 118 Microstation 2-D 4 ENGR 132 Problem Analysis 5 *ENGR 190-193 Co-op Field Experience I, II, III, IV 5 ENGR 200 Plane Survey 3 ENGR 210 Applied Hydraulics 5 ENGR 220 Environmental Engineer Tech 5 ENGR 222 Regulatory Forms 2 *ENGR 230-232 Engineering Design Project 5 ENGR 251 Estimates & Costs 4 ENGR 260 Soils & Foundations 4 ENGR 262 Roadway Construction & Design 3 ENGR 263 Structures 4 ENGR 266 Advanced Surveying 2 ENGR 267 Geographic Information Systems (GIS) 2 ENGR 268 AutoCAD Civil 3-D 4 ENGR 277 InRoads 2 MATH& 141 Precalculus I 5 PHYS 115 General Physics I Lecture 3 PHYS 116 General Physics II Lecture 3 PHYS 125 General Physics I Lab 2 PHYS 126 General Physics II Lab 2 **Elective 4 Total Credits 104 * Choose 10 credits from ENGR 230, 231, 232 or ENGR 190, 191, 192, 193. Courses First Year - Fall CHEM& 141 General Chemistry I CHEM& 151 General Chemistry I Lab ENGL& 101 English Composition I MATH& 151 Calculus I ENGR 100 Introduction to Engineering & Design Total Credits First Year - Winter CHEM& 142 General Chemistry II Lecture CHEM& 152 General Chemistry II Lab MATH& 152 Calculus II Approved Social Sciences Elective Approved Humanities Elective Total Credits First Year - Spring CHEM& 143 General Chemistry III CHEM& 153 General Chemistry III Lab IT 174 C++ Introduction ENGR 108 Engineering Graphics & CAD I MATH& 153 Calculus III Total Credits First Year - Summer ECON& 202 Macro Economics Approved Communication Elective Approved Humanities Elective Total Credits Second Year - Fall ENGR& 114 Engineering CAD & Visualization ENGR& 214 Statics MATH& 254 Calculus IV PHYS 211 Engineering Physics I Lecture PHYS 221 Engineering Physics I Lab Total Credits Second Year - Winter Yakima Valley Community College, 2015-2016 Credits 3 2 5 5 2 17 3 2 5 5 3 18 3 2 5 3 5 18 5 5 4 14 4 5 5 3 2 19 ENGR& 215 MATH 220 PHYS 212 PHYS 222 Dynamics 5 Linear Algebra 5 Engineering Physics II Lecture 3 Engineering Physics II Lab 2 Approved Humanities Elective 3 Total Credits 18 Second Year - Spring ENGR& 225 Mechanics of Materials 5 MATH264 DifferentialEquations 5 PHYS 213 Engineering Physics III Lecture 3 PHYS 223 Engineering Physics III Lab 2 Total Credits 15 In view of varying transferable coursework requirements, students in the transfer emphasis program are strongly urged to be in close contact with their advisor throughout their stay at YVCC. YVCC Classes : WSU Equivalents CHEM& 141/151, 142/152, 143/153: CHEM 105L, 106L ECON& 202: ECON 102 ENGR& 214, 215, 225: CE 211, 212, 215 ENGL& 101: ENGL 101 MATH& 151, 152. 153: MATH 171, 172 MATH 220, 254, 264: MATH 220, 273, 315 PHYS 211/221, 212/222, & 213/223: PHYS 201L, 202L YVCC Classes : UW Equivalents CHEM& 141/151, 142/152: CHEM 140/141, 150/151 CHEM& 143/153: CHEM 160/161 ECON& 202: ECON 201 ENGR& 214, 215, 225: AA 210, ME 230, CIV-E 220 ENGL& 101: ENGL 131 MATH& 151, 152: MATH 124, 125 MATH 220, 254, 264: MATH 308, 1XX (3), & 2XX (4) PHYS 211/221, 212/222, 213/223: PHYS 121, 122, 123, 131, 132, 133 Bachelor of Science in Engineering at YVCC & WSUTC YakimaValleyCommunityCollegeandWSUTri-Citiesoffer an exciting program for students interested in earning a Bachelor of Science in Mechanical Engineering (ME), Electrical Engineering (EE) or Civil Engineering (CE). This program would allow an engineering transfer student, upon enrollment at YVCC, to receive priority registration at WSUTC. Priority registration assures ME students access to and enrollment in a bachelor’s of science engineering program. The BS degree would be awarded by WSUTC upon completion. Students who choose this option follow the Associate of Science - DTA, Track 2 program at YVCC. The second half of the program is taken at WSUTC where courses, laboratories, and research experience provide students with instruction specifictotheirengineeringdisciplines. Studentswhooptforthisprogramwillreceivebenefits that include: • Joint advising with YVCC and WSUTC. • Free transcript transfer. • Unique scholarship opportunities. • Consideration for a transfer achievement award (hundreds of dollars toward tuition at WSUTC). • Significantsavingsinoveralleducationalcosts. • Priority consideration for AWAR internships. Please contact the Engineering department for more information at the phone number listed in the front of this catalog. Certificates Drafting Theone-yearDraftingcertificateprogramprovidesentrylevel skills in the area of manual and computer-aided drafting.Theprogramfocusesonspecificoccupationalskills andissuitedforpersonswhofindithardtoattendcollegefor two years to acquire employable skills. The credits earned through this program can be applied to the Associate in Applied Science degree requirements for CivilEngineeringorComputerDrafting.Thefirst-yearclasses aretobetakenforthecertificate. Note:Theone-yeardraftingcertificateprogramisthefirst year of the AAS Construction Design and Civil Engineering Technology degrees. Required Courses Credits BA 138 Written Business Communication 5 or PTECH 120: Technical Writing or ENGL& 101: English Composition I ENGR 101 Project Management 5 ENGR 104 Engineering Graphics I 5 ENGR 110 CAD I 3 ENGR 111 Mechanical CAD 3 ENGR 112 3-D CAD 3 ENGR 115 Blueprint Reading & Drafting Standards 2 ENGR 118 CAD Engineering Design 4 ENGR 132 Problem Analysis 5 ENGR 200 Plane Surveying 3 ENGR 222 Regulatory Forms 2 ENGR 251 Estimates & Costs 4 MATH 095 Intermediate Algebra 5 Total Credits for Certificate 49 Courses ENGR 098, 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in engineering. ENGR 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Workshops, short courses, and individual study in engineering. ENGR 100: Introduction to Engineering and Design 2 Cr Quarters: F, S This introductory course examines many facets of the engineering profession. Students will be introduced to engineering design processes and challenged to use their creative and analytical reasoning abilities to solve hands-on problemsrelatedtothedifferentengineeringdisciplines. ENGR 101: Project Management 5 Cr Quarters: F This course is a comprehensive overview of engineering project management. It will emphasize the fundamental principles of contracts, plan reading, resource management, and human relations in the engineering workplace. ENGR 104: Engineering Graphics 5 Cr Quarters: F Fundamentals of orthographic projection, including auxiliary views and oblique drawings. Graphically represent points, lines, planes, and solids to describe real or imagined technical devices or objects. Prerequisite: Plane geometry in high school or permission of instructor ENGR 108: Engineering Graphics and CAD I 3 Cr Quarters: S This course emphasizes the fundamental principles of orthographic projection, freehand sketching, lettering, and dimensioning and scales. The theories of related views, sections, pictorial drawings, and descriptive geometry are included. Students are introduced to computer-aided and designed drafting. This course is intended for individuals who are in the engineering transfer program. Prerequisite: High school plane geometry, MATH& 141, MATH&142, or equivalent Yakima Valley Community College, 2015-2016 129 130 ENGR 110: CAD I 3 Cr Quarters: F, W This course introduces the fundamentals of two-dimensional orthographic projection drawing on the latest version of AutoCAD program. This class will introduce how to draw to scale and print out their work (color or B/W). The class is taught in a drawing studio format. ENGR 111: Mechanical CAD 3 Cr Quarters: S Students learn the essentials of mechanical drafting using a CAD software. Basic and geometric tolerances, layouts and detailing standards are discussed. Prerequisite: ENGR 110 ENGR 112: 3-D CAD 3 Cr Quarters: S The student would learn advanced AutoCAD drafting commands, would create 3-D models by extrusion, wireframes, 3-D surfaces and AME solids. Prerequisite: ENGR 110 with a B (3.0) or better ENGR& 114: Engineering Computer-Aided Design & Visualization 4 Cr Quarters: F During this course, the students learn 3-D solid modeling, parts, engineering drawings and assemblies; geometric dimensioning and tolerancing. They will learn 3-D visualization, computational analysis of parts and assemblies. Prerequisite: MATH& 151 ENGR 115: Blueprint Reading & Drafting Standards 2 Cr Quarters: W This is an introductory class to be able to read blueprints and understand construction terminologies from building plans. Understanding the basic drafting standards in engineering drawings. ENGR 118: Microstation 2-D 4 Cr Quarters: W Students will learn and apply basic CADD (Computer Aided Drafting and Design) fundamentals. They will learn the functions and capabilities of Bentley’s MicroStation. Prerequisite: ENGR 110 ENGR 132: Problem Analysis 5 Cr Quarters: W The student will solve engineering problems by analyzing dataandfindingsolutionsusinggeometry,trigonometry, and algebra; present solutions in a written format that may include the use of models, graphs, and drawings; and use statistical analysis to interpret data and ensure accuracy. Prerequisite: MATH 095 or permission of instructor ENGR 160: Introduction to Revit Architecture 3 Cr Quarters: S This course id designed to teach the students the Revit functionality. REvit Architecture software is a powerful Building Information Modeling (BIM) program that works the way architects think. From preliminary design through design development and into construction documents, the program streamlines the design process with a central 3-D model. Prerequisite: ENGR 110 Yakima Valley Community College, 2015-2016 ENGR 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: O On-the-job training experiences with the engineering faculty assisting the student in analyzing, applying, and instituting engineering theory through actual practice. Variable credit is determined by the number of hours a student works per week. A minimum of one student-instructor contact hour is required per week. Prerequisite: Permission of instructor ENGR 200: Plane Survey 3 Cr Quarters: S A classic course in the fundamentals of surveying. The students would learn the theory of surveying; the use and care of surveying instruments; measurement of distances, elevation, and directions; and determination of land and area. Prerequisite: ENGR 132 or permission of instructor ENGR 210: Applied Hydraulics 5 Cr Quarters: F This is a classic course in water mechanics. The principles of laminarandturbulentflow,openchannelandclosedconduit flow,andhydraulicequipmentareemphasized.Thecourse is designed for the engineering student who is in the CET program. Classes will be a combination of lecture, discussion, fieldtrips,andvarioussampleexercises. Prerequisite: MATH& 141 ENGR& 214: Statics 5 Cr Quarters: F Classic course in engineering statics using vector algebra. Two-dimensional and three-dimensional space forms, resultants, equivalent force systems, moments, couples, analysis of structures, members, and centroids, as well as equilibrium, friction, and moment of inertia. Prerequisite: Successful completion of or concurrent enrollment in MATH& 152 or permission of instructor ENGR& 215: Dynamics 5 Cr Quarters: W A general treatment of dynamics in particles of rigid bodies using vector analysis, icinematics, and kinetics. Momentum and energy principles for particles and rigid bodies are studied. Prerequisite: ENGR& 214 ENGR 220: Environmental Engineering Technology 5 Cr Quarters: F Principles of collection and distribution of water, including pumps and pumping stations, techniques in water treatment, principles of sewage collection, types of sewer pipes, sewage treatment processes and types of plants, influentandeffluentanalysis,andreviewofindustrial wastes. Prerequisite: MATH& 141 or permission of instructor ENGR 222: Regulatory Forms for Construction 2 Cr Quarters: W This course introduces students to many of the regulatory forms required for nonresidential building projects. Documents for study include SEPA, JARPA, EIS, Stormwater General, 20 CFR 1926 OSHA forms, and county building permits. ENGR& 225: Mechanics of Materials 5 Cr Quarters: S An introduction to the mechanics of solids, strain and deformation, stress-strain relationships, torsion, and stresses due to bending. Prerequisite: ENGR& 214 ENGR 230, 231, 232: Engineering Design Project 5 Cr Quarters: F, W, S Studentswillpreparespecificationsforarealengineering project. This course is intended to give second-year engineering technology and construction design students an opportunity to use their abilities in project conception and design with the aid of CAD, surveying equipment, and other engineering tools. ENGR 251: Estimates and Costs 4 Cr Quarters: W Preparing quantity and cost estimates from plans for engineering projects. The class studies current costs of common construction materials, earthwork, and excavation costs. Critical Path Method (CPM) of planning and scheduling. Prerequisite: MATH 085 ENGR 260: Soils and Foundations 4 Cr Quarters: W Weight/volume relationships, index properties, bearing strengths of various soils, types and use of soils, as well as settlement and compaction, footings and retaining structures, lab equipment, and interpretation of soil tests. Prerequisite: MATH& 141 ENGR 262: Roadway Design and Construction 3 Cr Quarters: S Constructionmaterials,soils,drainageandfillsaswellas grading and preparation of roadway subgrade. Design and construction of roadway surfaces, including asphalt and concrete, and safety in design. Prerequisite: MATH& 141 ENGR 263: Basic Structural Design 4 Cr Quarters: W This course will include design and construction of roadway surfaces including asphalt and concrete. This course introduces students to construction materials, drainage and fills,aswellasgradingandpreparationofroadwaysubgrade. Prerequisite: MATH& 141 or permission of instructor ENGR 266: Advanced Surveying 2 Cr Quarters: S This course provides an advanced understanding of surveying, measuring distances, elevations, and directions using a total surveying station. Students learn construction staking and surveying of plots and land. Prerequisite: ENGR 200 and concurrent enrollment in ENGR 268 or permission of instructor ENGR 277: InRoads 2 Cr Quarters: S Students will learn and apply basic roadway geometric fundamentals. Students will also learn the functionality and capabilities of Bentley’s InRoads CAD program to design roadways. Prerequisite: ENGR 118 or permission of instructor ENGR 282: Building Code 3 Cr Quarters: W A study of the International Building Code and local building codes as they pertain to residential and light commercial construction. Prerequisite: ENGR 101 or permission of instructor ENGR 283: Building Systems 3 Cr Quarters: S An introduction to the design and drawing of service systems in residential and light commercial construction. Systems that will be studied include plumbing, HVAC, electrical and electronic,firesuppression,andintercommunication. Students will use AutoCAD to complete system drawings. Prerequisite: ENGR 101 and ENGR 110 ENGR 286: Structural CAD 4 Cr Quarters: F Students will learn structural terminology, design requirements, and documentation procedures to produce shop and erection drawings. They will gain a comprehensive understanding of major building materials and construction methods for commercial structures. Prerequisite: ENGR 112 or permission of instructor ENGR 287: Microstation 3-D 3 Cr Quarters: S Students will apply 3-D CADD (Computer Aided Drafting & Design) fundamentals using Microstation CAD program. Prerequisite: ENGR 118 Engineering - Machining Technology See "Aerospace Machining Technology" ENGR 267: Geographic Information Systems (GIS) 2 Cr Quarters: S IntroductiontoGISanditsrelationshiptothesurveyingfield. Study will include assessing, querying, editing, and classifying spatial data; analyzing spatial relationships; and presenting information through chart and map layout creation. Prerequisite: ENGR 200 or permission of instructor ENGR 268: AutoCAD Civil 3D 4 Cr Quarters: S Students learn the essentials of AutoCAD Civil 3D software which enables them to deliver higher-quality transportation, land developments, and environmental engineering projects. Prerequisite: ENGR 110 and ENGR 200 Yakima Valley Community College, 2015-2016 131 132 English The mission of the English department is to help students develop the habits of writers, readers, and critical thinkers as well as further their interest in reading and writing as a way of learning about themselves and the world. Most YVCC students will take college composition courses ranging from ENGL 090T: Reviewing English Essentials I to ENGL 102: English Composition II. Most transfer degrees require completion of ENGL& 101 and ENGL 102 with a C (2.0) or better in both courses. YVCC placement scores determine initial placement in composition courses. Since a solid foundation in reading, writing, and critical thinking is necessary for student success, students who place in ENGL 090T generally must complete ENGL 090T and 095 before entering ENGL& 101. Consult with an advisor for placementinthecompositionseriesandforspecificdegree requirements. To become more competent college writers, students planning to transfer to a four-year college or university often takeENGL203:TheResearchPaperwhichalsosatisfiesthree credits of basic requirements. Other English Courses Inadditiontothecompositioncourses,YVCCoffersarange of creative writing and literature survey courses taught by the department’s writers and its literature experts. Students who wish to enroll in a 100-level literature course must be eligible for ENGL& 101. Students who wish to enroll in a 200-level literature course must have completed ENGL& 101. Consult the list of courses below for any other prerequisites. Writing Centers at YVCC To support student success in writing for any discipline, the English department houses two writing centers, one on the Yakima Campus in Glenn Anthon G125 and one on the Grandview Campus in L117. As student-centered facilities, the writing centers are writing communities with consultants trained to help YVCC students with any aspect of writing, fromgatheringideastofinalizingapaperorotherwriting projects. Research shows that regular use of writing center services helps to improve student performance on writing assignments. Students also can earn credit for meeting with consultants weekly or for working as peer consultants. Current hours for the Writing Centers in Yakima and Grandview are listed on the Writing Center website, www. YVCC.edu/Owl English Placement Policy Students are placed in the English sequence by YVCC testing. Those students placed in ENGL 090T and ENGL 095 earn grades of S, CR, or NC with a few students continuing to earn an I, V, or W. Students in these courses are required to earn a grade of S in order to advance to the next class. Information about the English department policy on retesting is available at the YVCC Testing Center in the Deccio Higher Education Center. Once a student enters the composition sequence, s/he may not retest. Courses ENGL 080: Composing on Computers 2 Cr Quarters: O English 080 is a two-credit course that can stand alone or be linked to an existing developmental writing course (ENGL 090T or ENGL 095). Students will learn the basics of composing with the use of software—such as Inspiration, Writing About Reading, and CommonSpace —which is specifictowritingclasses,andawordprocessingpackage such as Microsoft Word. Students will learn how composing oncomputerssignificantlyenhancesthewritingprocessas they brainstorm, exchange drafts for online peer critique sessions, confer with each other online, and work together and with the instructor to revise their work using the Screenwriter. Prerequisite: Permission of instructor ENGL 081T: Reading-Writing in the Disciplines 5 Cr Quarters: F, W, S Students in this transitional course will learn strategies for reading and responding to a variety of printed materials, particularly those used in college courses. Strategies emphasized include identifying main ideas and supporting details; analyzing materials for the author’s purpose; participating in seminars about assigned readings; summarizing brief passages and longer works, such as journal articles; including citations and references; avoiding plagiarism; predicting and responding to quiz and/or test questions; and adjusting strategies to the type of materials to be read. Prerequisite: YVCC placement into ENGL 081T, CASAS scores of 236 or above ENGL 085: Writing Workshop 1-2 Cr Quarters: F, W, S The writing center workshop is designed to guide students through writing assignments and related work from any or all classes. Students in the workshop will get individual assistance from writing consultants at the Writing Center and will be coached in the process approach to writing. Strategies for gathering ideas, drafting, organizing, revising, and editing their work will be emphasized, as well as how to view grammatical “errors” as opportunities to learn. The workshopalsooffersguidanceincriticalreadingstrategies and, in general, provides a place where students may ask questions about academic language. Note: Students may be referred to this course by an instructor. ENGL 090T: Reviewing English Essentials I 5 Cr Quarters: F, W, S, SR Throughwell-definedandstructuredactivities,studentsin thistransitionalcourseproduceunified,coherent,short, typed compositions following standard conventions of formatting, spelling, punctuation, and grammar. They will base their writing on readings from basic texts enhanced by active participation in class discussions. A grade of S in ENGL 090T is required to enter ENGL 095. Prerequisite: Eligibility for ENGL 090T. For ABE transition students, a minimum CASAS reading score of 236 or above and a score of 4 or above on a rubric writing task ENGL 095: Reviewing English Essentials II 5 Cr Quarters: F, W, S, SR Students in ENGL 095 will practice writing as a process. Throughthisprocess,theywilllearntowriteclear,unified, coherent essays following conventions of written English. They also will develop their critical thinking through reading, writing, and discussion. They will support their ideas with evidence and will be introduced to MLA documentation. A grade of S in ENGL 095 is required to enter ENGL& 101. Prerequisite: YVCC placement into ENGL 095 or ENGL 090T with a grade of S Yakima Valley Community College, 2015-2016 ENGL 099, 198, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor ENGL& 101: English Composition I 5 Cr Quarters: F, W, S, SR Inthefirstoftwocollege-levelcourses,ENGL&101students willlearntowriteclear,unified,coherent,andwell-developed essays of increasing complexity. Through reading, writing, and discussion, students will learn to critically examine their own assumptions and opinions and to consider the facts and reasoning of others. Students will learn to use Modern Language Association conventions of language, format, and documentation accurately. Students must earn a C or better in ENGL& 101 to enroll in the second college-level composition course, ENGL 102. Prerequisite: YVCC placement into ENGL& 101 or ENGL 095 with a grade of S Distribution for DTA: Communications ENGL 102: English Composition II 5 Cr Quarters: F, W, S, SR The second of two college-level courses, ENGL 102 willcontinuetorequireclear,unified,coherent,and well-developed essays of increasing complexity. While consideration of audience is an inherent part of the writing required in ENGL& 101, students in ENGL 102 will learn to consider more explicitly the role the audience plays when they write. In seeking to gain credibility with their audience and to persuade others to their points of view, students will write extended arguments. Through reading, writing, and discussion, students will continue to examine their own assumptions and opinions and to consider the facts and reasoning of others. In their writing they will bring to bear a variety of texts to support their arguments as they learn basic research techniques and the documentation conventions of the Modern Language Association or comparable style sheets from other disciplines. Extended research, the province of ENGL 203, will not be required. Prerequisite: ENGL& 101 with a grade of C (2.0) or better Distribution for DTA: Communications ENGL 120: Basic Grammar 3 Cr Quarters: O This course is a concentrated study of English grammar and usage. It will also review fundamentals of sentence structure, punctuation,spelling,andotherbasicprinciplesofeffective writing. Prerequisite: Eligibility for ENGL& 101 ENGL 130, 131, 132: Writers and Ideas I, II, III 2 Cr Quarters: O Students will read and interpret novels, short stories, poems, plays,andliterarynonfiction.Thesubjectmattermay representallfivegenresormayfocusontheworksofoneor more writers. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 135: Introduction to Short Fiction 3 Cr Quarters: O Reading and analyzing representative short stories and/or novellas. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 136: Introduction to Plays 3 Cr Quarters: O Studentswillreadplayswithdifferentthemes,styles,and voices;theywilllearnaboutthedifferentgenreswithin dramatic literature. They also will explore background material, including the elements and the history of drama. Attendance of live performances will be required when possible. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 137: Introduction to Poetry 3 Cr Quarters: O The course introduces students to critical methods of reading and evaluating poetry of a wide variety of form, subject, and mood. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 138: Introduction to Novel 3 Cr Reading and analyzing novels. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities Quarters: O ENGL 140: Science Fiction 3 Cr Quarters: O Exploration of major novels by contemporary authors such as Cherryh, LeGuin, and Dick. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 141: The Mystery Novel 3 Cr Quarters: O Students will read, discuss, and write about the mystery genre either as a general overview, which would include detective, spy, and other types of mystery forms; or the course may focus on one or two writers such as Agatha Christie, P.D. James, Elizabeth George, John LeCarre, or Elmore Leonard, for example. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 144: Literature of Pacific Northwest and West 3 Cr Quarters: O WritingofthePacificNorthwestandWestwillbestudied. This writing may be studied against the background of early myths of the frontier, early European and U.S. expeditions, regional 19th century history, Hollywood legend, and the origins of literary regionalism. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 145: Introduction to Native American Literature 3 Cr Quarters: O An examination of Native American history, myth, and legend with readings and discussion of contemporary Native American authors. The integration of traditional material with contemporary concerns and the crucial role of storytelling in the preservation and revitalization of Native American cultures are explored. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 150: Women in Literature 3 Cr Quarters: O An examination of works by and about women with a concentration on comparative examination of themes and character development. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 133 134 ENGL 160, 161, 162: English Portfolio Generation & Management 1 Cr Quarters: O Designed for classes in which students maintain written records of their progress in a selected area of study. Students will be required to keep all their written assignments for a quarter, to write short assessments of each written assignment, and to write a more comprehensive selfassessment at the end of the quarter. In addition, they will meet with the portfolio management instructor two to three times a quarter to discuss their writing. Prerequisite: Eligibility for ENGL& 101 ENGL 170: Prism: Student Literary Journal I Variable Cr Quarters: O By reading and examining the creative works of YVCC students, class members in both Yakima and Grandview will collaborate to develop aesthetic standards for evaluating literature and art submitted for inclusion in YVCC’s annual student literary journal. Using these standards, class members will select poems, stories, essays, photographs, and works of art for publication; perform desktop publishing of the journal; and generally take full responsibility for all aspects of publishing and publicizing the journal. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 171: Prism: Student Literary Journal II Variable Cr Quarters: O By reading and examining the creative works of YVCC students, class members in both Yakima and Grandview will collaborate to develop aesthetic standards for evaluating literature and art submitted for inclusion in YVCC's annual student literary journal. Using these standards, class members will select poems, stories, essays, photographs, and works of art for publication; perform desktop publishing of the journal; and generally take full responsibility for all aspects of publishing and publicizing the journal. Prerequisite: ENGL 170 Distribution for DTA: Humanities ENGL 185: Writing Consultant Variable Cr Quarters: F, W, S The writing consultant course is designed to give students who enjoy writing or are anticipating careers as teachers or writers a chance to share their interest and knowledge about writing with their peers in the YVCC writing centers. Students in the consulting course will be coached in the process approach to writing. They will learn how to conduct successfulconsultations,offerconstructivefeedback, anddeterminetheeffectivenessoftutoringstrategies. Consultants will meet individually with student writers who drop in during their free time or schedule appointments. Note: This course may be repeated for credit. Prerequisite: A minimum grade of B+ in ENGL& 101 and Writing Center director permission ENGL 201: Creative Writing I 3 Cr Quarters: O Students will be introduced to the craft of creative writing in one or more of the following areas: the short story, the novel, creativenonfiction,orpoetry.Theywillstudypublished works in one or more of these areas, and they will complete writing assignments that deal with the elements and techniques particular to each form. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 ENGL 202: Creative Writing II 3 Cr Quarters: O Students may continue their study of creative writing by enrolling in ENGL 202. This course may be taught concurrently with English 201. Prerequisite: ENGL 201 Distribution for DTA: Humanities ENGL 203: The Research Paper 3 Cr Quarters: O Students will learn basic research methods and write one or more documented essays and an extended research paper. They will be introduced to the library and electronic sources, bibliography, and documentation conventions of the Modern Language Association as well as learn to apply various rhetorical principles to their writing. Credit will be given for Communications or Humanities distribution but not both. Prerequisite: ENGL& 101 Distribution for DTA: Communications or Humanities but not both ENGL 205: Poetry Workshop 2 Cr Quarters: O In a workshop format, students will study the aesthetics and techniques of poetry in order to create original poems. This is a course for anyone who wants to learn about poetry from a poet’s perspective. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities ENGL 209: Introduction to Mythology 5 Cr Quarters: O A general survey of world mythology, of myths from many cultures,theirliteraryadaptation,andtheirinfluenceon cultural and social norms. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 212: Survey of Latin American Literature 5 Cr Quarters: O Survey of representative works from Latin America in translation, including the colonial and neocolonial legacies asreflectedinauthorsofdiverserace,gender,andpolitical orientation. Survey may include such authors as de las Casas, Inez de la Cruz, Palma, Quiroga, Sarmiento, Machado, Vargas Llosa, Rulfo, Borges, Cortazar, Neruda, Garcia Marquez, and Allende. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 220: Survey of American Literature: Beginnings to 1870 5 Cr Quarters: O Major American writing and thinking from the Puritan and Colonial periods through the American Renaissance and the beginnings of realism. Representative works of writers of diverse cultural backgrounds will be included. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 221: Survey of American Literature: 1870 to 1945 5 Cr Quarters: O Survey of the major writers of the Realist, Naturalist, Modernist, and contemporary periods, such as Twain, James, Crane, Chopin, Frost, Eliot, Hemingway, Fitzgerald, O’Connor, Stein, and Porter. Representative works of writers of diverse cultural backgrounds will be included. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 222: Survey of American Literature: 1945 to Present 5 Cr Quarters: O Ethnic Studies ENGL 264: English Literature: Begin to 1660 5 Cr Quarters: O Significantworks,includingBeowulf,SirGawainandthe Green Knight, and selections from the Canterbury Tales and Paradise Lost are read and discussed in their literary, historical, and social contexts. Prerequisite: ENGL& 101 Distribution for DTA: Humanities Ethnic Studies focuses on the historical and contemporary experiences of people of color in the United States including Native Americans, African Americans, Hispanic/Latin@s, and Asian Americans. Emphasis is placed on their achievements and contributions to American society as well as on their roles within the complex dynamics of racial and ethnic relations. Introductoryethnicstudiescoursesareofferedasare more specialized courses focusing on one ethnic group oraspecifictopic.Inaddition,studentsofalllevelsare encouraged to pursue independent study and research under the guidance of the ethnic studies faculty. Ethnic studiescoursesprovidenewanddifferentperspectiveson American society making them an appropriate and necessary addition to any course of study. Survey of the major writers and literary movements after World War II. Emphasis is on the developing multicultural, multi-ethnic, and feminist movements in the United States but also includes Beat and counter-culture movements, deconstructionist thinking, and their resulting styles. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 265: English Literature: 1660 to 1832 5 Cr Quarters: O Major authors of this period, including Dryden, Swift, Pope, Boswell, Johnson, Blake, Wordsworth, Coleridge, Byron, Keats, and Shelley, are read and discussed in their literary, historical, and social contexts. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 266: English Literature: 1832 to Present 5 Cr Quarters: O Major authors of this period, which may include Tennyson, Browning, Arnold, Mill, Hardy, Hopkins, Shaw, Conrad, Yeats, Woolf, Joyce, D.H. Lawrence, and Eliot, are read and discussed in their literary, historical, and social contexts. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 270: Introduction to Shakespeare 5 Cr Quarters: O A study of selected history plays, tragedies, and comedies to enhance students’ comprehension of the plots, characters, and themes of Shakespeare’s plays. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 271: Shakespeare in Ashland 3 Cr Quarters: O A study and viewing of the Elizabethan plays currently in performance at Ashland, Oregon. Prerequisite: ENGL& 101 Distribution for DTA: Humanities ENGL 275: The Bible as Literature 5 Cr Quarters: O ENGL275addressestheliteraryartistry,culturalsignificance, and historical references in the Bible. The approach may be chronological, by genre, and/or by theme. The material will be analyzed and evaluated for its sociological, psychological, philosophical,spiritual,andcross-cultural/globalinfluence. Prerequisite: ENGL& 101 Distribution for DTA: Humanities See also “Chican@ Studies” Courses ETHS 101: American Ethnic Minorities 5 Cr Quarters: F, W, S, SR An in-depth study of Native American, Asian American, African American, and Hispanic American people. Students explore the role of the early immigration of women, elderly, gays, teens, and other minority groups to the United States. Includes examination of their cultures, traditions, customs, language, and contemporary status. The collaborative methodology encourages students to question, discuss, and debate past and current issues and to challenge myths and stereotypes of minorities. The course seeks to engage students in an intellectual journey intended to foster respect for all cultures and peoples. Distribution for DTA: Social Sciences ETHS 103: Media, Art, & American Ethnicity 5 Cr Quarters: W Considersthetreatmentofraceandethnicityinfilm, television, and the visual arts. The course will take a critical approach to the study of the mass media as art forms, as political and social commentaries, and as representations of ethnic America. Distribution for DTA: Humanities ETHS 105: Ethnic Women 3 Cr Quarters: O Addresses the unique experience of the woman of color in historical and contemporary context. This will include analysis of their economic, social, legal, and political condition as well as their relation to both the ethnic and women’s movements. Special focus will be placed on the intersection of race, class, and gender as the basis for social inequality and oppression. ETHS 107: Race & Ethnic Relations 2 Cr Quarters: O Explores the complex dynamics of race and ethnicity in America through examination of the treatment of minorities in dominant American society. This course will examine concrete examples of the ethnic experience, including topics suchasracism,prejudice,legaldiscrimination,affirmative action, hate crimes, and violence. It is designed to sensitize students to the minority experience. ETHS 120: African American Experience 3 Cr Quarters: S Studies the historical, cultural, literary, and artistic achievements of Americans of African descent. Course will examine the dynamics of slavery, white racism, and stratificationtoofferacomprehensiveintroductiontothe study of African American life. Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 135 136 ETHS 145: US/Indian Relations 3 Cr Quarters: W Provides a comprehensive overview of the unique legal and political status of American Indians. This course will describe andexplainthatstatus,firstbysurveyingitshistoricalorigins, and then by examining pertinent modern laws and some practical impact of those laws. Distribution for DTA: Social Sciences Geography ETHS 180: Ethnic Cultures I 2 Cr Quarters: O This course gives students the opportunity for cross-cultural experience and comparative studies while learning about and interacting with ethnic communities. The focus is on the cultures of Native Americans, African Americans, Mexican Americans, and Asian Americans. The class is conducted in a seminar format with an interdisciplinary approach. It will emphasize cross-cultural research, and students will produce a project based on independent investigation. Courses ETHS 181: Ethnic Cultures II 3 Cr Quarters: O This course is based on the same format as ETHS 180, but, in addition, this course will include direct involvement with community service. GEOG 102: Physical Geography 5 Cr Quarters: O An introduction to the principal components of the earth’s natural systems of landforms, weather and climate, vegetation, and soils, as well as their interrelationships. Factorsaffectingtheworldwidedistributionofthese components are stressed. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Natural Sciences ETHS 185: Field Experience 1 Cr Quarters: O This course will provide all students the opportunity to participate in ethnic student organizations, develop leadership skills, and present cross-cultural events for campus and community. Prerequisite: Permission of instructor ETHS 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in ethnic studies. ETHS 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Allows students to complete research on a special topic relating to ethnic studies chosen in consultation with a faculty mentor. Prerequisite: Permission of instructor ETHS 200: Ethnic Curriculum 5 Cr Quarters: O An introduction to ethnic studies curricula. The course will focus upon innovative teaching methodologies as well as strategies for teaching ethnic content and integrating those unique perspectives into current curricula. ETHS 203: Ethnic Storytelling 3 Cr Quarters: O An in-depth study of ethnic storytelling. The course focuses on the genesis of storytelling as well as the methods, techniques, and strategies of unique storytellers. Students will compare the myths, legends, fables, and oral traditions of ethnic peoples globally and examine the ways stories have traditionally been used to develop moral character. Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 Geography is an integrative discipline that unites the physical and Social Sciences in the study of people, places, and the environment. Major themes geographers explore are the interaction of human and natural environments, movement, and regions. Geography studies the where-and-why factors that shape our world and our lives in spatial terms. GEOG 101: World Regional Geography 5 Cr Quarters: F An introduction to the earth’s major geographic regions, their cultural, economic, and physical characteristics, and the interactions between regions. Includes an emphasis on locationsofsignificantplaces. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences GEOG& 200: Human Geography 5 Cr Quarters: O An introduction to the study of human cultural features (such as population, resources use, and language), their distribution, and their interaction with each other and the natural environment. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences GEOG 205: Economic Geography 5 Cr Quarters: O An introduction to the spatial patterns of economic activity on both a regional and global scale. Focuses on the growth andintensificationofglobalties,thedistributionofresources and wealth, and the resulting inequalities and tensions. Topics include trade, development, resource extraction, agriculture, manufacturing, and service sector economies, transportation, communication, and environmental impact. Credit cannot be given for both GEOG 205 and ECON 205. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences GEOG 210: Earth's Climate 5 Cr Quarters: O Earth's Climate is an introduction to climatology course. It explores the origin, composition, and structure of Earth's atmosphere and the physical processes that control the atmosphere, ocean, and climate. Topics include the nature andeffectsofsolarradiation,wind,clouddevelopment, precipitation, the seasons, sever storms, regional climate, the ozone layer, ocean currents and productivity, El Nino and La Nina, glaciation, and anthropogenic impacts on climate. Emphasis will be given to study the Earth's climate history. Prerequisite: Eligibility for MATH 084 or 085 and eligibility for ENGL& 101 Distribution for DTA: Natural Sciences Geology Abasicgroupofgeologycoursesisofferedsothatstudents may gain an understanding of the earth’s surfaces and interior and the processes which have changed Earth through time. Courses are taught for students who wish to satisfyNaturalSciencesrequirements,toexplorethefieldfor future study, or to learn for personal enrichment. Courses GEOL 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor GEOL& 208: Geology Pacific NW 5 Cr Quarters: F GeologyofthePacificNorthwestisthestudyofthephysical and historical geology of the state of Washington and surrounding region. Students will gain familiarity with earth materialscommontothePacificNorthwestandlearnabout the tectonic and gradational processes that shaped our region. Prerequisite: ENGL 095 or YVCC placement into ENGL& 101 and MATH 075 or YVCC placement into MATH 085 Distribution for DTA: Natural Sciences - Lab GEOL& 101: Introduction to Physical Geology 5 Cr Quarters: W The study of the earth as a whole; its origin, structure, composition, and history; and the nature of the processes that have given rise to its present state. Prerequisite: ENGL 095 or YVCC placement into ENGL& 101 and MATH 075 or YVCC placement into MATH 085 Distribution for DTA: Natural Sciences - Lab GEOL& 103: Historical Geology 5 Cr Quarters: S An introduction to the history of the earth including its origin, development of interior and crustal structures, changes in climate and surface environments, and the evolution of life forms. Emphasis is given to how the history of Earth is revealed in the rock record. Prerequisite: GEOL& 101, GEOL& 115, or GEOL& 208 Distribution for DTA: Natural Sciences - Lab GEOL& 115: Geology National Parks 5 Cr Quarters: F A study of selected U.S. and Canadian national parks which showcases the tectonic and gradational evolution of North America. The focus of the course will be on geologic exposures shaped principally by plate tectonic forces and by water, wind and glacial erosion. Prerequisite: ENGL 095 or YVCC placement into ENGL& 101 and MATH 075 or YVCC placement into MATH 085 Distribution for DTA: Natural Sciences - Lab GEOL 155: Glacial Geology 3 Cr Quarters: O Characteristicsandeffectsofmodernandancientglaciers and Earth’s Ice Ages will be studied, along with global climatic change, ice formation and movement, and glacial erosional anddepositionalfeatures.Weekendfieldtripstoobserve active glaciation and Washington’s Pleistocene legacy will be a part of the class. Prerequisite: ENGL 095 or YVCC placement into ENGL& 101 and MATH 075 or YVCC placement into MATH 085 Distribution for DTA: Natural Sciences GEOL 206: Glaciers and Ice Ages 5 Cr Quarters: F In this course students will examine characteristics and effectsofmodernandancientglaciation,andlearnaboutice formation and movement, glacial erosion and depositional features, and periglacial landscapes. Particular focus will be directed to investigate Earth’s Ice Ages and the origins of natural and anthropogenic climate change. Students will participateinfieldtripactivitieswheretheywillobserve active glaciation and assess evidence for Washington’s Ice Age history. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 084 or MATH 085 Distribution for DTA: Natural Sciences Yakima Valley Community College, 2015-2016 137 138 History The historian analyzes human events and social/political organizations, attempting to establish an accurate perspective of the past. History provides us with an identity. It allows us to place current events into a perspective which gives us a sense of context and sequence. The patterns of civilizations can be discerned. History courses are taught at YVCC by instructors who are known for their knowledge and provocative presentations. Courses may be taken out of sequence (e.g. HIST& 117 before HIST& 116 or HIST& 137 before HIST& 136). Courses HIST 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. HIST 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor HIST& 116: Western Civilization I 5 Cr Quarters: O A survey of European and Near Eastern history from the earliest Mediterranean civilizations through Medieval Europe. Credit will be granted for Social Sciences or Humanities but not both. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences or Humanities but not both HIST& 117: Western Civilization II 5 Cr Quarters: O Political, social, economic, and cultural history of Europe from the Renaissance to 1815. Credit will be granted for Social Sciences or Humanities but not both. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences or Humanities but not both HIST& 118: Western Civilization III 5 Cr Quarters: S Political, social, economic, and cultural history of Europe from 1815 through the post-World War II era. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences HIST& 136: U.S. History I 5 Cr Quarters: F, W, S Political, social, economic, and cultural history of the United States from pre-colonial exploration through Civil War. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences HIST& 137: U.S. History II 5 Cr Quarters: F, W, S Political, social, economic, and cultural history of the United States since the Civil War. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences HIST 190: Co-op Field Experience I 4 Cr Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 Quarters: O HIST 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in history. HIST 205: US History 1945 to Present 5 Cr Quarters: F, W The political, social, economic, and cultural history of the United States from 1945 to the present with special emphasis on the Cold War era. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences HIST 208: Roman Civilization 5 Cr Quarters: O Historical survey of Roman civilization from its origins through the Republic, Empire, and the rise of Rome’s successors. With a time frame of 800 BCE to 600 CE, this class will emphasize the political, social, and cultural transformation of the Roman world and how this society became an integral part of Western civilization. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Humanities HIST 209: Greek Civilization 5 Cr Quarters: O Historical survey of ancient Greek history from the Bronze Age to the Hellenic and Hellenistic eras. The course will provide a chronology of key events with emphasis on analyzing the evolution of Greek culture. Credit will be granted for either Social Sciences or Humanities but not both. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences or Humanities but not both HIST 213: Economic History 5 Cr Quarters: O An introduction to the methods of economic interaction from antiquitytothepresent.Thiscourseoffersacomprehensive world survey, emphasizing important economic events— such as the invention of currency, the Industrial Revolution, and the development of economic thought—to include major economic thinkers and their contribution to the understanding of economic processes. Credit cannot be given for both HIST 213 and ECON 213. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences HIST& 214: Pacific Northwest History 5 Cr Quarters: F Although emphasis is placed on historical chronology and developmentpertainingtoPacificNorthwesthistory,a sweeping view of the politics, geography, economy, and cultural exchanges of the region is examined from its earliest inhabitants to contemporary issues. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution to DTA: Social Sciences HIST 270: History of Latin America 5 Cr Quarters: O An examination of Latin America’s history and culture from the colonization era to recent times. Some focus on rich resources, chronic poverty, and the role of the U.S. in the hemisphere. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution to DTA: Social Sciences HIST 275: History of Mexico 5 Cr Quarters: O An examination of Mexican history from its indigenous roots through conquest and colonization to independence, the revolution, and some contemporary challenges. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution to DTA: Social Sciences Humanities Humanities is the study of the major ideas in Western thought concerning people and their culture, society, and place in the universe expressed through the visual arts, literature, philosophy, and religion. The degree distribution requirement in the humanities courselistincludesspecificcourseslistedhereaswellas courses listed in art, drama, English, ethnic studies, foreign languages, history, music, philosophy, and speech. To select courses for Humanities distribution, the student should also refer to these other disciplines in this catalog. Courses HUM 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor HUM 102: Introduction to Humanities I 5 Cr Quarters: F Society, arts and ideas of Ancient Egypt and Mesopotamia; Classical Greece, Rome and China; and European and Asian Medieval cultures, ca. 4000 BCE - 1400 CE. There are three essay assignments which may require extra-curricular attendance. Prerequisite: Successful completion of or concurrent enrollment in ENGL 095 Distribution for DTA: Humanities HUM 103: Introduction to Humanities II 5 Cr Quarters: W Society, arts and ideas of the Renaissance, Baroque and Enlightenment periods of Europe, and concurrent developments in Asia, Africa, and the Americas, ca. 1400 - 1800 CE. There are three essay assignments which may require extra-curricular attendance. Prerequisite: Successful completion of or concurrent enrollment in ENGL 095 Distribution for DTA: Humanities HUM 104: Introduction to Humanities III 5 Cr Quarters: F, S Society, arts, and ideas in the Early Modern, Modern, and Post-Modern periods of the 19th through 20th centuries in the West and concurrent developments in Asia and Africa. There are three essay assignments which may require extracurricular attendance. Prerequisite: Successful completion of or concurrent enrollment in ENGL 095 Distribution for DTA: Humanities HUM 111: American Pop Culture I 2 Cr Quarters: F An examination of the political, cultural, and social development of American popular culture from colonial times to the present. An exploration of our distinctive popular culture through its icons, activities, and rituals. Distribution for DTA: Humanities HUM 112: American Pop Culture II 2 Cr Quarters: W, S An irreverent examination of the art and business of pleasing the American mass audience through its pop culture forms— comics, art, cinema, best sellers, magazines, music, and television. Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 139 140 HUM 113: American Pop Culture III 2 Cr Quarters: S An examination of the cultural and sociological factors responsible for what American life may be in the 21st century; an examination of American life tomorrow. Distribution for DTA: Humanities HUM 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in humanities. HUM 270: Significant Figures in World Civilization 2 Cr Quarters: O This course will introduce students to a variety of people who havemadesignificantcontributionstohumanity.Figures presented will vary by instructor and represent cultural, historical, political, and social perspectives. Distribution for DTA: Humanities Information Technology YakimaValleyCommunityCollegeoffersexcitingInformation Technologydegreeprograms.Ourmodernfacilityoffers several computer classrooms, one hardware classroom, and one network classroom. Practical development is stressed in Information Technology classes as students are presented with strategies for applying their studies to present and future needs of technology-related careers. The faculty is committed to delivering excellent instruction, and the college is dedicated to providing students with the tools to succeed. For more information contact the department website at www.YVCC.edu/IT Program Outcomes Upon successful completion of this program, the student should be able to: • Apply current industry practices and standards to business challenges and opportunities. • Communicateeffectivelyandefficientlywithpeersand clients. • Utilize critical thinking skills to troubleshoot technological problems and apply solutions. Careers Information technology is a broad area with many career opportunities. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is available at the following websites: www.Access.wa.gov or www.WorkforceExplorer.com Degrees TheInformationTechnologyprogramoffersthreeAssociate of Applied Science degrees: • General Degree • Support Specialist • Network Administration Please contact the Information Technology department at the phone number listed in the front of this catalog for the most current curriculum information. Information Technology degree candidates must complete a 59-credit core which includes courses that present the concepts of theory, history, software, Internet, networking, hardware, programming, human relations, computation, communications, and ethics/law. The core helps students determine which degree they want to work toward and presents a solid foundation in the Information Technology discipline. Students then select a degree option which totals at least 90 credits upon degree completion. Degrees are awarded upon completion of the required degree courses with a minimum GPA of 2.0 (C). Yakima Valley Community College, 2015-2016 Required Courses for IT Core Credits BA 115 Business Math 5 BA 138 Written Business Communication 5 BA 225 Career Management 5 BUS& 201 Business Law or BA 259: Fundamentals of E-commerce 5 BT 160 Word Processing Short Course 2 IT 101 Introduction to Information Technology 5 IT 103 Operating Systems 5 IT 104 Internet Essentials 3 IT 110 Computer Programming Introduction 5 IT 111 Spreadsheet Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 IT 140 Network Fundamentals 5 IT 160 Managing & Maintaining the PC 5 IT 161 Computer Room Maintenance I 1 IT 190-193 Co-op Field Experience I, II, III, IV 2 Total Core Credits 59 In addition to these core requirements, students must have demonstratedproficiencyinthefollowingareas: • Mathproficiencyisrequiredandmaybefulfilledby either completing BA 075 with a grade of C (2.0) or better or YVCC placement to Math 085 or above. • Keyboardingproficiencyisrequiredandmay befulfilledbycompletingBT101orpassingthe keyboardingproficiencytestadministeredbythe Information Technology department. For more information, contact an IT advisor. • ExperienceandproficiencywithcurrentMicrosoft Windows operating system is highly recommended for all IT courses. Enroll in IT 102: Windows if you do not have this experience. IT General Degree For the IT General degree, students, with assistance from an IT advisor, will complete the Information Technology core courses as well as courses (100-level and above) from the departments listed below to total at least 90 credits. The IT General degree allows students to get a solid background in IT and also to supplement their degrees with courses in other interests or skills necessary for their intended occupations. Students can take up to 10 credits from Arts and Science classes and can choose additional electives from Agriculture, Business, Business Technology, Criminal Justice, Engineering, and Information Technology. Network Administrator This degree enables students to install, administer, configure,andtroubleshootnetworks.Thiscurriculumhelps prepare students for industry recognized Cisco, CompTIA, andMicrosoftcertifications. Required Courses IT Core IT 141 System Virtualization IT 143 Cisco I IT 144 Cisco II IT 145 Advanced Microsoft Windows IT 146 Windows Server IT 149 Windows PowerShell Scripting IT 243 Cisco III IT 244 Cisco IV IT 249 Network Security Total Credits Credits 59 3 5 5 5 5 2 4 5 5 98 Support Specialist The IT Support Specialist degree includes curriculum that helps prepare students for CompTIA and Microsoft certificationsandprovidesopportunitiesfordeveloping a strong IT knowledge base necessary for those in the Support Specialist degree. The curriculum includes hardware and software installations, end-user support, and troubleshooting skills. Required Courses Credits IT Core 57 *BT 260 Word Processing 5 IT 124 Publisher or IT 184: InDesign 3 IT 143 Cisco I 5 IT 145 Advanced Microsoft Windows 5 IT 221 Spreadsheets Advanced 4 IT 222 Outlook 2 IT 225 Database Advanced 4 IT 226 Systems Support: Software Applications 3 IT 227 Software Install & Troubleshooting 2 IT 260 Advanced Managing & Maintaining PC 5 Total Credits 95 * Support Specialist students are required to complete BT 260 instead of BT 160 listed in the core courses. Certificates Courses listed below may have prerequisites. Please consult the course descriptions. Managing & Maintaining the PC IT 160 Managing & Maintaining the PC IT 260 Advanced Managing & Maintaining PC Total Credits Access IT 115 IT 225 Database Introduction Database Advanced Total Credits Cisco Internetworking IT 143 Cisco I IT 144 Cisco II IT 243 Cisco III IT 244 Cisco IV Total Credits Excel IT 111 IT 221 Spreadsheet Introduction Spreadsheet Advanced Total Credits IT Computer User BA 115 Business Math BA 138 Written Business Communication or ENGL& 101: English Composition I BT 101 Beginning Keyboarding (or pass competency test) BT 260 Word Processing IT 100 Introduction to Computers IT 102 Windows IT 104 Internet Essentials IT 111 Spreadsheet Introduction IT 115 Database Introduction IT 120 PowerPoint IT 124 Publisher IT 221 Spreadsheet Advanced IT 225 Database Advanced Total Credits IT General Completionofthiscertificatewillenablestudentsto seek employment and/or continue with an Information Technology degree as most of the classes required for thecertificatecomprisetheInformationTechnologycore requirements. 5 5 10 2 4 6 5 5 4 5 19 2 4 6 5 5 5 5 3 2 3 2 2 2 3 4 4 45 Required Courses Credits BA 115 Business Math 5 BA 138 Written Business Communication 5 BA 220 Human Relations in Workplace 2 BUS& 201 Business Law or BA 259: Fundamentals of E-commerce 5 BT 160 Word Processing Short Course 2 IT 101 Introduction to Information Technology 5 IT 103 Operating Systems 5 IT 104 Internet Essentials 3 IT 110 Computer Programming Introduction 5 IT 111 Spreadsheets Introduction 2 IT 115 Database Introduction 2 IT 120 PowerPoint 2 IT 140 Network Fundamentals 5 IT 160 Managing & Maintaining the PC 5 IT 161 Computer Room Maintenance I 1 Total Credits 54 Office Suite BT 260 Word Processing IT 111 Spreadsheets Introduction IT 115 Database Introduction IT 120 PowerPoint IT 221 Spreadsheets Advanced IT 225 Database Advanced Total Credits 5 2 2 2 4 4 19 Programming IT 110 Computer Programming Introduction IT 174 Introduction to C++ IT 230 Java Total Credits 5 5 5 15 Courses IT 090: Basic Computer Skills 3 Cr Quarters: O A computer literacy course that will help the student identify basic computer components and develop computer skills using word processing, spreadsheet and presentation graphic software. Students will acquire experience in use of the Internet. IT 100: Introduction to Computers 3 Cr Quarters: F, W, S, SR A computer literacy course that will help the student identify basic computer components and develop computer skills using word processing, spreadsheet, database, and presentation graphic software. Students will acquire experience in use of the Internet. IT 101: Introduction to Information Technology 5 Cr Quarters: F, W, S This is a survey course that covers most aspects of information technology. It includes how computers work, differenttypesofcomputers,functionsofapplications,input anddatastoragedevices,differentoperatingsystems,ethics, data communications, and systems analysis and design. Prerequisite: IT 102 or equivalent IT 102: Windows 2 Cr Quarters: F, W, S, SR This course introduces the student to the Windows operating system, working with the Windows desktop, using and managingprograms,managingfilesandfolders,and working with the Control Panel. Yakima Valley Community College, 2015-2016 141 142 IT 103: Computer Operating Systems 5 Cr Quarters: F, W, S Students will install and explore the design, utilities, and configurationofmultipleoperatingsystemswhilelearning howeachsystemworkswithspecifichardwarecomponents. Prerequisite: IT 102 or equivalent IT 104: Internet Essentials 3 Cr Quarters: F, W, S, SR Introduces students to the basic concepts of the Internet including history, searching, browsing, email, downloading, chat, management, and Web page development. IT 105: Computer Literacy 3 Cr Quarters: F, W, S, SR This is an entry-level computer literacy course designed to introduce basic computer skills and concepts in word processing, Windows, the Internet, and Angel online classroom software. IT 110: Computer Programming Introduction 5 Cr Quarters: F, W, S An introductory course to teach students the fundamentals of computer programming techniques using Visual Basic. Prerequisite: IT 102 or equivalent IT 111: Spreadsheets Introduction 2 Cr Quarters: F, W, S, SR Specificexamplesofbeginningspreadsheetsetups,aswell as spreadsheet use, will be covered in detail. IT 115: Database Introduction 2 Cr Quarters: F, W, S, SR This course covers the use of databases in the small business environment including how data can be organized and sorted in a computer for updating forms and reports. IT 120: PowerPoint 2 Cr Quarters: F, W, S, SR Studentswilllearnhowtoeffectivelycommunicate information and ideas utilizing Microsoft PowerPoint. Prerequisite: IT 102 or equivalent IT 124: Publisher 3 Cr Quarters: F This course introduces students to layout and design of information to be published using a computer. Included is the design of several types of desktop publications such asstationery,businesscards,flyers,posters,banners, announcements, advertisements, letterheads, newsletters, postcards, and mailing labels. An introduction to basic layout and design principles is also included in this class. Students will study marketing techniques and design principles used by graphic artists and publishers in the layout of desktop materials. Prerequisite: IT 102 or equivalent IT 130: Web Page Authoring HTML 4 Cr Quarters: O Students will be provided with an introduction to Web page formats, functions, and design techniques including an overview of techniques used to manage collections of related Web pages. IT 135: Photoshop 4 Cr Quarters: F, S This course covers the use of digital imaging techniques to create bitmapped or raster images for use in print, multimedia, or web design. Photo editing and color correction tools will be used to enhance digital images and to createspecialeffectsusingAdobePhotoshop. Prerequisite: IT 102 or equivalent Yakima Valley Community College, 2015-2016 IT 140: Network Fundamentals 5 Cr Quarters: F, W, S This course introduces networking concepts including the knowledge and skills common to industry standards, terminology, planning, implementation, and troubleshooting. This course has been designed to help preparethestudentfortheCompTIA+Certification. Prerequisite: IT 102 or equivalent IT 141: System Virtualization 3 Cr Quarters: W This course will introduce the students to the concepts of system virtualization. Current industry standards and trends in system virtualization will be emphasized. Prerequisite: IT 103 or permission of instructor IT 143: Cisco I 5 Cr Quarters: S ThisisthefirstoffourcoursestopreparethestudentsCisco CertifiedNetworkAssociate(CCNA)RoutingandSwitching andCiscoCertifiedEntryNetworkingTechnician(CCENT) certification.ThiscoursewillfocusontheOpenSystems Interconnection (OSI) model, networking, components and technologies, basic network design, and IPv4 and IPv6 addressing including subnetting. Students will also be introducedtobasicswitchandrouterconfigurations. Prerequisite: IT 140 with a grade of C or better IT 144: Cisco II 5 Cr Quarters: F This is the second of four courses to prepare students for theCiscoCertifiedNetworkAssociate(CCNA)Routingand SwitchingandCiscoCertifiedEntryNetworkingTechnician (CCENT)certification.Thiscourseexpandsupontheskills andconceptslearnedinIT143andincludesconfigurationof static and dynamic routing, access control lists, virtual local area networks, switch port security, and the spanning-tree protocol. Prerequisite: IT 143 with a grade of C or better IT 145: Advanced Microsoft Windows 5 Cr Quarters: F Implement, administer, and troubleshoot Microsoft Windows as a desktop operating system in any network environment. Prerequisite: IT 103 IT 146: Windows Server 5 Cr Quarters: W Students implement and administer Windows Server networking,file,andprintservices. Prerequisite: IT 103 and IT 140. IT 149: Windows PowerShell Scripting 2 Cr Quarters: W This course is designed to introduce the students to scripting with Windows PowerShell. The students will acquire hands on experience with script building and system management using Windows PowerShell. IT 160: Managing & Maintaining the PC 5 Cr Quarters: F, W, S Students will safely demonstrate the ability to install and configurehardwareandsoftwareinaWindowsenvironment, optimize system performance, and troubleshoot problems withsoftwareandhardwareinstallation/configuration. Prerequisite: IT 102 or equivalent IT 161: Computer Room Maintenance I 1 Cr Quarters: F, W, S Through instructor-led demonstration and lecture, students will learn to perform routine and preventive computer maintenance. Students will maintain a log book of their assignments. IT 174: Introduction to C++ 5 Cr Quarters: S Students will learn the fundamental features of the C and C++ languages and apply them to develop solutions to business problems. Basic computer science programming conceptsofcorrectness,maintainability,andefficiencywill be emphasized . Prerequisite: MATH 095 or YVCC placement into MATH& 107 Distribution: Quantitative IT 184: InDesign 3 Cr Quarters: S Adobe InDesign is a software program designed to integrate text and graphics from many sources into newsletters, brochures, color catalogs, and magazines with maximum precision and control. In this course, the student will be expected to learn and explore the basic functions and applications of Adobe InDesign. Recommended: IT 102 or equivalent experience IT 190-193: Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Cooperative education integrates the students’ classroom study with work experience in cooperating employer organizations. Students usually alternate periods of college study with extended employment periods in appropriate fieldsofbusiness,industry,government,socialservices,and the professions. The students’ education, therefore, is shared between employer supervisors and YVCC faculty. Prerequisite: Permission of instructor IT 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in information technology. IT 199, 299: Independent Study/Field Experience Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor IT 221: Spreadsheets Advanced 4 Cr Quarters: W, SR This course provides students with advanced knowledge of spreadsheets, graphs, charts, and functions. Prerequisite: IT 111 or equivalent IT 222: Outlook 2 Cr Quarters: F, W, S This course teaches the many functions available from productivity software, including email, calendars, contact lists, task lists, journals, meeting requests, and notes. IT 225: Database Advanced 4 Cr Quarters: S This course will acquaint students with the proper procedures to create, query, and maintain databases suitable for coursework, professional purposes, and personal use. Prerequisite: IT 115 or equivalent IT 226: End-User and System Support 3 Cr Quarters: W For the Software Support Specialist degree. Prepares students to train and support end users in a variety of organizational settings. Includes techniques for developing and delivering training as well as strategies to provide ongoing technical support. Emphasis is on solving users’ problems by means of needs analysis, troubleshooting, and interaction with users. Prerequisite: Completion of 45 credits or equivalent work experience and concurrent enrollment in IT 227 IT 227: Software Installation & Troubleshooting 2 Cr Quarters: W Thiscourseincludeshowtocorrectlyconfiguresoftware, how to install software, and a discussion of compatibility issues. Prerequisite: Completion of 45 credits or equivalent work experience and concurrent enrollment in IT 226 IT 230: Java 5 Cr Quarters: F Students will be able to build programs using Java constructs while learning the basics of structured and object-oriented programming techniques. They will also be introduced to Graphical User Interface (GUI) and web-based programming in Java. Prerequisite: IT 110 or MATH 095 with a grade of C or better or YVCC placement into MATH& 107 Distribution : Quantitative IT 231: Illustrator 4 Cr Quarters: O This course will work with Adobe Illustrator, an industry standard illustration program for print, multimedia, and online graphics. Provides students the opportunity to use Illustrator’s software program to create vector graphics for print, multimedia, and the Web. Students should have a workingknowledgeofcomputers,filemanagement,andthe Windows operating system. Prerequisite: IT 102 or equivalent IT 233: Dreamweaver 3 Cr Quarters: F An introductory course exploring concepts and techniques of conceptualizing, designing, and developing integrated, interactive websites using Macromedia Dreamweaver software. Prerequisite: IT 104 IT 243: Cisco III 4 Cr Quarters: W This is the third of four courses to prepare students for theCiscoCertifiedNetworkAssociate(CCNA)Routingand Switchingcertification.Thiscourseexpandsupontheskills and concepts learned in IT 143 and IT 144. The student will deepen their knowledge of networking by exploring redundant network design, link aggregation, and advanced routing protocols. Prerequisite: IT 144 with a grade of C or better IT 244: Cisco IV 5 Cr Quarters: S This is the fourth of four courses to prepare students for theCiscoCertifiedNetworkAssociate(CCNA)Routingand Switchingcertification.Thiscourseexpandsupontheskills and concepts learned in IT 143, IT 144, and IT 243. Skills and concepts covered in this course include wide area network options including Point-to-Point Protocol (PPP), and Frame Relay, teleworker solutions, virtual private networking, and networking monitoring and troubleshooting. Prerequisite: IT 243 with a grade of C or better Yakima Valley Community College, 2015-2016 143 144 IT 249: Network Security 5 Cr Quarters: S This course is an introduction to network security and prepares the student for industry network security certifications.Studentswillbeintroducedtomultiple aspects of network security including both technical and administrative security measures. Firewalls, intrusion detection and prevention systems, host defenses, and cryptography will all be explored. Prerequisite: IT 103, IT 140, and IT 146 all with a grade of C or better IT 260: Advanced Managing & Maintaining the PC 5 Cr Quarters: F This course is a continuation of IT 160. Topics include personal computer components, laptop and portable devices, operating systems, printers and scanners, networks, security, safety and environmental issues, and communication and professionalism. This course may assist in preparing those students who are working toward industrycertification. Prerequisite: IT 103 and IT 160 with a grade of C or better and successful completion of or concurrent enrollment in IT 161 IT 290-293: Co-op Field Experience V, VI, VII, VIII Variable Cr Quarters: F, W, S, SR Cooperative education integrates the students’ classroom study with work experience in cooperating employer organizations. Students usually alternate periods of college study with extended employment periods in appropriate fieldsofbusiness,industry,government,socialservices, and the professions. The students’ education, therefore, is shared between employer supervisors and YVCC faculty. Prerequisite: Permission of instructor Mathematics All students needing to take mathematics at YVCC are required to be evaluated through the YVCC placement process before enrolling in a mathematics course. Courses MATH 049C: Accelerated Number Sense 5 Cr Quarters: F, W, S A self-paced course designed for students placing below MATH 050 on the COMPASS test and with placement into ENGL 090T. Students review fundamentals of whole numbers and integers with computation and problem solving. Students taking this course must be able to access computer labs on campus, or personal computers connected to the Internet, outside of the scheduled meetings in the computer classroom. Students receiving a S grade in this course may enroll in MATH 050 or MATH 050C. Students are allowed to repeat this course only once. Prerequisite: YVCC placement into MATH 049C and YVCC placement into ENGL 090T or above MATH 050: Arithmetic 5 Cr Quarters: F, W, S, SR A basic course with applications in the addition, subtraction, multiplication, and division of whole numbers, fractions, decimals, and signed numbers. High Demand Course policy applies: students are allowed to repeat this course only once. Prerequisite: YVCC placement into MATH 050 MATH 050C: Accelerated Arithmetic 5 Cr Quarters: F, W, S A self-paced course in arithmetic with applications in the addition, subtraction, multiplication, and division of whole numbers, fractions, decimals, and signed numbers. Students taking this course must be able to access computer labs on campus, or personal computers connected to the Internet, outside of the scheduled meetings in the computer classroom. High Demand Course policy applies: students are allowed to repeat this course only once. Prerequisite: MATH 049C with a grade of S MATH 075: Pre-Algebra 5 Cr Quarters: F, W, S, SR A transition course from arithmetic to beginning algebra. Content includes ratios, proportions, percents and their applications, measurements in the metric and English systems with applications, basic algebraic manipulations, and an introduction to geometry. Prerequisite: MATH 050 with a grade of C or better, MATH 050C with a grade of S, or YVCC placement into MATH 075 MATH 084: Algebra I: Introductory Algebra 5 Cr Quarters: F, W, S This is a course in introductory algebra for students with little or no background in algebra. Topics include properties of real numbers, algebraic expressions, linear equations, linear inequalities,polynomials,propertiesofexponents,scientific notation, and an introduction to graphing. Prerequisite: MATH 075 with a grade of C or better or placement into MATH 084 MATH 085: Beginning Algebra 5 Cr Quarters: F, W, S, SR An introductory algebra course in which students will solve equations and applications, analyze and graph linear equations, and simplify and factor polynomials. Prerequisite: MATH 075 with a grade of C or better or placement into MATH 085 Yakima Valley Community College, 2015-2016 MATH 091: Algebra II: Elementary Algebra 5 Cr Quarters: F, W, S This course is a continuation of MATH 084. Topics include graphing, systems of linear equations in two variables, radicals, and exponential and logarithmic functions. Prerequisite: MATH 084 or MATH 085 either with a grade of C or better MATH 092: Basic Algebra 5 Cr Quarters: F This is a course designed for students with previous experience in algebra and who intend to take MATH& 107. Topics include properties of real numbers, algebraic expressions, linear equations, linear inequalities, properties ofexponents,scientificnotation,andgraphiclinearand exponential functions. Prerequisite: MATH 075 with a grade of C or better or YVCC placement into MATH 084 or MATH 085 MATH 094: Algebra III: Intermediate Algebra 5 Cr Quarters: F, W, S This course is a continuation of MATH 091. Topics include graphing, radicals, and quadratic functions. Prerequisite: MATH 091 with a grade of C or better MATH 095: Intermediate Algebra 5 Cr Quarters: F, W, S, SR A course in algebraic methods, including polynomials, exponents,andradicals;solvingfirst-andsecond-degree equations; solving linear inequalities; and graphing and findingequationsoffunctions. Prerequisite: MATH 085 with a grade of C or better or YVCC placement into MATH 095 MATH& 107: Math in Society 5 Cr Quarters: F, W, S, SR For students who need Quantitative skills or Natural Sciences distribution credit and are either not taking additional math courses or are interested in the topics of the course as a supplement to their math studies. The course provides an introduction to and some exploration of the following areas: finance,probability,statistics,andmodeling(withgraphing). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH 091, MATH 092, MATH 094, MATH 095 with a grade of C or better or YVCC placement into MATH& 107 Distribution for DTA: Quantitative or Natural Sciences but not both MATH 111: Algebra Applied to Business/Economics 5 Cr Quarters: F, W This course covers algebraic functions, graphs, and processes applied to business and economics. Topics covered include applications and problem-solving using systems of equations, matrices, linear programming, simplex method,andfinancemathematics.Functionsusedare polynomials, exponentials, logarithmics, and rationals. A TI graphing calculator (83/84) is required for this class. Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH 094 or MATH 095 with a grade of C or better or YVCC placement into MATH 111 Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 131: Mathematics for Elementary Education 1 5 Cr Quarters: F, W A course for prospective teachers focusing on the mathematics underlying modern elementary school math curricula. Topics include deductive reasoning, set theory, whole numbers, fractions, decimals and their operations, and proportion and percentage. Emphasizes deep conceptual understanding, problem solving, and communication of mathematical ideas. Prerequisite: MATH 094 or MATH 095 with a grade of C+ or better or YVCC placement into MATH& 141; students must have a basic understanding of algebra MATH& 132: Mathematics for Elementary Education 2 5 Cr Quarters: W, S A course for prospective teachers focusing on the mathematics underlying modern elementary school math curricula. Topics include geometry, measurement, probability, and statistics. Emphasizes deep conceptual understanding, problem solving, and communication of mathematical ideas. Prerequisite: MATH& 131 with a grade of C or better Distribution for DTA: Quantitative MATH& 141: Precalculus I 5 Cr Quarters: F, W, S, SR PrecalculusIisthefirstofatwo-quartersequencethat prepares students to study calculus. Topics studied include nonlinear equations and system, nonlinear inequalities, polynomial, rational, piece-wise, exponential, and logarithmic functions, and conics. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-npsire (not CAS). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH 094 or MATH 095 with a grade of B- or better or YVCC placement into MATH& 141 Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 142: Precalculus II 5 Cr Quarters: F, W, S, SR Precalculus II is the second quarter of the precalculus sequence.Topicsstudiedinthiscourseincludedefinitions and properties of trigonometric functions and their inverses, identities, right triangle trigonometry, law of sines, law of cosines, polar coordinates, complex numbers, vectors, and parametric equations. A graphic calculator is required for this class. The calculator should be equivalent to the TI-84+ or TInspire (not CAS). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH& 141 with a grade of C or better or YVCC placement into MATH& 142 Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 146: Introduction to Stats 5 Cr Quarters: F, W S, SR This course presents a connected introduction to probability and statistics using statistical inference as its frame. The course covers distribution of measurements, probability distributions, the binomial and normal probability distributions, sample estimation, and tests of hypotheses. A graphing calculator is required. Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH 094 or MATH 095 with a grade of C or better or YVCC placement into MATH& 146 Distribution for DTA: Quantitative or Natural Sciences but not both Yakima Valley Community College, 2015-2016 145 146 MATH& 148: Business Calculus 5 Cr Quarters: W, S Derivatives and integrals of polynomial, rational, exponentials, and logarithmic functions with applications to business, economics, and social sciences. A TI graphing calculator (83/84) is required for this class. Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH& 141 or MATH 111 with a grade of C or better Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 151: Calculus I 5 Cr Quarters: F, W, S Thisisthefirstofafour-quartercalculussequence. Topicsstudiedincludelimits,differentiationtechniques foralgebraicfunctions,differentiationtechniquesfor transcendental functions, and applications of derivatives. A graphic calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH& 142 with a grade of C or better or YVCC placement into MATH& 151 Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 152: Calculus II 5 Cr Quarters: F, W, S The second course in the four-quarter calculus sequence explores the following in detail: techniques of integration for algebraic and transcendental functions, improper integrals, volumes of revolution, and applications to physics and engineering such as work, hydrostatic force, and centroids. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH& 151 with a grade of C or better Distribution for DTA: Quantitative or Natural Sciences but not both MATH& 153: Calculus III 5 Cr Quarters: W, S The third course in the four-quarter calculus sequence studiesdifferentialequations,infinitesequences,infinite series, vectors in the plane and space, polar coordinates, cylindrical coordinates, spherical coordinates, parametric equations, vector functions, and functions of several variables. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Credit will be granted for either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH& 152 with a grade of C or better Distribution for DTA: Quantitative or Natural Sciences but not both MATH 190: Co-op Field Experience I 4 Cr Prerequisite: Permission of instructor Quarters: O MATH 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 MATH 220: Linear Algebra 5 Cr Quarters: W Afirstcourseinlinearalgebracoveringsystemsoflinear equations, matrices, vector spaces and subspaces, eigenvalue theory, linear transformations, orthogonality, quadratic forms, determinants, and applications. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Prerequisite: MATH& 151 with a grade of C or better Distribution for DTA: Quantitative MATH& 254: Calculus IV 5 Cr Quarters: O The fourth quarter of the calculus sequence. Topics include limits and continuity for functions of more than one variable,partialdifferentiationandapplications,directional derivatives, multiple integrals, line integrals, divergence, curl, Green’s Theorem, and Stoke’s Theorem. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Prerequisite: MATH& 153 with a grade of C or better Distribution for DTA: Quantitative MATH 264: Differential Equations 5 Cr Quarters: S Elementarytechniquesappliedtoordinarydifferential equationswithemphasisonthelineardifferentialequation. A graphing calculator is required for this class. The calculator should be equivalent to the TI-84+ or TI-nspire (not CAS). Prerequisite: MATH& 153 with a grade of C or better Recommended: MATH 220 Distribution for DTA: Quantitative Modern Languages Notes for all Modern Languages: • • • • Onlyfivecreditsof100-levelmodernlanguage(American Sign Language, French, German, or Spanish) may be used for Humanities distribution. Second-yearcoursesarenotlimitedtoonlyfivecreditsfor Humanities distribution. These courses may also count toward a student’s major or minor at a four-year institution. A modern language minor consists of approximately 47 credits, and 15 of those credits can be taken at YVCC. Students who are unsure of placement level after meeting with an advisor should discuss their placement with a modern language instructor. If interested in more accurately determining placement, students may take a language placement test in the computer lab located in the Deccio Higher Education Center, Room 208 (with the exception of ASL). The Modern Language department does not award credit by placement testing. Students earn credit only through successful completion of courses. American Sign Language The goal of the modern language courses is to enable the students to interact successfully with native signers and to relate language behavior to real-world situations. The regular academic courses meet on a daily basis. It is advisable to begin the modern language 101 sequences in the Fall quarter and thereby complete a one-year program in ASL in fulfillmentoftherequirementatmanyfour-yearcollegesor universities. Course Placement Students may generally be placed in ASL courses as outlined by the following: • ASL 101: No experience to one year of high school ASL • ASL 102: Two or more years of high school ASL • ASL 103: Three or more years of high school ASL ELL - English Language Learning The goal of the English Language Learning courses is to enable the students to interact successfully with native speakers and to relate language behavior to real-world situations. The regular academic courses meet on a daily basis. It is advisable, although not required, that the student begin the ELL 090 sequences in the fall quarter and thereby complete a one-year program in ELL. Course Placement OpentoallstudentswhosefirstlanguageisnotEnglishand who have learned English outside of the home environment. Student must be able to speak English with a certain degree of accuracy and be able to satisfy the requirements of everyday situations. Students may be required to take a placement test given by the instructor to determine their language level. Students may be placed in these ELL courses in no particular order: • ELL 090: Listening & Speaking in an Academic Setting • ELL 091: Research & Writing in an Academic Setting • ELL 092: Reading & Interpretation in an Academic Setting Spanish The goal of the modern language courses is to enable the students to interact successfully with native speakers and to relate language behavior to real-world situations. The regular academic courses meet on a daily basis. The conversationcoursesdifferfromtheacademiccourses primarily in breadth. They are usually taught in the evenings and typically meet twice a week. It is advisable to begin the modern language 101 or 201 sequences in the fall quarter and thereby complete a one-year program in Spanish in fulfillmentoftherequirementatmanyfour-yearcollegeor universities. Course Placement Students may generally be placed in Spanish courses as outlined by the following: • Spanish 101: No Spanish to one year of high school Spanish • Spanish 102: Two or more years of high school Spanish • Spanish 103: Three or more years of high school Spanish • Spanish 201: Four or more years of high school Spanish Please note: Spanish classes are not open to native speakers of Spanish (heritage speakers). Courses for native speakers are listed under SPAN 231, 232, and 233. Spanish for Native Speakers The goal of these classes is to provide language learning opportunities for heritage Spanish speakers. The courses are designed to enhance and strengthen students’ speaking, writing, reading, and listening skills as well as develop strong cultural pride and awareness of the Hispanic world. Course Placement Students may generally be placed in these Spanish courses in no particular order. • Spanish 231: Second-year Spanish for Professional Speaking • Spanish 232: Second-year Spanish for Academic Writing • Spanish 233: Second-year Spanish for Reading Courses American Sign Language ASL 101: American Sign Language I 5 Cr Quarters: F, W, S The course will develop the language skills necessary for functionalproficiencyandcreativeuseofAmericanSign Language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Deaf. This course will enable the students to participate in short conversations and use limited memorized material. Basic vocabulary, sign formation, and grammatical structures will be covered. The emphasis, however, will be on active expressive and receptive communication in ASL. Distribution for DTA: Humanities ASL 102: American Sign Language II 5 Cr Quarters: W, S The course will develop the language skills necessary for functionalproficiencyandcreativeuseofAmericanSign Language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Deaf. This course will enable the students to participate in conversations of greater length and use memorized material to combine phrases and sentences. Additional vocabulary, sign formation, and grammatical structures will be covered. The emphasis, however, will be on active expressive and receptive communication in ASL. Prerequisite: A passing grade in ASL 101 or proven proficiency at that level Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 147 148 ASL 103: American Sign Language III 5 Cr Quarters: S The course will develop the language skills necessary for functionalproficiencyandcreativeuseofAmericanSign Language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Deaf. This course will enable the students to participate in conversations of greater length and use memorized material to create narratives. Additional vocabulary, sign formation, and grammatical structures will be covered. The emphasis, however, will be on active expressive and receptive communication in ASL. Prerequisite: A passing grade in ASL 102 or proven proficiency at that level Distribution for DTA: Humanities English Language Learning ELL 090: Listening and Speaking in Academic Setting 5 Cr Quarters: O Thiscourseoffersnon-nativespeakersofEnglish opportunities to study standard English in an academic setting. The course allows the students to reactivate the English they have learned previously and to further develop their target language skills and abilities, to learn more about the target language and cultures, to acquire English literacy and academic skills, and to enhance and further both their career and their educational opportunities. The emphasis, however, will be on oral academic English. Prerequisite: This course is open to those students whose firstlanguageisnotEnglishandwhohavelearnedEnglish outside the home environment. They must be able to speak English with a certain degree of accuracy and be able to satisfy the requirements of everyday situations. They will be required to take a listening/speaking and grammar placement examination given by the instructor. ELL 091: Research and Writing in Academic Setting 5 Cr Quarters: O Thiscourseoffersnon-nativespeakersofEnglish opportunities to study standard English in an academic setting. The course allows the students to reactivate the English they have learned previously and to further develop their target language skills and abilities, to learn more about the target language and cultures, to acquire English literacy and academic skills, and to enhance and further both their career and their educational opportunities. The emphasis, however, will be on written English. Prerequisite: This course is open to those students whose first language is not English and who have learned English outside the home environment. They must be able to speak English with a certain degree of accuracy and be able to satisfy the requirements of everyday situations. They will be required to take a writing and grammar placement examination given by the instructor. Yakima Valley Community College, 2015-2016 ELL 092: Reading and Interpretation in Academic Setting 5 Cr Quarters: O Thiscourseoffersnon-nativespeakersofEnglish opportunities to study standard English in an academic setting. The course allows the students to reactivate the English they have learned previously and to further develop their target language skills and abilities, to learn more about the target language and cultures, to acquire English literacy and academic skills, and to enhance and further both their career and their educational opportunities. The emphasis, however, will be on reading and interpreting academic English. Prerequisite: This course is open to those students whose first language is not English and who have learned English outside the home environment. They must be able to speak English with a certain degree of accuracy and be able to satisfy the requirements of everyday situations. They will be required to take a reading and grammar placement examination given by the instructor. Spanish SPAN 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. SPAN 101: Spanish I First Year 5 Cr Quarters: F, W, S, SR This course will develop the language skills necessary for functionalproficiencyandcreativeuseoftheSpanish language. With frequent and meaningful student-to-teacher and student-to-student interaction, monitored practice, and individual feedback during instructional time, students will explore the language, people, and cultures of Spanishspeaking communities. This course will enable the students to participate in short conversations and/or use limited memorized material. Basic vocabulary, fundamentals of pronunciations, and grammatical structures will be covered. The emphasis,however, will be on oral comprehension and spoken language. Distribution for DTA: Humanities SPAN 102: Spanish II First Year 5 Cr Quarters: F, W, S This course will develop the language skills necessary for functionalproficiencyandcreativeuseoftheSpanish language. With frequent and meaningful student-toteacher and student-to-student interaction, monitored practice, and individual feedback during instructional time, students will explore the language, people, and cultures of Spanish-speaking communities. This course will enable the students to participate in conversations of greater length and/or use memorized material to create narratives. Additional vocabulary, fundamentals of pronunciation, and grammatical structures will be covered. The emphasis, however, will be on oral comprehension and spoken language. Prerequisite: SPAN 102 with a grade of C or better or permission of instructor Distribution for DTA: Humanities SPAN 103: Spanish III First Year 5 Cr Quarters: S This course will develop the language skills necessary for functionalproficiencyandcreativeuseoftheSpanish language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Spanish-speaking communities. This course will enable the student to participate in short narratives and/or use memorized material to create short paragraphs. Additional vocabulary, pronunciation, and grammatical structures will be covered. The emphasis, however, will be on oral comprehension and spoken language. Prerequisite: SPAN 102, a placement test, or comparable competency Distribution for DTA: Humanities SPAN 111: Conversational Spanish I First Year 3 Cr Quarters: O This course will acquaint participants with some Hispanic cultural patterns and basic Spanish pronunciation. Students will also learn a basic speaking vocabulary related to everyday situations. SPAN 112: Conversational Spanish II First Year 3 Cr Quarters: O This course will acquaint participants with some Hispanic cultural patterns and basic Spanish pronunciation. Students will also learn a basic speaking vocabulary related to everyday situations. Prerequisite: SPAN 111 or comparable competency SPAN 113: Conversational Span III First Year 3 Cr Quarters: O This course will acquaint participants with some Hispanic cultural patterns and basic Spanish pronunciation. Students will also learn a basic speaking vocabulary related to everyday situations. Prerequisite: SPAN 112 or comparable competency SPAN 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor SPAN 201: Spanish I Second Year 5 Cr Quarters: O This course will develop the language skills necessary for functionalproficiencyandcreativeuseoftheSpanish language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Spanish-speaking communities. This course will enable the students to make up their own sentences, not limited to very familiar or memorized material. Additional vocabulary, pronunciation, and grammatical structures will be covered. The emphasis, however, will be on oral comprehension and spoken language. Prerequisite: SPAN 103, two or more years of high school Spanish, a placement test, or comparable competency; native speakers normally qualify for second-year courses Distribution for DTA: Humanities SPAN 202: Spanish II Second Year 5 Cr Quarters: O This course will develop the language skills necessary forfunctionalproficiencyandcreativeuseofthe Spanish language. Using a communicative, interactive, and task-based approach, the student will explore the language, people, and culture of the Spanish-speaking communities. This course will enable the students to deal with complications in such situations one might encounter in living in the target culture. Additional vocabulary, pronunciation, and grammatical structures will be covered. The emphasis, however, will be on oral comprehension and spoken language. Prerequisite: SPAN 201, three or more years of high school Spanish, a placement test, or comparable competency; native speakers normally qualify for second-year courses Distribution for DTA: Humanities SPAN 203: Spanish III Second Year 5 Cr Quarters: O This course will develop the language skills necessary for functionalproficiencyandcreativeuseoftheSpanish language. Using a communicative, interactive, and taskbased approach, the student will explore the language, people, and culture of the Spanish-speaking communities. This course will enable the students to hypothesize, to support opinions, persuade, describe in detail and narrate in detail with precision. Additional vocabulary, pronunciation, and grammatical structures will be covered. The emphasis, however, will be on oral comprehension and spoken language. Prerequisite: SPAN 202, three or more years of high school Spanish, a placement test, or comparable competency; native speakers normally qualify for second-year courses Distribution for DTA: Humanities Spanish for Heritage Learners SPAN 231: Second-Year Spanish for Professional Speaking 5 Cr Quarters: F ThiscourseoffersSpanishheritagelearnersopportunitiesto study standard Spanish in an academic setting. The course allows students to reactivate the Spanish they have learned previously and to develop it further, to learn more about their language and cultural heritage, to acquire Spanish literacy and academic skills, to enhance career opportunities, andtofulfillcollegelanguageadmissionrequirements.The emphasis, however, will be on oral, academic Spanish. Prerequisite: Students must have been raised in a Spanishspeaking home, speak Spanish with a certain degree of accuracy, and be able to satisfy the requirements of everyday situations. Distribution for DTA: Humanities SPAN 232: Second-Year Spanish for Academic Writing 5 Cr Quarters: F, W, S ThiscourseoffersSpanishheritagelearnersopportunitiesto study standard Spanish in an academic setting. The course allows students to reactivate the Spanish they have learned previously and to develop it further, to learn more about their language and cultural heritage, to acquire Spanish literacy and academic skills, to enhance career opportunities, andtofulfillcollegelanguageadmissionrequirements.The emphasis, however, will be on written, academic Spanish. Prerequisite: Students must have been raised in a Spanishspeaking home, speak Spanish with a certain degree of accuracy, and be able to satisfy the requirements of everyday situations. Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 149 150 SPAN 233: Second-Year Spanish for Academic Reading 5 Cr Quarters: W, S ThiscourseoffersSpanishheritagelearnersopportunitiesto study standard Spanish in an academic setting. The course allows students to reactivate the Spanish they have learned previously and to develop it further, to learn more about their language and cultural heritage, to acquire Spanish literacy and academic skills, to enhance career opportunities, andtofulfillcollegelanguageadmissionrequirements.The emphasis, however, will be on written, academic Spanish. Prerequisite: Students must have been raised in a Spanishspeaking home, speak Spanish with a certain degree of accuracy, and be able to satisfy the requirements of everyday situations. Distribution for DTA: Humanities Music Yakima Valley Community College has long been recognized as having a cutting-edge music program for music majors and non-majors. Some of the courses include classes in music theory, music composition, computer music, history, and literature. Private lessons are also available in voice, piano, and the major instruments. In addition, the department’s performing groups include Concert Choir, Salsa Band, Jazz Ensemble, Chamber Singers, jazz combos, Sax Quartet, and Guitar Ensemble. These groups perform and tour locally, regionally, and internationally and have also received numerous awards from major festivals. YVCC music groups have performed in China, Denmark, England, Italy, and Poland. The department also releases a quarterly music collection online featuring original music composed by YVCC students (YVCC Create Music Project). Please visit us on the website for more information about YVCC music at www.YVCC.edu/Music Applied Music: Class Instruction Applied Music: Class instruction courses (MUS 107, 108, and 113) are primarily for beginning students whether music majors or non-majors. All applied music courses, including ensembles, may be repeated for credit. Applied Music: Private Instruction The Applied Music: Private instruction courses are MUS 150, 160, 162, 165, 170, 180, 185, and 195. They are open to anyYVCCstudent.Lessonsoninstrumentsnotofferedby YVCCmusicstaffmaybearrangedwithqualifiedoff-campus instructorsandauthorizedforcollegecreditbythestaff at a cost of $200 per credit, payable to the instructor. This fee is in addition to the tuition fee payable to the college. Lessons for instrumental instruction are arranged through the instrumental director and for voice and piano through the director of choral activities. Students will take one halfhour lesson per week (one credit) at the discretion of the instructor. Music majors should do extended work in two applied music areas, not necessarily concurrently, while enrolledatYVCC.Juryperformancesineachappliedfield are required at the end of each quarter. Performances are for music faculty or in recitals. All applied music courses, including ensembles, may be repeated for credit. Music History & Appreciation The music history and appreciation courses are MUSC& 105, MUS 116, 117, 119, 218, 224, 225, and 226. Music Theory The music theory sequence (MUS 100, 101, 102, 103, 104, 105, 106, 201, 202, 207, 208, 209, 210, 211, and 212) is required of all music majors. Performance The performance courses are MUS 130, 133, 142, 149, 220, and 298. Courses MUS 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, noncredit course. Requires an audition. Extra time to be arranged. Prerequisite: Permission of instructor MUS 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 MUS 100: Music Fundamentals 3 Cr Quarters: S Basic musical terms, notation, scales, and rhythm. Primarily for non-majors. MUS 107: Beginning Piano is recommended as a supplement to this course. The music theory sequence is required of all music majors. Distribution for DTA: Humanities MUS 101: Ear Training I 2 Cr Quarters: F Ear training, interval singing, and melodic dictation. Required of music majors and minors. This class is linked to MUS 102. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Distribution for DTA: Humanities MUS 102: Music Theory I 3 Cr Quarters: F Firstinaseriesofsixtheorycoursesoffered.Studyofmajor and minor scales, major and minor key signatures, perfect and major intervals, and basic elements of rhythm. This class is linked to MUS 101. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Distribution for DTA: Humanities MUS 103: Ear Training II 2 Cr Quarters: W Continuation of Ear Training I. Interval and melodic singing as well as melodic dictation. Required of music majors and minors. This class is linked to MUS 104. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 101 Distribution for DTA: Humanities MUS 104: Music Theory II 2 Cr Quarters: W Continuation of Music Theory I. Study of triads, seventh chords, rhythmic division, and grouping of the beat. This class is linked to MUS 103. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 102 Distribution for DTA: Humanities MUS 105: Ear Training III 2 Cr Quarters: S Continuation of Ear Training II includes rhythmic reading. Required of music majors and minors. This class is linked to MUS 106. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 103 and MUS 104 MUSC& 105: Music Appreciation 5 Cr Quarters: F, W, S Designed to guide non-majors, through listening skills, into an awareness of the elements of music and historical periods and to stimulate a broader understanding of music as an art. Distribution for DTA: Humanities MUS 106: Music Theory III 3 Cr Quarters: S ContinuationofMusicTheoryII.Studyoffiguredbass procedures, diatonic chord functions, and rules of harmonic progression. This class is linked to MUS 105. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 104 MUS 107: Beginning Piano 2 Cr Quarters: F, W, S Class instruction primarily for beginning students. May be repeated for credit. MUS 108: Intermediate Piano 2 Cr Quarters: W Advancement of piano skills. Prerequisite: MUS 107 or previous piano training MUS 113: Beginning Guitar 2 Cr Quarters: F, W, S Group meetings to study basic beginning techniques. May be repeated for credit. MUS 116: History of Rock and Roll 5 Cr Quarters: F, W, S, SR This class is a survey of the history of rock music from the earliestevolutionofBlackAmericaninfluencetomusicstyles of the 1980s. Class discussions will highlight the connections between American popular culture and stylistic trends in rock music. Distribution for DTA: Humanities MUS 117: Music of the World 3 Cr Quarters: W This course will be a survey of music from cultures throughout the world, emphasizing musical style from non-western European sources. It will emphasize musical literature and styles not covered in MUSC& 105 and MUS 119. Distribution for DTA: Humanities MUS 119: History of Jazz 5 Cr Quarters: F, W, S Evolution of the jazz art form in America. Study of important artists and works, style periods, musical elements, and social contexts as well as the development of musical listening skills.Groupprojectsandfinalpaperrequired. Distribution for DTA: Humanities MUS 130: College Chorus 3 Cr Quarters: F, W, S Preparation and performance of choral literature. Public performance required. Concert tours, performance with orchestra, other choirs, or musical ensembles may be required. May be repeated. Distribution for DTA: Humanities - Performance MUS 133: Chamber Singers 2 Cr Quarters: F, W, S Select vocal performing group by audition. Prerequisite: Concurrent enrollment in MUS 130 and by audition Distribution for DTA: Humanities - Performance MUS 142: Ensemble Small Group 1 Cr Quarters: F, W, S Exploration, preparation, and performance of jazz and classical chamber ensemble concepts and literature. Heavy emphasis on acquiring improvisational skills. Regular public performances and concert tours. Audition required. May be repeated. Prerequisite: Approval of the director Yakima Valley Community College, 2015-2016 151 152 MUS 149: Jazz Ensemble 2 Cr Quarters: O Preparation and performance of jazz ensemble literature. Regular concert tours and performances with guest artists at the local, regional, and national level. Additional sectional rehearsals are required on a weekly basis. Audition required. May be repeated. Extra time to be arranged. Prerequisite: Approval of the director Distribution for DTA: Humanities - Performance MUS 150: Woodwind Private 1-2 Cr Quarters: F, W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 160: Piano Private 1-2 Cr Quarters: F, W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 162: Guitar Private 1-2 Cr Quarters: F, W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 165: Percussion Private 1-2 Cr Quarters: W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 170: Voice Private 1-2 Cr Quarters: F, W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 180: Violin/Viola Private 1-2 Cr Quarters: F, W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 185: Cello/Bass Private 1-2 Cr Quarters: W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor Yakima Valley Community College, 2015-2016 MUS 195: Brass Private 1-2 Cr Quarters: W, S Students studying in their principal area of concentration will take one, one-hour lesson per week (2 credits). Students studying in a secondary or minor area will take one, half-hour lesson per week (1 credit). Prerequisite: Permission of instructor MUS 201: Music Composition I 3 Cr Quarters: W The practical study of beginning music composition. Emphasis is placed on melody expansion, various harmonies,figurations,rhythm,andsimplerounded binaryform.Extensivewrittenworkcombiningthefive basic elements, concluding with a two- to three-minute composition for piano, voice and piano, or piano and other acoustic instrument. The music theory sequence is required of all music majors. Prerequisite: MUS 101 and MUS 102 or permission of instructor MUS 202: Music Composition II 3 Cr Quarters: S The practical, advanced study of music composition. Emphasis is placed on further creation of melody, harmony, and forms. From variation to serialism and textural composition. Extensive composition in each area concluding with a two- to four-minute work for chorus, piano, solo voice, or instrument and piano or combination. The music theory sequence is required of all music majors. Prerequisite: MUS 201 or permission of instructor MUS 207: Ear Training IV 2 Cr Quarters: F A continuation of Ear Training III. Required of music majors. Emphasizes four-part harmonic dictation. Intermediate work in rhythmic reading and dictation. This course is linked to MUS 208. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 105 and MUS 106 MUS 208: Music Theory IV 3 Cr Quarters: F Continuation of Music Theory III. Study of basic part writing procedures and analysis techniques for diatonic triads and dominant seventh chords. This course is linked to MUS 207. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 106 MUS 209: Ear Training V 2 Cr Quarters: W Continuation of Ear Training IV and required of music majors. Four-part harmonic dictation including modulation to closely related keys, non-harmonic tones, and seventh chords. This class is linked to MUS 210. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 207 MUS 210: Music Theory V 3 Cr Quarters: W Continuation of Music Theory IV. Study of part writing procedures for diatonic seventh chords, secondary dominant chords, and secondary leading tone chords. Introduction to common modulation techniques. This class is linked to MUS 209. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 208 MUS 211: Ear Training VI 2 Cr Quarters: S Continuation of Ear Training V including adding altered chords and modulations to distant keys. This class is linked to MUS 212. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 209 MUS 212: Music Theory VI 3 Cr Quarters: S Continuation of Music Theory V. Study of advanced modulation techniques and part writing procedures for altered chords. This class is linked to MUS 211. You must register for both courses for a total of 5 credits. The music theory sequence is required of all music majors. Prerequisite: MUS 210 MUS 218: Music of the 20th Century 5 Cr Quarters: F Music of the 20th century studies the music created during the 20th century from Impressionism to, and including, computer composition. Other styles are surrealism, aleatoric music, texture composition, neoromanticism, jazz, third stream, pop, and fusion. Distribution for DTA: Humanities MUS 224: Music History I 3 Cr Quarters: F Study of the traditional periods of music history. Emphasis on musical styles of the medieval, Renaissance, Baroque, Classical, Romantic, and twentieth-century composers. Primarily for music majors. Distribution for DTA: Humanities MUS 225: Music History II 3 Cr Quarters: W Study of the traditional periods of music history. Emphasis on musical styles of the medieval, Renaissance, Baroque, Classical, Romantic, and twentieth-century composers. Primarily for music majors. Distribution for DTA: Humanities MUS 226: Music History III 3 Cr Quarters: S Study of the traditional periods of music history. Emphasis on musical styles of the medieval, Renaissance, Baroque, Classical, Romantic, and twentieth-century composers. Primarily for music majors. Distribution for DTA: Humanities MUS 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in music. Nursing Careers Career opportunities are available as a Licensed Practical Nurse or as a Registered Nurse. It is anticipated that beginning Fall 2016, the Nursing program will begin a Direct Transfer Agreement (DTA) with one or more universities in Washington state. Please refer to the program's website www.YVCC.edu/Nursing for the most current information regarding potential changes in program requirements. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.Access.wa.gov or www.WorkforceExplorer.com and through the Washington Center for Nursing at www. WaCenterforNursing.org Program Outcomes Upon successful completion of the Nursing Program the student will pass the State Licensing Exam and be prepared for entry-level practice as a Registered Nurse. Program Options Associate of Applied Science in Nursing The YVCC Associate of Applied Science degree in Nursing (ADN) program is six quarters in length. In addition, most students complete a year or more of required and supporting courses prior to program entry. The ADN program is accredited by the Accreditation Commission for Education in Nursing (ACEN) and approved by the Washington State Nursing Care Quality Assurance Commission. Students who successfully complete the six quarters of the program are eligible to take the licensure exam for registered nursing (RN). Practical Nursing Option Studentswhosuccessfullycompletethefirstfourquartersof the program are eligible to take the national licensing exam for practical nursing (LPN). The practical nursing option is approved by the Washington State Nursing Care Quality Assurance Commission. Location Thesix-quarterADNprogramisofferedinYakimaonthe YVCCcampus.Theclinicalportionoftheprogramisoffered at various healthcare agencies throughout the YVCC service district. Program Requirements The following courses must be completed before acceptance to the Nursing program. Courses taken at other institutions and/or online must meet equivalency requirements at Yakima Valley Community College. Any science course taken online must have a lab component with an instructor on site and supervising the lab in order to meet equivalency at YVCC. Students who have taken advanced placement courses in high school must verify credit with the appropriate department at YVCC. Any course awarded a P or S will be given a C (2.0) value for GPA calculations on application. Required Courses: • CHEM 109 (4 Cr) - Principles of Chemistry Lecture (taken concurrently with CHEM 110) • CHEM 110 (1 Cr) - Principles of Chemistry Lab (taken concurrently with CHEM 109) • BA 256 (5 Cr) - Statistics or MATH& 146 (5 Cr) Introduction to Statistics • BIOL 109 (5 Cr) - General Biology (not used in GPA calculations) • BIOL 230 (5 Cr) - Human Anatomy and Physiology I Yakima Valley Community College, 2015-2016 153 154 • • • • • BIOL 231 (5 Cr) - Human Anatomy and Physiology II BIOL 232 (5 Cr) - Microbiology ENGL& 101 (5 cr) - English Composition I or ENGL 102 (5 Cr) - English Composition II PSYC& 100 (5 Cr) - General Psychology PSYC& 200 (5 Cr) - Lifespan Psychology Required Supporting Classes: • Five credits of Humanities electives taken from those approved for distribution credits in the YVCC catalog. • Five credits of Social Sciences electives taken from those approved for distribution credits in the YVCC catalog.ThesefivecreditsareinadditiontoPSYC&100 and PSYC& 200. Grades A minimum grade of C (2.0) must be achieved in all required prerequisite and supporting courses with a cumulative GPA of 2.5. Students must maintain a minimum of a 2.0 (C) grade point in each nursing course throughout the program. Although supporting courses may be taken any time prior to program completion, due to the high number of applicants, admission to the program is based on a prioritization policy. Please refer to the Nursing program website at www.YVCC. edu/Nursing for information regarding this policy. Application and Admission Application Process The most current information about the Nursing program is available on the college website at www.YVCC.edu/Nursing Students must be accepted for general admission to the college before the application to the Nursing program will be considered. When notice is received of acceptance into the college, it does not mean the student has been accepted into the Nursing program. A separate acceptance letter will be received from the Nursing department. Transcripts Twoofficialtranscriptsofallcoursestakenatothercolleges must be submitted to the college. One set must be sent to theNursingprogramandonetotheAdmissionsOffice.The applicant is solely responsible for obtaining transcripts for YVCCfiles.Noapplicationwillberevieweduntilalltranscripts have been supplied and evaluated. Please allow 4 weeks for official transcript evaluation. Application Deadlines It is the student’s responsibility to verify that all records including name, address, telephone, and email contact information have been received in the Nursing department prior to the deadline date for application evaluation. Application deadline information is available at www.YVCC. edu/Nursing Admissions Criteria Students must maintain a cumulative GPA of 2.5 (C+) in all required or supportive coursework. In addition, any grade below C (2.0) will not be accepted in any course taken. The Nursing program prioritizes students for admission when there are more students than spaces available. Information regarding prioritization is available on the Nursing website www.YVCC.edu/Nursing Transfer of Nursing Coursework Acceptance of nursing coursework taken in another Nursing program is done on a case-by-case basis. Please contact the Nursing program directly at 509-574-4902 for more information. Students applying to the Nursing program who have previously taken any coursework in another Nursing program must supply transcripts and any other program performance indicators as requested before the application Yakima Valley Community College, 2015-2016 can be considered. Based on the information obtained, a student may be admitted, admitted with conditions, or denied admission. In addition, a letter from the director of the previous Nursing program stating that the student left the program in good standing must be provided from that program’s Nursing director. This documentation must be mailed directly to the YVCC Nursing program from the previous program. Students who fail to disclose attendance and/ or unsatisfactory work in another Nursing program may be subject to immediate dismissal from the YVCC Nursing program if the information becomes available while they are enrolled. Additional Requirements Immunizations and CPR StudentsarerequiredtocompletetheirCPRcertificationand immunizations prior to program entry. Please refer to the Nursing web site at www.YVCC.edu/Nursing for the most up to date information regarding immunization and CPR requirements. Clinical Course Information Clinical hours are generally scheduled between 6:00 a.m. and 11:30 p.m. Clinical may rotate from day to evening shift. Some nights and weekends may be scheduled in order to gainspecificexperiences.Studentsmustprovidetheirown transportation. Travel may be required to outlying clinical sites. Students must abide by the policies stated in the Nursing Student Handbook related to matters of academic standards, integrity, attendance, behavior, and dress as it pertains to clinical rotations. Background Check Information Criminal history background information and drug screening is required of students applying to the Nursing program. Information obtained from the background check and/or drug screen will be considered in determining student eligibility to enter the program and/or complete clinical courses. Inability to participate in clinical experiences due to information obtained from the criminal history background check and/or drug screen may result in the student’s inability to satisfactorily complete program degree requirements. Questions regarding this policy should be directed to the Nursing Program Coordinator who can be reached at 509-574-4909. Additional Course Requirements The Nursing department recommends that students complete all supporting courses before entering the Nursing program. Required Supporting Courses Credits Humanities electives from approved distribution courses 5 Social Sciences electives from approved distribution courses 5 Total Elective Credits 10 Quarter #1 NRSE 110 Nursing I: Theory NRSE 111 Nursing I: Practice 6 6 Quarter #2 NRSE 120 Nursing II: Theory NRSE 121 Nursing II: Practice 6 6 Total Credits (must be completed to enter second quarter) 12 Total Credits (must be completed to enter third quarter) 12 Quarter #3 NRSE 130 Nursing III: Theory 6 NRSE 131 Nursing III: Practice 6 Total Credits (must be completed to enter fourth quarter) 12 Quarter #4 NRSE 210 Nursing IV: Theory 6 NRSE 211 Nursing IV: Practice 6 Total Credits (must be completed to enter fifth quarter) 12 All of the above courses are required for eligibility to take the NCLEX-PN licensure examination. Quarter #5 NRSE 220 Nursing V: Theory 5 NRSE 221 Nursing V: Practice 6 NRSE 228 Legal & Prof. Issues of the Registered Nurse 1 Total Credits (must be completed to enter sixth quarter) 12 Quarter #6 NRSE 230 Nursing VI: Theory 5 NRSE 231 Nursing VI: Practice 6 NRSE 238 Profession of Nursing 1 Total Credits 12 Total Program Credits 72 All of the above courses are required for eligibility to take the NCLEX-RN licensure examination. Courses Please contact the Nursing department for the most up-todate information. NRSE 100: Nursing Assistant Certified (NAC) Theory 10 Cr Quarters: W, S This course consists of 100 theory hours covering the following content areas: First Aid/CPR, HIV/AIDS, bloodborne pathogens, and basic technical nursing assistance skills. It is designed to prepare students to demonstrate competencies in the following areas: medical terminology, computer literacy, mathematical principles, basic care skills, infection control, and safety and emergency procedures. Studentspracticeeffectivecommunication(oral,reading, writing) and interpersonal skills as well as workplace skills. In addition, students will demonstrate understanding of rules and regulations pertaining to Washington State NAC requirements. Prerequisite: Students must achieve a minimum score of 221 on the CASAS reading test and/or a minimum score of 58 on the COMPASS reading test and possess the ability to read, write, and comprehend the English language. In addition, all students must successfully pass a Washington State Patrol criminal history background check NRSE 101: Nursing Assistant Certified (NAC) Practice 4 Cr Quarters: W, S Thiscourseisdesignedtopreparestudentsforsafe,effective care of the resident in the clinical setting. Throughout the duration of this hands-on experience, the student will expand their knowledge in the following areas: medical terminology, basic technical skills, mental health and social service needs, rights and independence promotion, infection control, and safety and emergency procedures. Students will exhibit knowledge of the rules and regulations pertaining to Washington State NAC requirements as well as practice effectivecommunicationandinterpersonalskillsandjob preparation. Prerequisite: Successful completion of NRSE 100 theory course. In addition, all students must pass a Washington State Patrol criminal history background check, a Department of Social and Health Services background check, and be up-to-date in all required immunizations NRSE 102: Nursing Assistant Certified (NAC) Test Preparation 1 Cr Quarters: W, S This course is designed to prepare students for the state nursingassistantcertificationexambyprovidinglabpractice in skills prior to testing. Prerequisite: Successful completion of NRSE 100 and NRSE 101 or permission of instructor NRSE 110: Nursing I Theory 6 Cr Quarters: F, W, S This is the beginning theoretical course in the associate degree sequence. It includes the foundations needed for basic nursing practice and more advanced study in the program. Students are introduced to the concepts of person, health, environment, and nursing. The nursing process is presented as the primary mechanism for providing care. Therapeutic communication techniques are studied as well as introductory knowledge in pharmacology. The components of a complete multidimensional health assessment are presented. The focus is on the well individual and normal physiologic functioning. Additional concepts basic to nursing practice are addressed including safety, nutrition, lifespan, health teaching, culture, leadership, and ethical and legal aspects of practice. Prerequisite: Admission to the Nursing program NRSE 111: Nursing I Practice 6 Cr Quarters: F, W, S This is the beginning clinical course in the associate degree sequence. This course provides for the clinical application of basic nursing concepts studied in the concurrent theoretical course (NRSE 110). Opportunities are provided for campus laboratory practice of selected nursing skills. The course also includes clinical experience in caring for adult patients in long-term care settings with an emphasis on the use of nursing process to promote adaptation and wellness. Beginning application of the concepts of lifespan, communication, legal and ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are included. Prerequisite: Concurrent enrollment in or successful completion of NRSE 110 NRSE 120: Nursing II Theory 6 Cr Quarters: F, W, S This theory course examines nursing care of selected clients throughout the lifespan experiencing multi-dimensional alterations originating from surgery, uncontrolled cell growth, alterations in the female reproductive system, sexually transmitted infections, and alterations in the integument. Adaptations with normal pregnancy, childbirth, and the newborn are examined as well as common alterations. Nursing process serves as the organizing framework for study and delivery of nursing care. The concepts of lifespan, communication, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are integrated throughout as means of promoting adaptation and wellness. Prerequisite: NRSE 110 , NRSE 111, and BIOL 231 NRSE 121: Nursing II Practice 6 Cr Quarters: F, W, S This course provides clinical application of theoretical concepts in the nursing care of clients experiencing surgery, pregnancy, and childbirth: the normal newborn and inpatient hospitalization. Clinical experiences include caring for selected clients in acute care and ambulatory care settings using the nursing process to promote adaptation and wellness. Application of the concepts of lifespan, communication, leadership, health teaching, pharmacology, nutrition, ethical/legal issues, pediatrics, safety, and culture are included. Prerequisite: NRSE 110, NRSE 111, and concurrent enrollment in or successful completion of NRSE 120 Yakima Valley Community College, 2015-2016 155 156 NRSE 130: Nursing III Theory 6 Cr Quarters: F, W, S This theory course examines nursing care of selected individuals throughout the lifespan experiencing multidimensional alterations in the cardiovascular, respiratory, urinary, male reproductive, hematologic, and immune systems. The nursing process serves as the organizing framework for study and delivery of nursing care. The concepts of communication, lifespan, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are integrated throughout as means of promoting adaptation and wellness. Prerequisite: NRSE 120 and NRSE 121 both with a grade of C or better NRSE 131: Nursing III Practice 6 Cr Quarters: F, W, S This course provides clinical application of theoretical concepts in nursing care of adult and pediatric patients experiencing multidimensional alterations originating from the cardiovascular, respiratory, urinary, hematological, and immune systems. Opportunities for campus laboratory and simulation laboratory practice of selected skills are furnished. The course also includes clinical experiences in caring for selected clients in ambulatory and acute care with an emphasis on the use of nursing process to promote adaptation and wellness. The concepts of communication, lifespan, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are included. Prerequisite: NRSE 120 , NRSE 121, and concurrent enrollment in or successful completion of NRSE 130 NRSE 210: Nursing IV Theory 6 Cr Quarters: F, W, S This theory course examines nursing care of selected individuals throughout the lifespan who are experiencing multidimensional alterations in the musculoskeletal, neurological, endocrine (thyroid and endocrine pancreas), and gastrointestinal systems. The nursing process serves as the organizing framework for the study and delivery of nursing care. The concepts of lifespan, communication, leadership, health teaching, pharmacology, nutrition, legal/ ethical issues, safety, and culture are integrated throughout as a means of promoting adaptation and wellness. Prerequisite: NRSE 130 and NRSE 131 both with a grade of C or better NRSE 211: Nursing IV Practice 6 Cr Quarters: F, W, S This clinical course provides clinical application of theoretical concepts in nursing care of adults and children in acute and outpatient settings. The course is focused on multidimensional alterations originating from the musculoskeletal, neurological, sensory, endocrine (thyroid and endocrine pancreas), and gastrointestinal systems. Opportunities are provided for classroom or campus laboratory practice of selected skills. The course includes clinical experience in caring for selected adult and pediatric clients with an emphasis on the use of nursing process to develop individualized nursing care plans for patients across the lifespan. The concepts of lifespan, communication, leadership, safety, health teaching, pharmacology, nutrition, legal/ethical issues, and culture are included. Prerequisite: NRSE 130, NRSE 131, and concurrent enrollment in or successful completion of NRSE 210 Yakima Valley Community College, 2015-2016 NRSE 220: Nursing V Theory 5 Cr Quarters: F, W, S This theory course examines nursing care of selected individuals throughout the lifespan who are experiencing complex alterations in wellness across multiple systems. In addition to medical-surgical care, the care of patients experiencing a high-risk pregnancy and high-risk newborns is described. Nursing care of patients with alterations in pediatrics is also discussed. The nursing process serves as the organizing framework for study and delivery of nursing care. The concepts of communication, lifespan, legal and ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are integrated throughout as means of promoting adaption and wellness. Prerequisite: NRSE 210 and NRSE 211 both with a grade of C or better and permission of instructor. NOTE: Permission of instructor is required to withdraw from course NRSE 221: Nursing V Practice 6 Cr Quarters: F, W, S This clinical course provides application of theoretical concepts in the nursing care of patients in acute and ambulatory care settings. The focus of the acute care experience is on the care of patients with complex health alterations in wellness. Clinical experiences in caring for intrapartumpatientsandpediatricpatientsarealsooffered. Opportunities for campus laboratory practice of selected skills are furnished. The course emphasizes the use of the nursing process to develop individualized nursing care plans for patients across the lifespan. The concepts of lifespan, communication, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are included. Prerequisite: NRSE 210 , NRSE 211, and concurrent enrollment in or successful completion of NRSE 220 NRSE 228: Legal & Professional Issues of the Registered Nurse 1 Cr Quarters: F, W, S This course provides an overview of the role of the registered nurse in coordinating patient care. Topics discussed include legal aspects of nursing practice, delegation of care, quality improvement,professionalcommunication,andconflict management. The concepts of communication, legal/ethical issues, leadership, and safety are integrated throughout as a meansofpromotingeffectivepatientcare. Prerequisite: NRSE 210 and NRSE 211 both with a grade of C or better and concurrent enrollment in or successful completion of NRSE 220 NRSE 230: Nursing VI Theory 5 Cr Quarters: F, W, S This theory course examines nursing care of selected individuals throughout the lifespan experiencing multi-dimensional alterations in the gastrointestinal, genitourinary, neurological, immune and endocrine systems as well as care of patients experiencing mental health problems. The nursing process serves as the organizing framework for study and delivery of nursing care. Curricular threads of lifespan, communication, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are integrated throughout as a means of promoting adaption and wellness. Prerequisite: NRSE 220, NRSE 221, and NRSE 228 all with a grade of C or better and permission of instructor Note: Permission of instructor is required to withdraw from this course NRSE 231: Nursing VI Practice 6 Cr Quarters: F, W, S This clinical course provides clinical application of theoretical concepts in the nursing care of individuals who are experiencing multi-dimensional health alterations. Clinical experiences include acute inpatient mental health and a precepted clinical practicum. The course emphasizes the use of the nursing process to develop individualized nursing care plans for patients across the lifespan. The concepts of communication, lifespan, legal/ethical issues, pharmacology, nutrition, leadership, safety, health teaching, and culture are included. Prerequisite: NRSE 220 and NRSE 221 both with a grade of C or better and concurrent enrollment in or successful completion of NRSE 230 NRSE 238: Profession of Nursing 1 Cr Quarters: F, W, S This course provides an overview of nursing as a profession. Topics discussed include the nurse's role in resource management; nursing ethics and advocacy; quality; and preparation for the NCLEX exam, entry into practice, and employment. Prerequisite: NRSE 220, NRSE 221, and NRSE 228 all with a grade of C or better and concurrent enrollment in or successful completion of NRSE 230 Nutrition The Nutrition program emphasizes understanding the “whole food”; guiding students through a study of food, its individualcomponents,howitaffectsthehumanbody,and how it interacts with other foods. Our focus is to provide students with nutrition education that merges the science of nutrition with a broader view of wellness, community, and the environment. The Nutrition courses help prepare students for careers in dietetics, family and consumer science, and allied health as well as to transfer to other institutions to pursue undergraduate degrees. Courses NUTR& 101: Nutrition 5 Cr Quarters: F, W, S, SR Nutrition is a science based on principles of chemistry and molecular biology. This course will study the body's utilization of nutrients, energy metabolism, how nutrients can be made applicable to one's lifestyle, nutrition and disease, changes in the life cycle from pregnancy through older adult years, preventive health care, energy balance and weightmanagement,andidentificationofreliablenutrition information. Distribution for DTA: Natural Sciences NUTR 104: Winning Sports Nutrition 1 Cr Quarters: F, W, S This course contains current information on the fundamentals of sports nutrition. These fundamentals include how nutrients work in the body for optimal sports performance. NUTR 106: Nutrition/Lifestyle/Consumer Choices 2 Cr Quarters: F, W, S, SR Explores relationships between disease risk factors and stress as well as exercise and diet. The class targets strategies to live a healthier lifestyle and make wise consumer choices. Emphasis is on helping students apply the information to their own lives. NUTR 201: Nutrition in the Life Cycle 3 Cr Quarters: O This course explores the nutrient needs and key nutritional concerns at each stage of the life cycle including prenatal and maternal, infant, preschool and school-age child, adolescent, adult, and older adult. Key nutritional concerns such as growth and development, food behaviors, eating disorders, nutrition in athletics, preventive health, as well as weight control will be addressed. Prerequisite: Successful completion of or concurrent enrollment in NUTR& 101 Yakima Valley Community College, 2015-2016 157 158 Philosophy Courseofferingsinphilosophyareintendedfortransfer students as well as for those wanting personal enrichment. Courses stress the cultivation of personal and interpersonal expression of ideas through critical and constructive reading, writing, listening, speaking, and observing. The program alsoorganizesfilmanddiscussionevents,conference attendance, participation in essay competitions, and community involvement. Courses PHIL& 101: Introduction to Philosophy 5 Cr Quarters: F, W, S, SR Introduction to Philosophy exposes students to major tools, problems, and domains of philosophy. Students engage in the activity of philosophizing through the use of historical and contemporary reading. Questions addressed include: Are my beliefs all a matter of opinion? What is reality? What is truth? Does God exist? Am I free? Does science give us knowledge? Distribution for DTA: Humanities PHIL& 115: Critical Thinking 5 Cr Quarters: F/W/SR The class provides an informal, non-symbolic introduction to logic and critical thinking emphasizing real-life examples, natural language applications, and the informal logical fallacies. Students learn the concept of an argument, learn how to distinguish arguments from non-arguments, and studydifferentpatternsofargumentation.Studentsalso learn how to critically evaluate arguments and how to construct arguments of their own. Prerequisite: Eligibility for ENGL 095 or permission of instructor Distribution for DTA: Humanities PHIL& 120: Introduction to Logic 5 Cr Quarters: F, W, S, SR Students of Introduction to Logic examine validity, soundness, inference, necessity, implication, and other concepts central to standard reasoning processes. Examination of the nature of formal arguments including propositional (sentence) logic and predicate logic (quantificationallogic)arestressed.Creditwillbegrantedfor either Quantitative or Natural Sciences distribution but not both. Prerequisite: MATH 094 or MATH 095 Distribution for DTA: Quantitative or Natural Sciences but not both PHIL 150: Existential Group 2 Cr Quarters: O An intensive, experiential course that explores, on both a personal and impersonal level, how themes in the writings of existentialist philosophers such as Beckett, Buber, Camus, de Beauvoir, Dostoyevsky, Kafka, Kierkegaard, Heidegger, Nietzsche, and Sartre pertain to the lifestyles, attitudes, and actions of class participants. The course entails interacting in a group format and making presentations. The group interactions are often interpersonal encounters rather than ones involving only abstract discussion. Attendance and weekly reading and writing assignments are all required. Prerequisite: One course in Philosophy and permission of instructor Distribution for DTA: Humanities Yakima Valley Community College, 2015-2016 PHIL 167: World Philosophy 5 Cr Quarters: O Studentsexplorethreetofivelivingphilosophiesnomore than one of which has found primary expression in Europe. Thematic comparisons and contrasts will be included; for example, the nature of reality and the nature of the self in its social setting. Representative philosophies include African, American Indian, Buddhist, Confucian, and Taoist. Prerequisite: Eligibility for ENGL 095 desirable; college-level reading and writing Distribution for DTA: Humanities PHIL 215: Introduction to Ethics 5 Cr Quarters: F Introduction to Ethics assesses the underlying models that inform morally relevant behavior. Some issues addressed include the nature of value claims, moral relativism and skepticism, morality and well-being, moral responsibility, ethics and science, ethics and religion, and the connections, if any, between theory and daily living. Distribution for DTA: Humanities PHIL 220: Philosophy of Religion 5 Cr Quarters: W This course analyzes issues basic to understanding religion, such as the problem of evil and theodicies, free will and divine foreknowledge, arguments for/against the existence of God, and the relationship between faith and reason. It will also examine major world religions such as Buddhism, Confucianism, Taoism, Christianity, Hinduism, Islam, and Judaism. Prerequisite: ENGL& 101 or permission of instructor Distribution for DTA: Humanities Photography Photography courses are structured for the novice as well as those with some photographic experience. Beginners should enroll in Photography 103. Students with photographic experience should consult the instructor for advanced placement. Courses PHOTO 103: Digital Photography 5 Cr Quarters: F, W, S An introduction to digital camera operation, image manipulation software, visualization skills, expressive sensitivity, and quality printing. Emphasis is on the elements and principles of photographic composition, ethical issues, aesthetic vocabulary, and the study of how images communicate. Includes lecture, supervised lab, and group critiques. Students must provide a digital camera with operable controls (eg. F-stop, shutter speed). Distribution for DTA: Humanities - Performance PHOTO 190, 191: Co-op Field Experience I, II Variable Cr Quarters: O Prerequisite: Permission of instructor PHOTO 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Projects in photography determined by instructor and student. Prerequisite: Permission of Instructor PHOTO 201: History of Photography 5 Cr Quarters: O A survey of the history and continually evolving properties of photography as a cultural language and art-making tool from its beginnings in the 1830s to the digital imaging of today. Prerequisite: Eligibility for ENGL* 101 Distribution for DTA: Humanities PHOTO 203: Intermediate Digital Photography 5 Cr Quarters: O Continuation of elements and principles from beginning digital photography, with greater emphasis on the development of personal visual statements as well as a more in-depth understanding of the hardware, software, and concepts of visual communication. Includes lecture, supervised studio time, and group critiques. Students must provide a digital SLR camera with operational controls (eg. F-stop, shutter speed) and camera RAW. Prerequisite: PHOTO 103 Distribution for DTA: Humanities - Performance Physical Education The courses in Physical Education provide students with the knowledge, awareness, and physical activity skills necessary to meet their desired personal state of “wellness”. The student will learn to make educated and responsible decisions when faced with a variety of lifestyle choices. No more than three PE activity credits apply towards a DTA degree. Courses PE 076: Community Service 0 Cr Quarters: F, W, S Thisnoncreditcourseisofferedtoallowstudents,staff, faculty, and community members to use the YAK Fitness/ Wellness Center. PE 130: Weight Training Beginning 1 Cr Quarters: F, W, S This introductory course provides a foundation of knowledge and skill to acquaint students with the proper fundamentals, technique, and safety in resistance training and alternative exercises to develop muscle endurance and strength. It will provide an opportunity for the creation of individualized training program that allows the student to meet personal, fitness,andhealthgoals.ActivityCourse. PE 132: Weight Training Advanced 2 Cr Quarters: F, W, S This course is a continuation of resistance training which will enhance and include advanced techniques for strengthening and building endurance. Each student will be responsible for creating and performing an individualized program as well as for a commitment to increasing active participation time in the YAK Fitness/Wellness Center. Activity Course. PE 180: Wellness for Life I 1 Cr Quarters: F, W, S This course is designed for the student who wants to take responsibility for lifestyle changes for wellness through developingpersonalgoals,appraisingfitnesslevels,and applyingpositivebehavioralchangesthroughactivefitness program design and self-awareness activities. Activity Course. PE 181: Wellness for Life II 1 Cr Quarters: F, W, S Introduces students to the intermediate challenge of wellness concepts which enhance physical, mental, and emotional well-being with emphasis on personal commitment and responsibility for positive lifestyle change. Activity Course. Prerequisite: PE 180 PE 182: Wellness for Life III 1 Cr Quarters: F, W, S This course continues to expand the student’s physical and mental well-being through positive lifestyle change with the developmentofadiversified,advancedfitnessprogram. Activity Course. Prerequisite: PE 181 PE 184: Fast Track Wellness for Life 2 Cr Quarters: F, W, S Thisentry-levelcourseinstructsstudentstodevelopafitness or active activity program to meet personal goals and move toward greater awareness of a student’s human potential for life-long health, self-care and sensitivity to the environment. Assignmentsandfitnesscenterlabhoursarestructured tostudyphysicalfitness,goalsetting,basicnutritional components, self-behavior change tactics, cardiovascular endurance,muscularstrength,andflexibility.ActivityCourse. Yakima Valley Community College, 2015-2016 159 160 PE 199: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in physical education. Physical Education, Men’s Physical Education, Men's PEM 243: Basketball Fundamentals II Men 2 Cr Quarters: F Intermediate- to advanced-level basketball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Activity Course. Prerequisite: A first meeting skills test is conducted to ensure entry-level skills and coordination are possessed in order to ensure safety of the student; permission of instructor PEM 143: Basketball Fundamentals Men 2 Cr Quarters: F Entry- to intermediate-level basketball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition.Afirst-meetingskillstestisconductedtoensure entry-level skills and coordination are possessed in order to ensure safety of the student. Activity Course. Prerequisite: Permission of instructor PEM 245: Baseball Fundamentals II Men 2 Cr Quarters: F Intermediate- to advanced-level baseball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Activity Course. Prerequisite: A first meeting skills test is conducted to ensure entry-level skills and coordination are possessed in order to ensure safety of the student; permission of instructor PEM 145: Baseball Fundamentals Men 2 Cr Quarters: F Entry- to intermediate-level baseball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition.Afirst-meetingskillstestisconductedtoensure entry-level skills and coordination are possessed in order to ensure the safety of the student. Activity Course. Prerequisite: Permission of instructor PEM 253: Basketball Theory II Men 3 Cr Quarters: F Application of coaching related to various basketball fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the basketball coach will be studied and applied through community service learning. Prerequisite: PEM 153 and permission of instructor PEM 153: Basketball Theory Men 3 Cr Quarters: F A study of the fundamental skills of basketball as well as offensiveanddefensivestrategies.Attentionisgivento the rules of the game, administration, and other related problems facing the prospective coach. The approach throughout is from the viewpoint that the students are preparing for coaching. Prerequisite: Permission of instructor PEM 155: Baseball Theory Men 3 Cr Quarters: W A study of the fundamental skills of baseball as well as offensiveanddefensivestrategies.Attentionisgivento the rules of the game, administration, and other related problems facing the prospective coach. The approach throughout is from the viewpoint that the students are preparing for coaching. Prerequisite: Permission of instructor PEM 163: Techniques of Basketball I Men 2 Cr Quarters: W Advances basketball skills and techniques course which meets on a daily basis during Winter quarter only; basketball rules and interpretation and application; organized and officiatedcontestsonaregularbasis.Flexibleschedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: Permission of instructor PEM 165: Baseball Techniques Men 2 Cr Quarters: S Baseball skills and technique class which meets on a daily basisduringSpringquarteronly.Organizedandofficiated contests are played on a regular basis. Flexible schedule is necessary since class meets daily, some evenings, and weekends. Activity Course. Prerequisite: Closed enrollment; permission of instructor Yakima Valley Community College, 2015-2016 PEM 255: Baseball Theory II Men 3 Cr Quarters: W Application of coaching related to various baseball fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the baseball coach will be studied and applied through community service learning. Prerequisite: PEM 155 and permission of instructor PEM 263: Basketball Techniques II Men 2 Cr Quarters: W Advanced basketball skills and techniques course that meets on a daily basis during Winter quarter only; basketball rules, theirinterpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developing athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized basketball and permission of instructor PEM 265: Baseball Techniques II Men 2 Cr Quarters: S Advanced baseball skills and techniques course that meets on a daily basis during Spring quarter only; baseball rules, theirinterpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developing athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized baseball and permission of instructor Physical Education, Women’s PEW 143: Basketball Fundamentals Women 2 Cr Quarters: F Entry- to intermediate-level basketball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition.Afirst-meetingskillstestisconductedtoensure entry-level skills and coordination are possessed in order to ensure safety of the student. Activity Course. Prerequisite: Permission of instructor PEW 144: Soccer Fundamentals Women 2 Cr Quarters: S Entry- to intermediate-level soccer skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition.Afirst-meetingskillstestisconductedtoensure entry-level skill coordination is possessed in order to ensure the safety of the student. Activity Course. Prerequisite: Permission of instructor PEW 146: Softball Fundamentals Women 2 Cr Quarters: F Entry- to intermediate-level softball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition.Afirst-meetingskillstestisconductedtoensure entry-level skills and coordination are possessed in order to ensure the safety of the student. Activity Course. Prerequisite: Permission of instructor PEW 148: Volleyball Fundamentals Women 2 Cr Quarters: S Entry- to intermediate-level volleyball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Skill instruction includes serving, passing, hitting,andoffensiveanddefensivepositioning.Afirstmeeting skills test is conducted to ensure entry-level skill coordination is possessed in order to ensure the safety of the student. Activity Course. Prerequisite: Permission of instructor PEW 153: Basketball Theory Women 3 Cr Quarters: F A study of the fundamental skills of basketball as well as offensiveanddefensivestrategies.Attentionisgivento the rules of the game, administration, and other related problems facing the prospective coach. The approach throughout is from the viewpoint that the students are preparing for coaching. Prerequisite: Permission of instructor PEW 154: Soccer Theory Women 3 Cr Quarters: F A study of coaching soccer and the fundamental skillsforsocceraswellastheoffensiveanddefensive strategies. Attention is given to the rules of the game, the administration, and other related problems facing the perspective coach. The approach throughout is from the viewpoint that the students are preparing for coachingrelated opportunities. Prerequisite: Permission of instructor PEW 156: Softball Theory Women 3 Cr Quarters: W A study of the fundamental skills of softball as well as offensiveanddefensivestrategies.Attentionisgivento the rules of the game, administration, and other related problems facing the prospective coach. The approach throughout is from the viewpoint that the students are preparing for coaching. Prerequisite: Permission of instructor PEW 158: Volleyball Theory Women 3 Cr Quarters: F Study of the fundamental skills, rules, and history of volleyballaswellastheoffensiveanddefensivestrategies. Attention is given to the rules of the game, administration, and other related problems facing the prospective coach. The approach throughout is from the viewpoint that students are preparing for coaching. Prerequisite: Permission of instructor PEW 163: Basketball Techniques Women 2 Cr Quarters: W A basketball skills and techniques course which studies the game of basketball, game plans, rules interpretation, and applicationtechniques.Organizedandofficiatedcontests areplayedonaregularbasis.Aflexiblescheduleisnecessary since the class meets daily, some evenings, and weekends. Activity Course. Prerequisite: Permission of instructor PEW 164: Soccer Techniques Women 2 Cr Quarters: F A soccer skills and techniques class which meets on a daily basis.Organizedandofficiatedcontestsareplayedona regularbasis.Aflexiblescheduleisnecessarysincetheclass meets daily, some evenings, and weekends. Activity Course. Prerequisite: Permission of instructor PEW 166: Softball Techniques Women 2 Cr Quarters: S Softball skills and technique class which meets on a daily basisduringSpringquarteronly.Organizedandofficiated contests are played on a regular basis. Flexible schedule is necessary since class meets daily, some evenings, and weekends. Activity Course. Prerequisite: Closed enrollment; permission of instructor PEW 168: Volleyball Techniques Women 2 Cr Quarters: F Advanced volleyball skills and technique class which meets on a daily basis during Fall quarter only. Volleyball rules interpretationandapplication.Organizedandofficiated contests are played on a regular basis. Flexible schedule is necessary since class meets daily, some evenings, and weekends. Activity Course. Prerequisite: Permission of instructor; high school or club program experience in organized volleyball PEW 243: Basketball Fundamentals II Women 2 Cr Quarters: F Intermediate- to advanced-level basketball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Activity Course. Prerequisite: First meeting skill test is conducted to ensure entrylevel skills and coordination are possessed in order to ensure safety of the students; permission of instructor Yakima Valley Community College, 2015-2016 161 162 PEW 244: Soccer Fundamentals II Women 2 Cr Quarters: S Intermediate- to advanced-level soccer skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Activity Course. Prerequisite: First meeting skill test is conducted to ensure entrylevel skills and coordination are possessed in order to ensure safety of the students; permission of instructor PEW 248: Volleyball Fundamentals II Women 2 Cr Quarters: S Intermediate- to advanced-level volleyball skills class stressing the basic fundamentals of the game. Emphasis is placed on individual skill development as opposed to team play or competition. Activity Course. Prerequisite: First meeting skill test is conducted to ensure entrylevel skills and coordination are possessed in order to ensure safety of the students; permission of instructor PEW 253: Basketball Theory II Women 3 Cr Quarters: F Application of coaching related to various basketball fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the basketball coach will be studied and applied through community service learning. Prerequisite: PEW 153 and permission of instructor PEW 254: Soccer Theory II Women 3 Cr Quarters: F Application of coaching related to various soccer fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the soccer coach will be studied and applied through community service learning. Prerequisite: PEW 154 and permission of instructor PEW 256: Softball Theory II Women 3 Cr Quarters: W Application of coaching related to various softball fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the softball coach will be studied and applied through community service learning. Prerequisite: PEW 156 and permission of instructor PEW 258: Volleyball Theory II Women 3 Cr Quarters: F Application of coaching related to various volleyball fundamentalskills,developingoffensiveanddefensive strategies, and enforcing the game rules. The administrative duties of the volleyball coach will be studied and applied through community service learning. Prerequisite: PEW 158 and permission of instructor PEW 263: Basketball Techniques II Women 2 Cr Quarters: W Advanced basketball skills and techniques course that meets on a daily basis during Winter quarter only; basketball rules, theirinterpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developmental athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized basketball and permission of instructor Yakima Valley Community College, 2015-2016 PEW 264: Soccer Techniques II Women 2 Cr Quarters: F Advanced soccer skills and techniques course that meets on a daily basis during Fall quarter only; soccer rules, their interpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developmental athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized soccer and permission of instructor PEW 266: Softball Techniques II Women 2 Cr Quarters: S Advanced softball skills and techniques course that meets on a daily basis during Spring quarter only; softball rules, theirinterpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developmental athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized softball and permission of instructor PEW 268: Volleyball Techniques II Women 2 Cr Quarters: F Advanced volleyball skills and techniques course that meets on a daily basis during Fall quarter only; volleyball rules, their interpretationandapplication;organizedandofficiated contests on a regular basis. The student will participate in an organized, educational community service event to assist in instructing developmental athletes’ techniques and skills. Flexible schedule is necessary as class meets daily, some evenings, and weekends. Activity Course. Prerequisite: High school or summer program experience in organized volleyball and permission of instructor Physical Science Physics Courses Introduction to Physics The introductory physics course is a good beginning science course while the general physics and engineering physics courses give strong backgrounds in classical physics (i.e. mechanics, energy, work, electricity and magnetism, thermodynamics, optics, and waves). Physical science courses are intended as an introduction for non-science majors to the four main physical sciences: physics, chemistry, astronomy, and geology. Physical Science I covers physics and chemistry, while Physical Science II covers astronomy, atmospheric science, and geology. PHSCI 076: Community Service 0 Cr Quarters: O Thisclassisofferedasaself-support,communityservice, non-credit course. PHSCI 101: Physical Science Survey I 5 Cr Quarters: O A survey of elementary physics and chemistry designed for students taking no further courses in these subjects. PHSCI 101 may be used either for chemistry or physics distribution but not for both. Prerequisite: MATH 084 or 085 or placement into MATH 095 or above Distribution for DTA: Natural Sciences PHSCI 102: Physical Science Survey II 5 Cr Quarters: O A survey of physical and historical geology, meteorology, and astronomy designed for students taking no further courses in the physical sciences. PHSCI 102 may be used either for geology or astronomy distribution but not for both. Prerequisite: ENGL 090T or YVCC placement into ENGL 095 Distribution for DTA: Natural Sciences PHSCI 112: Physical Science Survey II with Lab 5 Cr Quarters: W, S A survey of basic astronomy, atmospheric science, and physical geology with lab, designed for students taking no further courses in the physical sciences. PHSCI 112 may be used for distribution for either astronomy or physical geography but not for both. Prerequisite: ENGL 090T or YVCC placement into ENGL 095 and MATH 075 or YVCC placement into MATH 085 Distribution for DTA: Natural Sciences - Lab PHSCI 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Short courses, seminars, and individual study. Prerequisite: Permission of instructor Physics is the fundamental science. All other sciences andtechnologiescanfindtheirrootsinphysics.Physics principles are logical and simple and yet far-reaching in their application. Currently, a single-quarter introductory physics courseandtwodifferentphysicssequencesareoffered. General Physics I, II, III General Physics I, II, and III are non calculus-based, intended for non-science majors and some allied health majors; however, these courses are a solid preparation for engineering and science majors with no previous experience with physics. These courses can be used by the transfer student to satisfy a general or non calculus-based physics requirement at a university. Engineering Physics I, II, III Engineering Physics I, II, and III are calculus-based, intended for the mathematics, physics, chemistry, or engineering major transfer student. Most pre-med majors also use this sequence. The sequence of subjects is essentially the same as the general physics sequence, but the topics are considered from a more rigorous mathematical viewpoint. The lab content of engineering physics is similar to general physics, but the mechanics of the labs (data collection and analysis)areverydifferent.Thesecoursescanbeusedbythe transfer student to satisfy an engineering or calculus-based physics requirement at a university. Courses PHYS 099, 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Workshops, short courses, and individual study. Prerequisite: Permission of instructor PHYS 100: Introduction to Physics 5 Cr Quarters: SR Introduction to Physics is a survey course designed to introduce and enhance a student’s understanding of elementary physics. This course emphasizes a more conceptual and less mathematical approach to physics. Topics include mechanics, heat, sound, electricity and magnetism, light, and special topics. While primarily designed for the non-science major (i.e., students in the arts, humanities, and social sciences), this is an excellent beginning science course for any student. Prerequisite: MATH 084 or MATH 085 or YVCC placement into MATH 095 or above Distribution for DTA: Natural Sciences PHYS 115: General Physics I Lecture 3 Cr Quarters: F, S PHYS 125: General Physics I Lab 2 Cr Quarters: F, S The overriding theme is classical mechanics. Topics include vectors, velocity, acceleration, work, energy, momentum, statics and equilibrium, and Newton’s laws of motion. A graphing calculator is required. For non-engineering majors and general science majors. Prerequisite: MATH& 141 or permission of instructor; PHYS 115 and PHYS 125 must be taken concurrently Distribution to DTA: Natural Sciences - Lab Yakima Valley Community College, 2015-2016 163 164 PHYS 116: General Physics II Lecture 3 Cr Quarters: W PHYS 126: General Physics II Lab 2 Cr Quarters: W Topicsincludefluids,waves,sound,heat,and thermodynamics. There is also a brief detour into the area of modern physics. A graphing calculator is required. For nonengineering majors and general science majors. Prerequisite: PHYS 115 and PHYS 125 or permission of instructor; PHYS 116/ and PHYS 26 must be taken concurrently Distribution for DTA: Natural Sciences - Lab PHYS 117: General Physics III Lecture 3 Cr Quarters: S PHYS 127: General Physics III Lab 2 Cr Quarters: S Topics include electricity, magnetism, circuits, optics, and (more) modern physics. A graphing calculator is required. For non-engineering majors and general science majors. Prerequisite: PHYS 116/ and PHYS 126 or permission of instructor; PHYS 117 and PHYS 127 must be taken concurrently Distribution for DTA: Natural Sciences - Lab PHYS 211: Engineering Physics I Lecture 3 Cr Quarters: F PHYS 221: Engineering Physics I Lab 2 Cr Quarters: F Classical mechanics at the calculus level. Typical topics include vectors, displacement, velocity, acceleration, work, energy, momentum, statics and equilibrium, and Newton’s laws of motion. A graphing calculator is required. For engineering and physical science (physics or chemistry) majors. Prerequisite: One year of high school physics or PHYS 115, PHYS 125, and MATH& 151 or permission of instructor; PHYS 211 and PHYS 221 must be taken concurrently Distribution for DTA: Natural Sciences - Lab PHYS 212: Engineering Physics II Lecture 3 Cr Quarters: W PHYS 222: Engineering Physics II Lab 2 Cr Quarters: W Topicsincludefluids,waves,sound,heat,and thermodynamics. There is a brief detour into the area of modern physics. A graphing calculator is required. For engineering and physical science (physics or chemistry) majors. Prerequisite: PHYS 211, PHYS 221, and MATH& 152 or permission of instructor; PHYS 212 and PHYS 222 must be taken concurrently Distribution for DTA: Natural Sciences - Lab PHYS 213: Engineering Physics III Lecture 3 Cr Quarters: S PHYS 223: Engineering Physics III Lab 2 Cr Quarters: S Topics include electricity, magnetism, circuits, optics, and (more) modern physics. A graphing calculator is required. For engineering and physical science (physics or chemistry) majors. Prerequisite: PHYS 212 and PHYS 222 or permission of instructor; PHYS 213 and PHYS 223 must be taken concurrently Distribution for DTA: Natural Sciences - Lab Yakima Valley Community College, 2015-2016 Political Science Political science is the study of government and public policy and of the political behavior of individuals and groups. Politicalscienceusesbothhumanisticandscientificmethods of analysis to examine individual and group behaviors and outcomes at the local, state, national, and international levels of politics (source: American Political Science Association). ThePoliticalScienceprogramatYVCCoffersmostofthe fundamental courses in the discipline that prepare students for a declared major or minor in political science at a fouryear college or university. Political science courses at YVCC also contribute toward general education requirements necessary for a bachelor’s degree in any liberal arts discipline. Courses POLS 099: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor POLS 100: Contemporary World Problems 3 Cr Quarters: O This course examines current global political, social, economic, and environmental issues. Each quarter will addressslightlydifferenttopicsdependingontheglobal situation. The course will not necessarily be region or countryspecific,butorganizedaroundglobalproblems such as the environment, economic development, weapons proliferation, trade, nationalism, and human rights. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences POLS 100W: Contemporary World Problems 5 Cr Quarters: F This course examines current global political, social, economic, and environmental issues. Each quarter will addressslightlydifferenttopicsdependingontheglobal situation. The course will not necessarily be region or countryspecific,butorganizedaroundglobalproblems such as the environment, economic development, weapons proliferation, trade, nationalism, and human rights. Students will choose a particular global problem and investigate it in depth. They will learn how to write a research paper appropriate for political science and the social sciences in general. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences POLS& 101: Introduction to Political Science 5 Cr Quarters: F, W, S, SR An introduction to the basic theories, concepts, and methods associated with an examination of political institutions, processes of political decision-making, and the sociocultural context that produces political choices. Thiscourseintroducesstudentstothemajorsubfieldsand methodologies of the discipline. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences POLS 201: Introduction to Political Theory 5 Cr Quarters: O This course is an introduction to the philosophical basis of political thought and activity. Political theorists ask fundamental questions about politics and seek to derive answers to these questions. The course is organized around several key concepts such as justice, liberty, equality, the ethical community, individual rights, and citizenship. Prerequisite: Eligibility for ENGL& 101 Distribution for DTA: Humanities POLS& 202: American Government 5 Cr Quarters: W, S An examination of the American political process and the institutions of the national government as well as an analysis of the United States’ political system from an evaluative perspective. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences POLS& 203: International Relations 5 Cr Quarters: W An introduction to the study of international relations. The course examines methods and theories of inquiry, the causesofconflictandtheconditionsforcooperationatthe global level, the nature of interstate relations, and the causes of change in the structure of international politics. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences POLS 205: State and Local Government 5 Cr Quarters: O An examination of the political process, institutions, functions, and structure of state and local government in the United States. Special emphasis is given to Washington State government. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences Professional/ Technical Education Courses PTECH 098, 198: Experimental/Exploratory Studies Variable Cr Quarters: O WorkFirst pre-employment truck driver training for TANF students. PTECH 099: Independent Study/Field Experience Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor PTECH 115: Applied Mathematics II 3 Cr Quarters: F, W, S, SR Thiscourseincludesmathematicalapplicationsforspecific professional/technical programs. The content may include the following topics: ratio, proportion, metric conversion, andscientificnotationaswellasroots,geometry,statistics, solution of equations, functions, polynomials, and formulas. Prerequisite: Coded in a professional/technical program in which PTECH 115 is required and eligibility for MATH 075 PTECH 116: Applied Mathematics II for Early Childhood Ed 5 Cr Quarters: S This course includes mathematical applications for early childhood educators. Concepts include math sense and problem-solving for whole numbers, fractions, decimals, percents, proportions, charts and graphs, geometry, and specificpreschooltopics. Prerequisite: Enrollment in an Early Childhood or Paraeducator degree or certificate program and one of the following: successful completion of MATH 075, eligibility for MATH 085, or permission of instructor PTECH 120: Technical Writing 5 Cr Quarters: F, W, S, SR Studentsinthiscoursewilllearnthedefinition,distinct features, and diverse applications of technical writing. They willalsopracticeandlearnthespecificcharacteristicsof technical writing: subject, audience, organization, style, tone, and other special features. Various technical writing formats such as business communications, informative reports, analytical and persuasive briefs, and research proposals will be practiced and learned. Prerequisite: Eligibility for ENGL& 101 and successful completion of IT 100 or IT 105 and BT 101 or BT 104 Yakima Valley Community College, 2015-2016 165 166 Psychology YakimaValleyCommunityCollegeoffersacoreofbasic psychology courses which will provide a sound introduction to the discipline. Psychology is the science of human behavior and experience and includes perspectives examining abnormal behavior, the biological bases of behavior, social interaction, and cognitive processes. These psychologycoursesareofferedforgeneraleducation, personal enrichment, and for students pursuing a career in psychologyorrelatedfields.Theyserveasprerequisitesfor several campus programs. Courses PSYC& 100: General Psychology 5 Cr Quarters: F, W, S, SR An introduction to the science of human behavior and experience, including fundamental perspectives as well as behavioral and cognitive processes. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences PSYCH 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in psychology. PSYCH 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor PSYC& 200: Lifespan Psychology 5 Cr Quarters: F, W, S, SR LifespanPsychologyprovidesasurveyofthescientificstudy of physical, cognitive, and emotional development and social changes that take place throughout the human lifespan. Students will explore the interaction between genetic and environmentalinfluencesonhumandevelopment. Prerequisite: PSYC& 100 Distribution for DTA: Social Sciences PSYCH 209: Fundamentals of Psychological Research 5 Cr Quarters: O This course addresses basic experimental and nonexperimental research designs and strategies and provides both lecture and laboratory experiences. Topics include hypothesis testing, interpretation of statistics, searching and evaluatingresearchliterature,fundamentalsofscientific writing, research strategies, and ethical issues in research. Prerequisite: PSYC& 100 and eligibility for MATH 095 Distribution for DTA: Social Sciences PSYCH 212: Human Life-span Develop. for CD Professionals 5 Cr Quarters: W An interdisciplinary, multi-cultural investigation of the entire human lifespan from conception through the dying process and death. Designed for those in the chemical dependency field.Opentochemicaldependencystudentsonly. Prerequisite: PSYC& 100 PSYC& 220: Abnormal Psychology 5 Cr Quarters: W, S Anintroductiontotheetiology,diagnosis,classification,and manifestations of psychopathology as well as recommended treatment modalities and prognosis. Prerequisite: Eligibility for ENGL& 101, eligibility for MATH 085, and PSYC& 100 Distribution for DTA: Social Sciences Yakima Valley Community College, 2015-2016 PSYCH 230: Social Psychology 5 Cr Quarters: F Socialpsychologyisthescientificstudyofthewaysinwhich people’sthoughts,feelings,andbehaviorareinfluenced by the real or imagined presence of others. Topics include self-concept, self-serving biases, self-deception, aggression, lovingandliking,socialinfluence,conformity,obedience, attitude formation, and attitude change. This course is crossdisciplined. Credit cannot be given for both PSYCH 230 and SOC 230. Prerequisite: PSYC& 100 or SOC& 101 Distribution for DTA: Social Sciences Radiologic Sciences The Radiologic Sciences program is a sequence of courses thatfulfillstheeducationalobjectivesestablishedby the American Society of Radiologic Technologists and competencies outlined by the American Registry of Radiologic Technologists. The program commences in June each year. The program is accredited through YVCC by the Northwest Commission on Colleges and Universities. A radiologic technologist is like a photographer. They take pictures or images of internal organs or structures within a person’s body. The technologist produces images usingionizingradiation,film,computers,etc.Anintegraljob responsibility is patient care. While producing images, human touch and patient safety are critical. Technologists will be faced with the entire spectrum of patient types: healthy people needing routine physical procedures, trauma victims, the critically or terminally ill, the elderly, etc. Program Outcomes Upon successful completion of this program the student should be able to: • Beproficientatperformingentry-leveljobskills. • Be prepared to take the national examination offeredbytheAmericanRegistryoftheRadiologic Technologists. Careers Upon successful completion of the 24-month program, students are granted an Associate of Applied Science degree in Radiologic Technology (AAS) and are eligible to apply totakethenationalregistryexaminationofferedbythe American Registry of Radiologic Technologists. Radiologic technologists seek employment in hospitals, clinics, and physicianoffices.Withadditionaltrainingand/orcollege coursework, graduates are eligible for CT, MRI radiation therapy, ultrasound, administration, and education. For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.WA.gov/ CareerGuide or www.WA.gov/ESD/lmea Degree Associate of Applied Science in Radiologic Technology All Radiologic Technology courses may be taken only in sequence or by special permission of the program coordinator. A grade of C (2.0) or better must be received in the courses required for the Associate of Applied Science degree in Radiologic Technology. Summer Quarter Credits RT 116 Radiographic Communications 2 RT 110 Introduction to Radiology 3 RT 117 AIDS/HIV/CPR 1 Total Credits 6 Fall Quarter BIOL 231 Human Anatomy and Physiology II 5 RT 111 Introduction to Clinical Experience 1 RT 120 Image Acquisition Theory I 3 RT 121 Image Acquisition Lab I 1 RT 130 Radiologic Positioning I Theory 3 RT 131 Radiologic Positioning I Lab 2 RT 140 Radiology Patient Care Theory 2 RT 141 Radiology Patient Care Lab 1 Total Credits 18 Winter Quarter RT 122 Image Acquisition Theory II 3 RT 123 Image Acquisition Lab II 1 RT 132 Radiologic Positioning II Theory 3 RT 133 RT 150 Radiologic Positioning II Lab Clinic Practicum I Total Credits Spring Quarter RT 134 Radiologic Positioning III Theory RT 135 Radiologic Positioning III Lab RT 136 Radiographic Procedures RT 151 Clinic Practicum II Total Credits Summer Quarter RT 250 Clinic Practicum III Total Credits Fall Quarter RT 230 Pathology & Advanced Procedures I RT 240 Radiation Biology RT 251 Clinic Practicum IV Total Credits Winter Quarter RT 220 Quality Management Theory RT 231 Pathology & Advanced Procedures II RT 252 Clinic Practicum V RT 259 Professional Prep Total Credits Spring Quarter RT 232 Pathology & Advanced Procedures III RT 246 Radiation Physics RT 253 Clinic Practicum VI RT 260 Registry Review Total Credits Total Program Credits 2 6 15 2 2 4 6 14 13 13 3 3 13 19 2 4 11 1 18 2 5 7 2 16 119 Admission Requirements • Candidate must meet general admission requirements of YVCC. • Applicants’filesmustbecompletebyMarch1. • Completion of college courses with a 2.7 (B-) cumulative GPA. • Completion of the following program prerequisites with a grade of C (2.0) or better. It is acceptable to repeat a course in order to receive the required GPA; however, a student will not be considered eligible for selection if s/he failed to receive a C (2.0) on the second attempt or needed to repeat three or more of the prerequisites. A student has the option to submit a letter of appeal if extenuating circumstances influencedunsatisfactorygrade(s). • BIOL 109 * (requires a C+ or better) • CHEM 100 * (or one year of high school chemistry) • ENGL& 102 • AH 119 * • MATH 095 * • CMST& 101 or CMST& 220 • BIOL 230 * • BIOL 231 * The following may be taken and completed by Winter quarter duringthefirstyearoftheprogram: • CMST& 101 or CMST& 220 • BIOL 231 *Coursesmusthavebeentakenwithinthepastfiveyears. Criminal History Information Criminal history and drug screening information will be requested of students enrolling in Radiologic Science. Information obtained from this inquiry will be treated confidentiallyandwillbeconsideredindeterminingthe students’ eligibility to complete clinical competencies. Inability to participate in clinical experience due to information obtained from the background check or drug screen will result in a student’s inability to satisfactorily complete program degree requirements or to take the examinationofferedbytheAmericanRegistryofRadiologic Yakima Valley Community College, 2015-2016 167 168 Technologists.Formorespecificinformation,contactthe program coordinator. Selection Procedure The application deadline is March 1. See the program applicationpacketforspecificcriteria.Finalselectionof applicants is based on the following: college GPA, completion of and GPA in program prerequisite, essay, visitation, and volunteer hours. Applicants who accumulate enough points toward selection will be scheduled for an interview, which will determinefinalselection.Notificationofstatus—acceptance, conditional acceptance, alternate, or rejection—will be sent to the candidate by May 30. Students who are accepted into the Radiologic Science program must meet current immunization requirements. The Radiologic Science program does not discriminate on the basis of age, marital status, sex, race, color, creed, national origin, the presence of any physical or sensory handicap, or being a disabled or Vietnam-era veteran. RT 110: Introduction to Radiography 3 Cr Quarters: SR This course is designed to orient the beginning radiology studenttothefieldofdiagnosticimaging.Studentswill reflectonhistoricaleventsinradiographyandexplore advancedimagingfields.Medicalethicsandlegalissueswill be studied. Prerequisite: Admission to the Radiologic Science program RT 111: Introduction to Clinical Experience 1 Cr Quarters: F This course provides opportunities for students to acquaint themselves with the clinical education centers and policies specifictoclinicaleducation.Thecontentofthiscourse includes becoming familiar with and completing competency testingonspecifichospitalradiographicequipmentaswellas filmanddarkroomprocedures. Prerequisite: Admittance to the Radiologic Science program and completion of RT 117 with a grade of S Clinical Assignments Clinical Assignment Scheduling Since clinical experience is a required portion of the educational program which builds skills, monetary reimbursement is not given for the time spent during the students’ clinical assignments. Students are assigned to a variety of shifts on a one-month rotational basis. Schedules are posted quarterly. RT 116: RT Communications 2 Cr Quarters: SR This course assists students to develop skills and knowledge about multicultural communication in a radiologic imaging/ medical environment. Focus is on cultural ethnicity and interaction with patients at medical facilities, Spanish verbal communication, and radiologic terminology. Prerequisite: Admittance to the Radiologic Science program Clinical Education Centers • Klickitat Valley Hospital • Sunnyside Community Hospital • Toppenish Community Hospital • Yakima Regional Medical & Cardiac Center • Yakima Valley Memorial Hospital RT 117: HIV/AIDS/CPR for Radiographers 1 Cr Quarters: SR This course meets the requirements for AIDS/HIV education as stated in WAC 246-12-260. Also included is CPR for the radiographer. Prerequisite: Admission to the Radiologic Science program Certificate RT 120: Image Acquisition Theory I 3 Cr Quarters: F This course is designed to teach the student basic technical principles and mathematical calculations of image production. The student will also obtain a basic knowledge of how x-radiation is produced and used in diagnostic medical radiography and what radiation safety measures can be taken to minimize exposure. Prerequisite: MATH 095 and admission to the Radiologic Science program CT Certificate Program TheCTcertificateprogramisanextensionprogramoffered to the radiologic technology graduate by application process. This two-quarter program consists of online delivery of academic classes and supervised clinical practicum in a CT scan department. Upon completion of this two-quarter program, students will have the classroom knowledge and the clinical competencies to prepare them to apply for the CTcertificationtestofferedbytheAmericanRegistryof Radiologic Technologists. TheCTcertificateprogrambeginsFallquarter.For technologists currently working in CT scan, clinical practicum may be waived. (See the program coordinator for exceptions.) Applications are accepted beginning March 1 for the year applying. For more information, contact the Radiologic Science program. Fall Quarter Credits RT 270 CT Physics & Quality Assurance 4 RT 272 Cross Sectional Anatomy & Pathology I 2 RT 273 CT Clinical Practicum I 7 Winter Quarter Credits RT 276 Cross Sectional Anatomy & Pathology II 4 RT 278 CT Special Procedures 2 RT 279 CT Clinical Practicum II 7 Total Certificate Credits 26 Courses Registration in radiologic science courses requires acceptance into the Radiologic Science program. Yakima Valley Community College, 2015-2016 RT 121: Image Acquisition Lab I 1 Cr Quarters: F This course includes orientation to radiographic equipment and application of prime exposure factors, geometric factors, density, and contrast in the laboratory setting. Prerequisite: Admission to the Radiologic Science program RT 122: Image Acquisition Theory II 3 Cr Quarters: W Course content includes the principles of digital radiography, computedradiography,radiographicfilm,automatic processing, grids, screens, and beam restriction. Prerequisite: RT 120 or permission of instructor RT 123: Image Acquisition Lab II 1 Cr Quarters: W Students will perform laboratory experiments to discover principles of automatic processing, sensitometry, and the use of radiographic accessories. Prerequisite: Admission to the Radiologic Science program RT 130: Radiologic Positioning Theory I 3 Cr Quarters: F Course emphasis is placed on radiographic protocols for the chest, upper extremities, abdomen, sternum, ribs, and IVU. Images will be analyzed for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 131: Radiologic Positioning I Lab 2 Cr Quarters: F Protocols for the chest, upper extremities, abdomen, sternum, ribs, and IVU will be practiced in a laboratory setting. Images will be produced and evaluated for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 132: Radiologic Positioning Theory II 3 Cr Quarters: W Course emphasis is placed on radiographic protocols for the lower extremities and vertebral column. Images will be analyzed for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 133: Radiographic Positioning II Lab 2 Cr Quarters: W Protocols for the lower extremities and the vertebral column will be practiced in a laboratory setting. Images will be produced and evaluated for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 134: Radiographic Position Theory III Lecture 2 Cr Quarters: S Course emphasis is placed on radiographic protocols for the alimentary tract and cranium to include skull, sinuses, facial bones, nasal bones, mandible, zygomas, and TMJs. Images will be analyzed for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 135: Radiographic Positioning III Lab 2 Cr Quarters: S Protocols for the vertebral column, alimentary tract, and cranium to include skull, sinuses, facial bones, nasal bones, mandible, zygomas, and TMJs will be practiced in a laboratory setting. Images will be produced and evaluated for proper demonstration of anatomy and diagnostic quality. Prerequisite: Admission to the Radiologic Science program RT 136: Radiographic Procedures 4 Cr Quarters: S This course is designed to acquaint the student with imaging considerations for the trauma, surgical, pediatric, and geriatric patient. Appropriate terminology, pathology, patient care, technical changes, and positioning variants will be explored. The student will learn pathology procedures and cross-sectional imaging for the skeletal system. Prerequisite: Admission to the Radiologic Science program or permission of instructor RT 140: Radiology Patient Care Theory 2 Cr Quarters: F This course is designed to teach the radiology student basic principles of patient care. The student will obtain basic knowledge of patient interaction, patient history, transport, emergency situations, basic laboratory tests, medical/surgical asepsis, venipuncture, contrast media administration, pharmacokinetics, and pharmacology. Prerequisite: Admission to the Radiologic Science program RT 141: Radiology Patient Care Lab 1 Cr Quarters: F This course provides the student with practical training in the area of patient care using the principles and theory learned in RT 140. Upon completion of this course, the student will have had the opportunity to practice and role play emergency situations, patient transfer, immobilization and body mechanic techniques, venipuncture, standard infection precautions, contrast administration, and medical/surgical asepsis. Prerequisite: Admission to the Radiologic Science program RT 150: Clinical Practicum I 6 Cr Quarters: W Students are assigned clinical experience in a radiology department to practice educational objectives that correlate withfirst-yearacademiccourses. Prerequisite: Successful completion of RT 111, RT 140, and RT 141 RT 151: Clinical Practicum II 6 Cr Quarters: S Students are assigned clinical experience in a radiology department to practice educational objectives that correlate with previously-learned academics. Prerequisite: RT 150 or permission of instructor RT 198: Experimental/Exploratory Studies Variable Cr Prerequisite: Permission of instructor Quarters: O RT 199: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor RT 220: Radiographic Quality Management 2 Cr Quarters: F This course explores equipment testing parameters for digitalandfilmimagingsystems.Itprovidesinstruction about components of x-ray generators, JCAHO government regulations and the requirements of a quality management program. Prerequisite: Admission to the Radiologic Science program RT 230: Pathology & Advanced Procedures I 3 Cr Quarters: F This course provides the student opportunities to acquaint themselves with anatomy, physiology, pathology, imaging, and advanced patient care procedures involving respiratory and digestive systems. Cross-sectional anatomy and laboratory tests for these systems will be addressed. Tomography, CT Scan, MRI and Ultrasound will be studied. Prerequisite: Admission to the Radiologic Science program RT 231: Pathology & Advanced Procedures II 4 Cr Quarters: W This course provides the student opportunities to acquaint themselves with anatomy, physiology, pathology, imaging, and advanced patient care procedures involving urinary, hematopoietic, circulatory/lymphatic, central nervous systems, and neoplasia. Cross-sectional anatomy and laboratory tests for these systems will be addressed. Prerequisite: Acceptance into the Radiologic Science program or permission of instructor Yakima Valley Community College, 2015-2016 169 170 RT 232: Pathology & Advanced Procedures III 2 Cr Quarters: S This course provides students opportunities to acquaint themselves with anatomy, physiology, pathology, imaging, and advanced patient care procedures involving endocrine and male and female reproductive systems. Cross-sectional anatomy and laboratory tests for these systems will be addressed. Sensory organs and genetics will also be studied. Prerequisite: Acceptance into the Radiologic Science program or permission of instructor RT 240: Radiation Biology 3 Cr Quarters: W Thestudyofradiation’seffectsonthebodyandhowtouse radiationprotectionfortechnologists,staff,patients,andthe community. Prerequisite: Admission to the Radiologic Science program or permission of instructor RT 246: Radiographic Physics 5 Cr Quarters: S This course introduces the student to basic physics concepts with special emphasis on the physics of electricity, magnetism, and electromagnetism and how they are applied to radiologic science. Prerequisite: RT 120 or permission of instructor RT 250: Clinical Practicum III 13 Cr Quarters: SR Students are assigned clinical experience in a radiology department to practice educational objectives that correlate withfirst-yearacademiccourses.Clinicalassignments include forty hours of experience per week throughout the quarter. Prerequisite: RT 151 or permission of instructor RT 251: Clinical Practicum IV 13 Cr Quarters: F Students are assigned clinical experience in a radiology department to practice educational objectives that correlate with previously-learned academics. Prerequisite: RT 250 or permission of instructor RT 252: Clinical Practicum V 11 Cr Quarters: W Students are assigned clinical experience in a radiology department to practice educational objectives that correlate with previously-learned academics. Prerequisite: RT 251 or permission of instructor RT 253: Clinical Practicum VI 7 Cr Quarters: S Students are assigned clinical experience in a radiology department to practice educational objectives that correlate with previously-learned academics. Prerequisite: RT 252 or permission of instructor RT 259: Professional Preparation 1 Cr Quarters: W In preparation for a career in radiology, students in this coursewilllearnlicensureandcertificationrequirementsas well as investigate career advancement opportunities. They will also practice employment strategies. Prerequisite: Acceptance into the Radiologic Science program or permission of instructor Yakima Valley Community College, 2015-2016 RT 260: Registry Review 2 Cr Quarters: S This course provides a review of program content to assist the student in preparation for the American Registry of Radiologic Technologists. Prerequisite: Acceptance into the Radiologic Science program or permission of instructor RT 270: CT Physics & Quality Assurance 4 Cr Quarters: F This course is designed to provide the academic instruction regarding CT scan equipment principles and operation. Equipment physics, image acquisition and image processing will be included as well as quality assurance testing. Prerequisite: Graduation from an accredited Radiography program or permission of instructor RT 272: Cross Sectional Anatomy & Pathology I 2 Cr Quarters: F This course presents information related to CT scanning of the thorax, abdomen, and pelvis. Sectional anatomy, pathology, and scanning techniques will be discussed. Prerequisite: Graduation from an accredited Radiography program or permission of instructor RT 273: CT Clinical Practicum I Variable Cr Quarters: F Students are assigned to clinical practicum in a CT scan departmenttopracticeclinicalobjectivesasdefinedbythe ARRT. Prerequisite: Admission to the CT certificate program or permission of instructor RT 276: Cross Sectional Anatomy and Pathology II 4 Cr Quarters: W This course presents information related to CT scanning of the head, neck, central nervous system, and musculoskeletal system. Sectional anatomy, pathology, and scanning techniques will be discussed. Prerequisite: Graduation from an accredited Radiography program or permission of instructor RT 278: CT Special Procedures 2 Cr Quarters: W This course is designed to provide the academic instruction regarding CT advanced procedure exams. Instruction on contrast administration and reactions, radiation protection, pediatric CT, 3-D imaging, cardiac and angiographic exams, radiation treatment planning, PET CT, patient care, and biopsy/drain procedures will be discussed. Prerequisite: Admittance to the CT certificate program or permission of instructor RT 279: CT Clinical Practicum II Variable Cr Quarters: W Students are assigned to clinical practicum in a CT scan departmenttopracticeclinicalobjectivesasdefinedbythe ARRT. Prerequisite: RT 273 or permission of instructor Reading Course READ 105: Critical Reading 5 Cr Quarters: F, W, S, SR Students develop skills in thinking and reading in the cognitive domain resulting in increased comprehension and expanded problem-solving skills in reading. The students will develop skills in questioning, analyzing, synthesizing and applying information while learning to evaluate and communicate about assumptions, assertions, arguments, anddefinitionsfoundinwrittenmaterials. Social Science Social Science courses provide the perspective of more than one of the following disciplines: Anthropology, Chican@ Studies, Economics, Ethnic Studies, Geography, History, Political Science, Psychology, and Sociology. Course SOSCI 100: Introduction to Social Science 4 Cr Quarters: O The purpose of this course is to prepare students for inquiry into the social sciences. It will examine the language, logic, and methods of the social science distribution courses and will expose students to the types of questions posed by the various disciplines. It will emphasize practicing academic skills and learning the basic concepts and methodology necessary for successful study of these disciplines. Recommended: Eligibility for MATH 075, ENGL 095, and ENGL 081T Sociology Sociology is the systematic analysis of the social causes and consequences of human behavior. Sociologists study social interaction, social structure, and social change. Contemporary American society is the focus but comparative andhistoricalperspectivesareincluded.Thecollegeoffers basic courses that introduce the student to the fundamental principles, theories, and approaches of the discipline. Courses SOC& 101: Introduction to Sociology 5 Cr Quarters: F, W, S, SR This introductory course in sociology provides a survey of the discipline and a foundation for other sociology and related socialsciencecourses.Significantconceptsandtheoriesare introduced along with the basics of social research. Topics includeculture,socialstratification,deviance,socialchange, and social institutions such as the family and education. Although the main emphasis is on contemporary American society, comparative and historical perspectives are included. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 or successful completion of BA 075 Distribution for DTA: Social Sciences SOC 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor SOC& 201: Social Problems 5 Cr Quarters: W This course focuses on the sociological concepts and methods employed in the analysis of contemporary social problems such as poverty, crime, substance abuse, divorce, andracialandethnicconflict.Thecourseincludesthe analysis of global, national, and local problems and considers possible solutions. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 or successful completion of BA 075 Distribution for DTA: Social Sciences SOC 210: Sociology of Sex & Gender 5 Cr Quarters: W, S This course is a multicultural exploration of the roles of women and men in historical and contemporary societies. Issues relating to social institutions, social roles, mobility, sexuality, and family will be explored. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences SOC 230: Social Psychology 5 Cr Quarters: F Socialpsychologyisthescientificstudyofthewaysinwhich people’sthoughts,feelings,andbehaviorareinfluenced by the real or imagined presence of others. Topics include self-concept, self-serving biases, self-deception, aggression, lovingandliking,socialinfluence,conformity,obedience, attitude formation, and attitude change. This course is crossdisciplined. Credit cannot be given for both PSYCH 230 and SOC 230. Prerequisite: PSYC& 100 or SOC& 101 Distribution for DTA: Social Sciences Yakima Valley Community College, 2015-2016 171 172 SOC 250: Marriage & Family 5 Cr Quarters: S This course focuses on the family as a social institution. It involves analysis of intimate and family relationships across the lifespan and in traditional and alternative family forms. Emphasis is on the modern American family, but historical and cross-cultural comparisons are addressed. Topics include changing family patterns and roles, love, courtship, marital success and dissolution, child-rearing, and family stress. Prerequisite: Eligibility for ENGL& 101 and eligibility for MATH 085 Distribution for DTA: Social Sciences Student Development Courses SD 075: Navigating for Success in Higher Education 3 Cr Quarters: 0 Thiscourseisforfirst-yearYVCCstudentswhoare required to take developmental-level coursework in order to place into college classes. The focus is on developing the knowledge and skills needed to chart a pathway for continuing one’s education in face-to-face and eLearning environments with the support of one’s peers. Topics of study include college culture and related vocabulary, career and academic goal-setting, education planning, learning and interacting styles, and taking advantage of academic support services. SD 104: Career and Life Planning Variable Cr Quarters: 0 This course is designed to help students make an initial career/lifeplanbaseduponreflectionontheirskills, interests, and values as they pertain to the world of work, education, and leisure. The course will give students essential tools useful in making similar plans in the future. This course differsfromSD105:CareerPlanning,inthatthiscourse ismorecloselytailoredtoindividualstudentsbyoffering continual enrollment and requiring independent study. SD 104 allows students to choose how deeply they wish to cover this topic. Recommended: Placement in ENGL 095 is strongly advised SD 105: Career Planning 3 Cr Quarters: F, W, S, SR This course is designed to help students make an initial career/life plan based upon their skills, interests, and values as they pertain to the world of work, education, and leisure. The course gives students the essential tools useful in making similar decisions in the future. Recommended: Reading and writing at the English 095 level are strongly advised SD 111: Specific Learning Skills 2 Cr Quarters: SR This course is part of a link and will always be linked with a content course. The student development portion of the link focuses on the skills and abilities needed for success in the content course. Through classroom instruction, students demonstrate application of the following skills withinspecificcoursecontent:notetaking,testtaking, effectivestudygroupprocess,useofsupplemental instructional materials, analysis of assessment results, time management, and content-related assignment skills. May be repeated for credit. Prerequisite: Enrollment in the linked content-area course SD 112: Specific Learning Skills 2 Cr Quarters: F This course is part of a link and will always be linked with a content course. The student development portion of the link focuses on the skills and abilities needed for success in the content course. Through classroom instruction, students demonstrate application of the following skills withinspecificcoursecontent:notetaking,testtaking, effectivestudygroupprocess,useofsupplemental instructional materials, analysis of assessment results, time management, and content-related assignment skills. May be repeated for credit. Prerequisite: Enrollment in the linked content-area course Yakima Valley Community College, 2015-2016 SD 113: Specific Learning Skills 2 Cr Quarters: W This course is part of a link and will always be linked with a content course. The student development portion of the link focuses on the skills and abilities needed for success in the content course. Through classroom instruction, students demonstrateapplicationofthefollowingskillswithinspecific coursecontent:notetaking,testtaking,effectivestudy group process, use of supplemental instructional materials, analysis of assessment results, time management, and content-related assignment skills. May be repeated for credit. Prerequisite: Enrollment in the linked content-area course TV/Video Production SD 114: Specific Learning Skills 2 Cr Quarters: S This course is part of a link and will always be linked with a content course. The student development portion of the link focuses on the skills and abilities needed for success in the content course. Through classroom instruction, students demonstrateapplicationofthefollowingskillswithinspecific coursecontent:notetaking,testtaking,effectivestudy group process, use of supplemental instructional materials, analysis of assessment results, time management, and content-related assignment skills. May be repeated for credit. Prerequisite: Enrollment in the linked content-area course Upon successful completion of this program, the student should be able to: • Begin training in the workforce as interns or entry level intheaudio/videoproductionfield. • Understand and operate various types of audio and video production equipment and software. • Communicateeffectively,applyinterpersonalskills, and professional awareness to multiple production scenarios. • Utilizewell-definedprofessionalskillstoperformbasic and advanced production procedures in a team or as an individual. • Understand the social and legal responsibility of multimedia in the community. SD 120: Learning Skills 2 Cr Quarters: F, W, S, SR Through leader presentations and group participation, studentsdevelopanunderstandingofbarrierstoefficient study and practice means by which to improve their academic performance. Covered are such issues as student management of learning, time management, how to take exams and class notes, improve listening and text reading, and set goals for achievement. Appropriate for all levels of ability. SD 140: Winning at College 5 Cr Quarters: SR A course for students entering college who want an overview of what college is all about, e.g., college admissions; programs; degree requirements; college transfer information;financialaid;scholarshipsearch;learning style, personality and career interest assessments; time management; listening skills; note taking; test taking; memory techniques; and career information. Prerequisite: Ability to read and write at high school level SD 190, 191: Co-op Field Experience I, II Variable Cr Prerequisite: Permission of instructor Quarters: O SD 198: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory studies in student development. TV/Video Production is a collaborative program with YV-TECH. Students will train in a real-world environment by working in a student-operated production company. The program is equipped with up-to-date equipment and facilities. Studentswhocompletethefirstyearwillreceivea certificatefromYV-TECH,andstudentswhocompletethe two-year program will receive an Associate of Applied Science degree in TV/Video Production from YVCC. For more information, contact YV-TECH at 509.573.5520. Program Outcomes Careers For more information on current employment trends, contact the Washington State Employment Security Department Job Service Center at 800.215.1617. Information is also available at the following websites: www.Access.wa.gov or www.WorkforceExplorer.com Courses TVID 101: Digital Media I 7 Cr Quarters: F This course introduces the student to working on projects suchasshortfilms,musicvideos,livein-studiomusic performances, digital video and audio editing, multi-track audio recording, animation visual graphics and much more. Students work in a real-world environment with up-to-date equipment and facilities and have the opportunity to produce content for the 90.3 FM HD-2 radio station. *This is a 12-week class each quarter rather than the traditional 10-weeks. Prerequisite: Permission of instructor, Fall quarter start TVID 102: Digital Media II 7 Cr Quarters: W This course builds on the skills and concepts learned in TVID 101.Studentsworkonprojectssuchasshortfilms,music videos, live in-studio music performances, digital video and audio editing, multi-track audio recording, animation, visual graphics and much more. Students work in a real-world environment with up-to-date equipment and facilities and have the opportunity to produce content for the 90.3 FM HD-2 radio station. *This is a 12-week class each quarter rather than the traditional 10-weeks. Prerequisite: TVID 101 with a grade of c or better or permission of instructor Yakima Valley Community College, 2015-2016 173 174 TVID 103: Digital Media III 7 Cr Quarters: S This course builds on the skills and concepts learned in TVID 101 and TVID 102. Student work on projects such as short films,musicvideos,livein-studiomusicperformances, digital video and audio editing, multi-track audio recording, animation, visual graphics, and much more. Students work in a real-world environment with up-to-date equipment and facilities and have the opportunity to produce content for the 90.3 FM HD-2 radio station. *This is a 12-week class each quarter rather than the traditional 10-weeks. Prerequisite: TVID 102 with a grade of c or better or permission of instructor Veterinary Technology The mission of the Veterinary Technology program is to attract, educate, and graduate highly competent individuals who are prepared to make a positive impact in their employment areas through excellent patient care, interpersonal communication, and economic skills. The Veterinary Technology program is a two-year course of study leading to an Associate of Applied Science degree in Veterinary Technology. Successful completion of the program should provide the graduate with the credentials and information for successful completion of the national and state board examinations leading to licensing as a Veterinary Technician. YVCC’sVeterinaryTechnologyprogramisstaffedby clinically-experienced, licensed veterinarians, and veterinary technicians. Facilities include small animal wards and the horsesarehousedatanoff-campusfacility.Otherprivatelyowned,off-site,large-animalfacilitieswillbeusedaswell. The program is fully accredited by the American Veterinary Medical Association (AVMA). Program Outcomes Upon successful completion of this program the student should be able to: • Possess the credentials and basic information for successful completion of the National and State Board examinations leading to licensure as a Veterinary Technician. • Bring desirable interpersonal skills and patient care abilities to the workplace. Careers Veterinary Technicians are an integral part of the animal health care team, assisting veterinarians and biological scientists in their work. Licensed Veterinary Technicians are employed in a variety of situations. These include private veterinary practices, universities, veterinary schools, wildlife rehabilitation centers,pharmaceuticalfirms,researchfacilities,zoos, animal feed companies, diagnostic laboratories, the government and military, and humane shelters. YVCC’s program provides training for students in the following areas: restraint and nursing of pets, horses, food animals, exotic and laboratory animals; clinical laboratory procedures; surgical assisting; dental, anesthesia, and radiology techniques; medication administration; and use of routine hospital equipment. Coursework will also cover various business aspects of veterinary practice such as client communications, medical record keeping, inventory control, computer technology, and veterinary ethics. Admission YVCC’s Veterinary Technology program starts a class of students each fall. Admission is based on completion of program prerequisites including high school and/or college coursework, letters of recommendation, plus veterinarian clinic observation or veterinary work experience. Applications should be received by May 1 to be considered for the following Fall quarter. Upon successful completion of the program, graduates will have been given the opportunity to gain the skills and knowledgeneededforemploymentwithintheexcitingfield of veterinary medicine. Prerequisites • High school diploma or GED. • One year of high school biology or BIOL 109 at YVCC (or its equivalent) with a grade of C (2.0) or better, takenwithinthelastfive(5)years. • One year of high school chemistry or CHEM 100 at YVCC (or its equivalent) with a grade of C (2.0) or Yakima Valley Community College, 2015-2016 • • • better,takenwithinthelastfive(5)years. Math COMPASS placement scores (within the last 12 months) indicating eligibility for Intermediate Algebra (YVCC’s Math 095) or equivalent coursework. English COMPASS placement scores (within the last 12 months) indicating eligibility for ENGL& 101 or equivalent coursework. Reading COMPASS placement scores (within the last 12 months) indicating eligibility for college-level reading or equivalent coursework. 3 or 5 4 1 2 3 2 2 27-29 Degrees Additional Requirements • Fifty (50) hours of clinical observation or work experience with a veterinarian within the last three years. This may be paid or volunteer and does not include time working on your own animals. • Three (3) completed reference forms. One must be from the veterinarian with whom experience was gained. Application Process Students should contact the Veterinary Technology department by phone using the number listed in the front of this catalog, by email (swedam@YVCC.edu or kdenome@ YVCC.edu), or by mail (Veterinary Technology Program, YVCC, PO Box 22520, Yakima, WA 98907-2520) to obtain a copy of the Veterinary Technology Application Packet. A copy may be downloaded from the YVCC website at www. YVCC.edu/VetTechaswell.Inadditiontomorespecific program information, this guide contains the application for admission to the Veterinary Technology program. A criminal history background check will be performed upon admission into the program. Students must be accepted for general admission to the college to be considered for the Veterinary Technology program. When notice has been received of acceptance into the college, it does not mean the student has been accepted into the Veterinary Technology program. A separate letter will be sent regarding acceptance or non-acceptance from the Veterinary Technology department. Transcripts • Requestanofficialtranscriptfromeachhighschool attended. Send the transcripts to the Veterinary Technology program. • Requesttwo(2)officialtranscriptsfromeachcollege attended. One copy should be sent to the YVCC AdmissionOfficeandtheothersenttotheVeterinary TechnologyOffice.Thereisarequestfortranscriptof credits form in the Veterinary Technology Application Packet which can be used for this purpose. The applicant is solely responsible for obtaining transcripts forYVCCfiles.Noacceptanceevaluationcanbemadeuntil these transcript have been supplied. Support Courses The curriculum for the Veterinary Technology program is listed below. Students are encouraged, but not required, to take any of the credits of support courses before entering the program. Otherwise, the courses will be included in the program of study. Any credits to be considered for the degree must have been completed with a grade of C- (1.7) orbetterwithinfive(5)yearsofentranceintotheprogram. Students with older coursework will have their transcripts evaluated on a case-by-case basis. Support Courses AGSCI 130 Introduction to Animal Science BA 138 Written Business Communication or ENGL& 101: English Composition I or PTECH 120: Technical Writing IT 100 Introduction to Computers or BT 101: Beginning Keyboarding CHEM 109 Principles of Chemistry Lecture CHEM 110 Principles of Chemistry Lab VET 101 Introduction to Veterinary Technology VET 110 Veterinary Medical Dosages VET 152 Safety & OSHA VET 154 Professional Development Total Credits Credits 5 5 Associate of Applied Science in Veterinary Technology First Year - Fall Credits AGSCI 130 Introduction to Animal Science 5 IT 100 Introduction to Computers 3 VET 101 Introduction to Veterinary Technology 2 VET 114 Animal A & P Lecture 3 VET 115 Animal A & P Lab 3 VET 118 Veterinary Medical Terminology 3 Total Credits 19 First Year - Winter CHEM 109 Principles of Chemistry Lecture 4 CHEM 110 Principles of Chemistry Lab 1 VET 103 Animal Care Lab I 1 VET 110 Veterinary Medical Dosages 3 VET 120 Clinical Practices I Lecture 2 VET 121 Clinical Practices I Lab 2 VET 152 Safety & OSHA 2 VET 164 Surgical Nursing I Lecture 1 VET 165 Surgical Nursing I Lab 1 VET 170 Small Animal Nutrition 2 Total Credits 19 First Year - Spring VET 104 Animal Care Lab II 1 VET 124 Livestock/Equine Medicine Lecture 2 VET 125 Livestock/Equine Medicine Lab 1 VET 130 Parasitology & Clinical Pathology Lecture 3 VET 131 Parasitology & Clinical Pathology Lab 2 VET 160 Clinical Practices II Lecture 2 VET 161 Clinical Practices II Lab 2 VET 172 Small Animal Therapeutic Nutrition 2 VET 222 Radiology Lecture 3 VET 223 Radiology Lab 1 Total Credits 19 Second Year - Fall BA 138 Written Business Communication or ENGL& 101: English Composition I or PTECH 120: Technical Writing 5 VET 105 Animal Care Lab III 1 VET 154 Professional Development 2 VET 204 Hematology Lecture 2 VET 205 Hematology Lab 2 VET 213 Sterile Techniques 1 VET 224 Lab Principles Lecture 1 VET 225 Lab Principles Lab 2 VET 236 Anesthesia Lecture 2 VET 237 Anesthesia Lab 1 Total Credits 19 Second Year - Winter VET 201 Public Health 3 VET208 VeterinaryOfficeProcedures 3 VET 230 Animal Disease & Microbiology Lecture 4 VET 231 Animal Disease & Microbiology Lab 3 VET 234 Pharmacology 3 VET 238 Critical Care Lecture 1 VET 239 Surgery Lab 2 Total Credits 19 Second Year - Spring VET 240 Veterinary Clinical Experience 10 VET 244 Special Topics Seminar 2 Total Credits 12 Total Program Credits 107 Yakima Valley Community College, 2015-2016 175 176 Courses VET 076: Community Service 0 Cr Quarters: F, W, S, SR Thisclassisofferedasaself-support,communityservice, noncredit course. VET 101: Introduction to Veterinary Technology 2 Cr Quarters: F This course reviews the role of veterinary technicians in animal health, medical ethics, tasks that can be legally performed, and career opportunities. VET 103: Animal Care Lab I 1 Cr Quarters: W Students will develop skills in animal care including animal restraint, feeding, physical examination, and cleanliness of the kennel facility. Students will apply guidelines and requirementsspecifiedbyveterinariansandregulatory agencies. Prerequisite: VET 114, VET 115, and VET 118 or permission of instructor and concurrent enrollment in VET 120 and VET 121 VET 104: Animal Care Lab II 1 Cr Quarters: S Students will develop skills in animal care including animal restraint, feeding, physical examination, and cleanliness of the kennel facility. Students will apply guidelines and requirementsspecifiedbyveterinariansandregulatory agencies. This course is a continuation of VET 103. Prerequisite: VET 103, VET 120, VET 121, VET 170, and concurrent enrollment in VET 124 and VET 125 VET 105: Animal Care Lab III 1 Cr Quarters: F Students will develop skills in animal care including animal restraint, feeding, physical examination, and cleanliness of the kennel facility. Students will apply guidelines and requirementsspecifiedbyveterinariansandregulatory agencies. This course is a continuation of VET 104. Prerequisite: VET 104, VET 160, and VET 161 VET 110: Veterinary Medical Dosages 3 Cr Quarters: W Application of practical math needed to learn dosage and calculation of medicines used in veterinary medicine. Students will be exposed to prescription abbreviations, routes of drug administration, the metric system, drug labels, types of drug preparations, and the equipment used to measure doses. Prerequisite: MATH 084 or MATH 085 or YVCC placement into MATH 091 or MATH 095 or permission of instructor VET 114: Animal Anatomy & Physiology Lecture 3 Cr Quarters: F This course is a systems approach to animal anatomy and physiology, with emphasis on practical function and application. Comparative anatomy and physiology of common species will be presented. This course is concurrent with VET 115. Prerequisite: Entrance into the Veterinary Technology program or permission of instructor and program coordinator VET 115: Animal Anatomy & Physiology Lab 3 Cr Quarters: F This laboratory course is a systems approach to animal anatomy and physiology with emphasis on practical function and application. Comparative anatomy and physiology of several domestic species will be presented. This course is concurrent with VET 114. Prerequisite: Entrance into the Veterinary Technology program or permission of instructor and program coordinator Yakima Valley Community College, 2015-2016 VET 118: Veterinary Medical Terminology 3 Cr Quarters: F This course will provide a systems approach to understanding the basic foundation of the language of veterinary medicine. Students will learn to recognize, understand, and use common components of terms, allowing dissection of words for comprehension and structuring of words for use. This course is best taken in conjunction with VET 114 and VET 115 to allow practical application of the terminology learned. Prerequisite: Entrance into the Veterinary Technology program or permission of instructor and program coordinator VET 120: Clinical Practices I Lecture 2 Cr Quarters: W This course will help students develop practical veterinary technician skills. Students will learn basic animal behavior and restraint, physical examination techniques, basic and therapeuticgrooming,andveterinaryofficeprotocoland examination room procedures, including medical records. This course is concurrent with VET 121. Prerequisite: VET 114, VET 115, and VET 118 or permission of instructor VET 121: Clinical Practices I Lab 2 Cr Quarters: W This course will help students develop practical veterinary technician skills. Students will apply the principles of basic animal behavior and restraint, physical examination, basic and therapeutic grooming, and bandage and splint applications. This class is concurrent with VET 120. Prerequisite: VET 114, VET 115, and VET 118 or permission of instructor VET 124: Livestock and Equine Medicine Lecture 2 Cr Quarters: S This course will cover practical aspects of livestock and equine nursing skills plus use of humane and safe restraint techniques.Specificskillswillincludemedicatingorallyand parenterally, performing venipuncture, bandaging, and prepping for various procedures and surgeries. Class is concurrent with VET 104 and 125. Prerequisite: VET 114, VET 115, VET 120, and VET 121 or permission of instructor VET 125: Livestock and Equine Medicine Lab 1 Cr Quarters: S This course will cover practical aspects of livestock and equine nursing skills plus use of humane and safe restraint techniques.Specificskillswillbedevelopedfororaland parenteral medication administration, venipuncture, bandaging, and prepping for various procedures and surgeries. Class is concurrent with VET 104 and 124. Prerequisite: VET 114, VET 115, VET 120, and VET 121 or permission of instructor VET 130: Parasitology & Clinical Pathology Lecture 3 Cr Quarters: S Students will gain an understanding of animal parasites and be introduced to urinalysis in this class. Concurrent enrollment in VET 131 is required. Prerequisite: VET 114, VET 115, VET 120, VET 121, and VET 152 or permission of instructor VET 131: Parasitology & Clinical Pathology Lab 2 Cr Quarters: S Students will identify gross and microscopic stages of common animal parasites using standard laboratory tests. Students will also be introduced to the steps of urinalysis. Concurrent enrollment in VET 130 is required. Prerequisite: VET 114, VET 115, VET 120, VET 121, and VET 152 or permission of instructor VET 142: Veterinary Module for Medical Terminology 1 Cr Quarters: W, S, SR This course will provide independent study over veterinaryspecificmedicalterminology.Whencoupledwithsuccessful completion of AH 119 (a human-oriented course), this course will substitute for VET 118 for the Veterinary Technology program. Prerequisite: Admission to the Veterinary Technology program or permission of instructor and program coordinator VET 170: Small Animal Nutrition 2 Cr Quarters: W This is an introductory course for students accepted in the VeterinaryTechnologyprogramprovidingidentificationand function of nutrients, understanding pet food labels, and applications for wellness and lifestage for dogs and cats. The course is conducted via an asynchronous, web-based format. Prerequisite: Acceptance into the Veterinary Technology program, VET 114 and VET 155, or permission of instructor VET 152: Safety & OSHA 2 Cr Quarters: W Thecomponentsofaneffectivesafetymanagement program will be explored in accordance with state and federal employee safety regulations relating to veterinary medicine. Prerequisite: VET 101 or permission of instructor VET 172: Small Animal Therapeutic Nutrition 2 Cr Quarters: S This course is a continuation of the introductory course VET 170, for students accepted into the Veterinary Technology program. The course will provide applications of nutrition in disease management in dogs and cats. The course is conducted via an asynchronous, web-based format. Prerequisite: VET 170 VET 154: Professional Development 2 Cr Quarters: F This course will explore practical application of professional development,personnelandfinancialmanagement,and client interactions skills. History taking, communications, establishing rapport, and utilization of public relations skills will be included. Prerequisite: VET 101 or permission of instructor VET 160: Clinical Practices II Lecture 2 Cr Quarters: S This course explores veterinary technician nursing skills such as injections, IV catheter placement, blood collection, advanced enteral techniques, urinary catheter placement, cystocentesis.Italsoprovidesinformationonfluidtherapy, care of recumbent and geriatric patients, physical therapy, and neonatal care. Prerequisite: VET 110, VET 114, VET 115, VET 120, and VET 121 or permission of instructor and concurrent enrollment in VET 161 VET 161: Clinical Practices II Lab 2 Cr Quarters: S This course will allow students to practice veterinary technician small-animal nursing skills such as injections, IV catheter placement, blood collection, advanced enteral techniques, and cystocentesis. Prerequisite: VET 114, VET 115, VET 120, VET 121, and VET 152 all with a grade of C or better or permission of instructor and concurrent enrollment in VET 160 VET 164: Surgical Nursing Lecture 1 Cr Quarters: W Development of veterinary surgical assistant skills will be covered including surgical preparations and assisting, aseptic technique, care and use of surgical instrumentation and equipment, plus maintenance of the surgical suite. Prerequisite: VET 114, VET 115, and VET 118 or permission of instructor and concurrent enrollment in VET 165 VET 165: Surgical Nursing Lab 1 Cr Quarters: W Practical development of veterinary surgical assistant skills will be covered including surgical preparations and the role as the non-sterile assistant, aseptic technique, care and use of surgical instrumentation and equipment, plus maintenance of the surgical suite. Prerequisite: VET 114, VET 115, and VET 118 or permission of instructor and concurrent enrollment in VET 164 VET 190, 191, 192, 193: Co-op Field Experience I Variable Cr Quarters: F, W, S, SR Prerequisite: Permission of instructor VET 198, 298: Experimental/Exploratory Studies Variable Cr Quarters: O Experimental/exploratory study in veterinary technology VET 199, 299: Independent Study/Field Experience Variable Cr Quarters: O Prerequisite: Permission of instructor VET 201: Public Health 3 Cr Quarters: W This course will cover principles and procedures that must be followed by veterinary technicians to promote and maintain public health and sanitation and to prevent the spread of disease. The role of the technician in prevention and recognition of zoonotic diseases and occupational health hazards, with an emphasis on client education, will be covered. Class is concurrent with VET 230/231. Prerequisite: VET 101, VET 130, and VET 131 or permission of instructor VET 204: Veterinary Hematology Lecture 2 Cr Quarters: F This class will familiarize students with the basic terms and principles of veterinary hematology. Students will learn typesofbloodcellsandspeciesdifferencespertainingtothe blood. The essentials of blood transfusion will be reviewed, and students will learn about blood parasites. Class must be taken concurrently with VET 205, VET 224, and VET 225. Prerequisite: VET 130, VET 131, VET 160, and VET 161 VET 205: Veterinary Hematology Lab 2 Cr Quarters: F This class will familiarize students with common procedures in veterinary hematology. Students will identify blood cell types from various species, learn techniques for measuring important blood values, and identify blood parasites. Coagulation and pre-transfusion tests will be performed. Class must be taken concurrently with VET 204, VET 224, and VET 225. Prerequisite: VET 130, VET 131, VET 160, and VET 161 VET 208: Veterinary Office Procedures 3 Cr Quarters: W Students will learn procedures for scheduling, inventory, telephoneetiquette,interofficeandclientrelations,financial records, and electronic communications in the veterinary office.Useofveterinaryspecificsoftwarewillbecovered. Prerequisite: IT 100 or equivalent or permission of instructor Yakima Valley Community College, 2015-2016 177 178 VET 213: Sterile Techniques Lab 1 Cr Quarters: F This Laboratory course will provide practical development of veterinary technician skills as a sterile surgical assistant. This course will build upon skills acquired in VET 164 and VET 165 Surgical Nursing. Students will learn surgical assisting, patient preparations, aseptic techniques, plus care and use of patient monitors. Prerequisite: VET 164 and VET 165 or permission of instructor VET 222: Radiology Lecture 3 Cr Quarters: S This course provides theoretical application of veterinary radiographic imaging to include image production, radiation protection,filmprocessing,radiographicanalysis,quality assurance, and contrast media studies. This class is concurrent with VET 223. Prerequisite: VET 120 and VET 121 or permission of instructor and program coordinator and concurrent enrollment in VET 223 VET 223: Radiology Lab 1 Cr Quarters: S This course provides laboratory experience in radiographing animalsusingradiationsafetymeasures,processingfilm, analyzing radiographs, participating in contrast media studies, and performing quality control tests. This class is concurrent with VET 222. Prerequisite: VET 120 and VET 121 or permission of instructor and program coordinator and concurrent enrollment in VET 222 VET 224: Lab Principles Lecture 1 Cr Quarters: F Students will gain an understanding of a variety of laboratory tests commonly used in veterinary practice. Principles of cytologicidentificationwillbediscussed.Classmustbetaken concurrently with VET 225, VET 204, and VET 205. Prerequisite: VET 130, VET 131, VET 160, and VET 161 or permission of instructor VET 225: Lab Principles Lab 2 Cr Quarters: F Students will perform a variety of laboratory tests commonly used in veterinary clinics and will relate the results to patient cases. Cytology skills will be developed. Class must be taken concurrently with VET 224, VET 204, and VET 205. Prerequisite: VET 130, VET 131, VET 160, and VET 161 or permission of the instructor VET 230: Animal Diseases & Microbiology Lecture 4 Cr Quarters: W This course is an overview of animal diseases and microbiology, incorporating concepts of pathology. Common diseases of multiple animal species will be examined including those involved in dentistry. Class is concurrent with VET 231, and VET 239. Prerequisite: VET 130, VET 131, VET 210, VET 211, VET 224, VET 225, and VET 234 or permission of instructor VET 231: Animal Diseases & Microbiology Lab 3 Cr Quarters: W Students will learn and perform microbiological procedures and dental prophylaxis. The course is the lab to accompany VET 230 and must be taken concurrently with VET 220, VET 221, and VET 230. Prerequisite: VET 130, VET 131, VET 210, VET 211, VET 224, VET 225, and VET 234 or permission of instructor Yakima Valley Community College, 2015-2016 VET 234: Pharmacology for Veterinary Technicians 3 Cr Quarters: W Summary of general types and groups of drugs as well as the proper preparation of medication and vaccines. Students willbeabletoexplaindrugmedicationsandtodifferentiate between normal and abnormal responses of animals to medications. Students will calculate dosages for common medications of large and small animals. Prerequisite: CHEM 109, CHEM 110, VET 110, VET 114, VET 115, VET 130, and VET 131 or permission of instructor VET 236: Anesthesia Lecture 2 Cr Quarters: F Students will receive training in the use and monitoring of general and local anesthesia. Pain management techniques, anesthetic agents, and variations between animal species will be included. Prerequisite: VET 160, VET 161, VET 164, and VET 165 or permission of instructor and concurrent enrollment in VET 237 VET 237: Anesthesia Lab 1 Cr Quarters: F Students will receive training in the use and monitoring of general anesthesia. Utilization and maintenance of inhalent anesthesia equipment and various patient monitoring devices will be covered. Prerequisite: VET 160, VET 161, VET 164, and VET 165 or permission of instructor and concurrent enrollment in VET 236 VET 238: Critical Care Lecture 1 Cr Quarters: W This course will cover the essentials of veterinary emergency and critical care including monitoring and treatment of the critical veterinary patient, emergency procedures, triage, and CPR. Prerequisite: VET 204, VET 205, VET 213, VET 224, VET 225, VET 236, and VET 237 or permission of instructor VET 239: Surgery Lab 2 Cr Quarters: W Students will learn and perform anesthesia and monitoring of such during surgery and other medical procedures. Anesthesia and monitoring equipment use and maintenance will be included. Prerequisite: VET 204, VET 205, VET 213, VET 224, VET 225, VET 236, and VET 237 or permission of instructor VET 240: Veterinary Clinical Experience 10 Cr Quarters: S Work experience under the supervision of a veterinarian and/or licensed veterinary technician. Emphasis is on the practical application of skills acquired during the program and performed by veterinary technicians. The course is intended to provide a broad exposure to veterinary medicine,surgery,andofficeprocedures. Prerequisite: Successful completion of all courses required by the Veterinary Technology program except VET 244 and an accumulative GPA of 2.0 (C) or better or permission of the instructor and the program coordinator VET 244: Special Topics Seminar 2 Cr Quarters: S This course is a review of current literature and important discipline-specificandpublicissuesrelatedtothepractice of veterinary medicine. The sessions will be instructor led involving lecture, review, and interactive discussions interspersed with formal student presentations. Prerequisite: Successful completion of all courses required by the Veterinary Technology program and an accumulative GPA of 2.0 (C) or better or permission of the instructor and the program coordinator VET 290-293: Adv. Co-op Field Experience I, II, III, IV Variable Cr Quarters: F, W, S, SR Cooperative education integrates the students’ classroom study with work experience in cooperating employer organizations. Students usually alternate college study withemploymentperiodsinappropriatefieldsrelatedto veterinary medicine or supporting industry. The students’ education, therefore, is shared between the employer, supervisors, and YVCC faculty. 179 Yakima Valley Community College, 2015-2016 180 YVCC FOUNDATION SCHOLARSHIP & AWARDS TERRY ABEYTA Awarded to a Native American student who is enrolled full-time (12 credits) at YVCC. ADMINISTRATION SCHOLARSHIP Awarded by the Yakima Valley Community College administrators. DOROTHY L. AIKEN Awardedtoafirst-yearstudent enrolled full-time (12 credits) at Grandview Campus who may transfer to the Yakima Campus in her second year, who is pursuing an AA degree, and who demonstrated academic achievementandfinancialneed. ALLARD SISTERS Awarded to a full-time (12 credits) student who is seeking an AA degree in arts and sciences, technical areas, or general studies and who shows academic achievement. JAMES C. ALLARD Awarded to a full-time (12 credits) student who is seeking an AA degree in arts and sciences, technical areas, or general studies and who shows academic achievement. RUTH & CLAYTON ALLARD Awarded to a full-time (12 credits) student who is seeking an AA degree in arts and sciences, technical areas, or general studies and who shows academic achievement. ROBERT J. & HOPE ALLAN Awarded annually to a student enrolled full-time (12 credits) at YVCC during eithertheirfirstorsecondyear.The student must be seeking an AA degree. Thestudentshalldemonstratefinancial need and be a graduate of Naches High School . ALTRUSA CLUB - ROBERTSON Awarded to a female student enrolled full-time (12 credits) at YVCC who is copingwithdifficultsituationsinsucha waythatsheshowspromiseoffulfilling her educational goals. The student should show potential for success in school or training, show an ability for growth, possess ambition and initiative, anddemonstratefinancialneedas well as potential for success. The scholarship is awarded by the Altrusa Club. ALUMNI ASSOCIATION Awarded to a full-time (12 credits) student enrolled at YVCC and working toward an AA in arts and sciences, technical areas, or general studies. The student must demonstrate achievement, either academic, professional, or through lifeexperience,andfinancialneed. Preference given to family members of YVCC alumni. PAUL M. & GENEVIEVE ANDERSON MEMORIAL For outstanding YVCC students transferring to a four-year university and majoring in political science or history.Ifnoonequalifies,itmay be awarded by Paul and Genevieve Anderson in memory of Paul’s parents. S. I. ANTHON Granted to a full-time (12 credits) student attending YVCC after completingthefirstyear.Award based on his academic work and demonstrated responsibility in all aspects of her life. The student must have demonstrated leadership, friendliness,andinfluenceforgood among his fellow students. J. S. APPLEGATE For students who demonstrate that they have the ability to maintain average or better grades and have a strong desire to become a school teacher. For students that plan to attend a four-year college or university majoring in education after completing two years at YVCC. ASSOCIATED STUDENTS OF YVCC DISABLED STUDENT SCHOLARSHIP FUND Awarded to disabled students who haveafinancialneed.Availableforfirst or second year, full-time (12 credits) students who are seeking a degree in any major. The scholarship shall be awarded for one year based on maintaining satisfactory academic standing each quarter. BERNAL C. BACA Awarded to a full-time (12 credits) Hispanic student at YVCC who is seeking an AA degree, working toward a degree in counseling or political science. The student must have a GPA of 2.5 or higher. Financial need is considered. ELIZABETH BANNISTER TRUST Grantedtoafirst-yearstudentenrolled full-time (12 credits). Selection is made by the YVCC Foundation. Yakima Valley Community College, 2015-2016 MARCY BARNES MEMORIAL A scholarship awarded to students enrolled in the Radiologic Science Program who have demonstrated academic and clinical achievement as well as leadership skills. The recipient will be selected with input from a committee of the radiologic science program. CATHERINE MAY BEDELL A scholarship awarded to a returning woman or displaced homemaker who is enrolled full-time (12 credits), working toward an associate of arts and science degree, and is able to demonstratefinancialneed. HAROLD & MARJORY BERGEN MEMORIAL Awarded to a full-time (12 credits) student who is seeking a degree in nursing. Academic achievement (3.0 GPA) is a consideration. WINFIELD BOYD Granted to a full-time (12 credits) student attending YVCC and majoring in accounting. ROY BROWN Awarded by the Athletic Department to a returning full-time (12 credits) student at YVCC who has shown talent in baseball or basketball. Financial need and academic ability also considered. RUTH BROWN Available to a returning full-time (12 credits) student at YVCC who has shown a talent in the arts, including painting, music, or some phase of family and consumer sciences. Financial need and academic ability is also a consideration. RUTH BUOY Awarded to an older, returning, female student enrolled full-time (12 credits) at YVCC. The student must be seeking an AA in arts and science, technical areas, or general studies and must demonstrate academic achievement andfinancialneed. NORMAN & NELLIE BYRD Awarded to a full-time (12 credits) student attending YVCC and determined on the basis of academic achievement. The student must be seeking an AA in agriculture. The selection is made by the Agriculture Department. YVCC FOUNDATION SCHOLARSHIP & AWARDS ELIZABETH C. CAMPBELL MEMORIAL Awarded to a full-time (12 credits) student attending YVCC seeking a business degree with special interest in sales and marketing. Financial need and academic achievement are also considered. DR. KELLY CASEY MEMORIAL Awarded to a full-time (12 credits) student attending YVCC seeking a Chemistry degree. CLASSIFIED EMPLOYEE-KOCH AWARD Awardedtotheclassifiedemployeeof the year. COMBINED FUND Awardedtoafirstorsecondyear student in general studies. DONALD CONNOR MEMORIAL DALTON FAMILY SCHOLARSHIP Awarded to a student enrolled full-time (12 credits) at YVCC. The student must be a high school graduate, from Wapato or Toppenish High School, and seeking an AA degree. First generation college student. G. THOMAS DOHN Granted to a full-time (12 credits) student attending YVCC. The student must be working toward an AA in arts and sciences, technical areas, or general studies and demonstrate academic achievement with a 3.0 GPA from high school. JOHN E. DOWNING Awarded to a returning student, enrolled full-time (12 credits) at YVCC who has completed one year of the Radiologic Sciences Program at YVCC. The student must have demonstrated academic and clinical achievement as well as leadership skills while attending the program. MER EDMONDSON Awarded by the YVCC Athletic Department to men or women enrolled full-time (12 credits) in basketball and tennis. ELLIOTT FAMILY SCHOLARSHIP Awarded to a student enrolled full-time (12 credits) at YVCC who is seeking an AA degree in math or science and who has achieved a 3.0 GPA. Student must demonstratefinancialneed. MARY ESTEP Awarded to a student enrolled full-time (12 credits) at YVCC and studying music, piano, or voice. KINGSLEY & JEANNE FAIRCHILD Awardedtoafirstorsecondyear student enrolled full-time (12 credits) at YVCC and seeking an AA degree. ERNEST & GENEVIEVE FALK Awardedtoafirstorsecondyear student enrolled full-time (12 credits) at YVCC and who demonstrates academic achievement. ADA ANDERSON GALLUCCI Granted to a returning student enrolled full-time (12 credits) at YVCC who is from the Yakima Valley and demonstrates good academic qualities and character. COL. ALFRED (RET) AND GENEVIEVE GALLUCCI Awarded to students enrolled full-time (12 credits) at YVCC and majoring in a program which will prepare her to enter a technical career after graduating from YVCC. ANTONIO & CATHERINE GALLUCCI Granted to a needy East Valley High School graduate to attend YVCC fulltime (12 credits). Selection made by East Valley High School. MARY GALLUCCI Granted to a student from the Yakima Valley who will be enrolled full-time (12 credits) and who demonstrates good academic abilities and character. FRANK GAYMAN MEMORIAL Awarded to a student enrolled full-time (12 credits) at YVCC and majoring in journalism. The scholarship is determined by the Yakima HeraldRepublic and the YVCC Foundation. GILBERT ORCHARDS Awardedtoafirst-orsecond-year student enrolled full-time (12 credits) at YVCC and studying geology or agriculture. The student must have a cumulative GPA of 2.5 or higher from high school or while attending YVCC. DELORES GOODMAN Awarded to a high school senior of African American descent graduating from a Yakima Valley high school who will be attending YVCC full-time (12 credits). The students should be preparing to go on to a four-year institution or majoring in a program which will prepare the student to enter a technical career after graduating from YVCC. LOUISE GRIFFITH, BUSINESS Awardedtoafemalefirst-yearstudent enrolled full-time (12 credits) and seeking an associate degree in business while demonstrating academic achievementandfinancialneed. FRANK & MELBA HAGEL FAMILY Full-time (12 credits) student at YVCC seeking AA degree in a technical area or general studies. Must demonstrate academic achievement. WILBERT HANSEN FUND Awardedtoafirst-orsecond-year student enrolled full-time (12 credits) at YVCC and interested in a career in agriculture, with preference for those interested in the tree fruit business. Selection is based on academic achievement, recommendation from former teachers, and involvement in activities. JULIE HARRIS Awarded to students in the Dental Hygiene Program. Must show academic achievement. YOSHIO HATA MEMORIAL SCHOLARSHIP Awarded to a full-time (12 credits) student at YVCC. Recipient is determined by the YVCC Foundation directors. CHET & MARY HATFIELD Granted to a student enrolled full-time (12 credits) at YVCC who demonstrates academic achievement with a GPA of at least3.0andalsoshowsfinancialneed. ELLIE HEFFERNAN Awarded to a full-time (12 credits) student who has completed one to two years at YVCC and is seeking an AA degree in arts and sciences, technical areas, or general studies. She has made a positive contribution to the lives of students at YVCC through extracurricular activities. Recipients are selected with consultation from the Student Life Coordinator. HERMAN & JULIA HOPF Awarded to a student enrolled full-time (12 credits) at YVCC or transferring to a four-year college after having attended for two years and graduated from YVCC. Academic achievement and desire to complete work for a bachelor’s degree are basic criteria. JOHN W. GRIFFITH, AGRICULTURAL Granted to a second-year student enrolled full-time (12 credits) at YVCC and studying agriculture. Yakima Valley Community College, 2015-2016 181 182 YVCC FOUNDATION SCHOLARSHIP & AWARDS JANE HUNTZICKER Awarded to students enrolled full-time (12 credits) at YVCC with a GPA of 3.0 or higher at the college and intending to major in family and consumer sciences education, early childhood education, or teaching of family and consumer sciences. This scholarship is transferable to a four-year university. INLAND FRUIT Granted to a second-year student enrolled full-time (12 credits) at YVCC majoring in agriculture, and transferring to Washington State University. DON & HELEN JEWETT HELEN JEWETT WALT & HELEN JEWETT-SHIELDS Awarded to a full-time (12 credits) student enrolled at YVCC. The student must be pursuing an AA degree and demonstrate academic achievement from high school or college with a 3.0 or higher GPA. The student must also demonstratefinancialneed. LYLE JOHNSON - APPLE VALLEY KIWANIS Awarded to a full-time (12 credits) student seeking a degree in agriculture who demonstrates academic achievement with a GPA of 3.0 or higher. Financial need considered. JERRY & LINDA KAMINSKI Awarded to a music student. PEGGY KELLER MEMORIAL Awarded to a full-time (12 credits) student seeking a degree at YVCC. Student must demonstrate academic achievement with a GPA of 3.0 or higher. DON KEITH MEMORIAL Awarded by the YVCC Athletic Department. Primary attention to excellence in athletics. CATHERINE PRIOR KING Awarded to a full-time (12 credits) student who is enrolled at YVCC. The scholarship is based on academic achievementandfinancialneed. KOCH MEMORIAL Awarded to a student in the Business Technology Program. ROBERT M. LEADON AWARD Awarded to a YVCC faculty member based on nomination by peers, students, and community. HAZEL M. LELAND Awarded to a female returning student enrolled full-time (12 credits) at YVCC. The student must demonstrate academic achievement with a GPA of 3.0 or higher and intend to major in physical education, health education, or biological science. Courses taken must be transferable to a four-year institution in the state of Washington. Financial need not a criterion. JEROME LEWIS Awarded to full-time (12 credits) students. Academic achievement and financialneedconsidered. MEL LEWIS Awarded to a full-time (12 credits) student enrolled at YVCC who is pursuing an AA degree and who has demonstrated academic achievement. Financial need is not a criterion. DONNA (BROOKE) LINSE SCHOLARSHIP Granted to a full-time (12 credits) student enrolled at YVCC who is seeking an AA in arts and sciences, technical areas, or general studies. She must demonstrate academic achievementandfinancialneed.The scholarship shall not be awarded to an acquaintance of the donor or to a member of the donor’s extended family. EVERETT LOGAN JR MEMORIAL Awarded to a full-time (12 credits) student. The student must demonstrate academic achievement. KATHRYN MANN MEMORIAL Awarded to a nursing student. The student must demonstrate academic achievement. MILTON L. MARTIN MEMORIAL Awardedannuallytoafirst-year student enrolled full-time (12 credits) at YVCC. The student must be a graduate of either Eisenhower or Davis high schools who has demonstrated outstanding scholastic abilities, participated in school activities, and shown evidence of leadership capabilities. Student must have a desire to attend a four-year college. Financial need not a criterion. RICHARD MARVIN MEMORIAL Awarded to a returning second-year student enrolled full-time (12 credits) at YVCC. Academic excellence in college courses is required. The scholarship is for majors in biology, botany, zoology, nursing, or dental hygiene. Yakima Valley Community College, 2015-2016 MICHAEL S. MATTHEWS MEMORIAL Awarded to a full-time (12 credits) student enrolled at YVCC. The student must show academic achievement with a GPA of 2.8 or higher from high school or college. MILDRED MCBRIDE Awarded to a second-year student pursuing an AA degree in technical or general studies. The student must demonstrate academic achievement. GEORGE MCCULLOCH MEMORIAL Awarded to a second-year dental hygiene student. The student must demonstrate academic achievement. ELPHA MCDONALD Awarded to a full-time (12 credits) student enrolled at YVCC. The student must show academic achievement. EUGENE MCPHERSON Awarded to a student athlete. GEORGE MESHKE Awarded to a student enrolled in drama. Ray E. Munson/SUNDOWN M RANCH Awarded to a full-time (12 Credit) student seeking an AA degree orcertificationintheChemical Dependency Program. Students must be alumni of Sundown M Ranch, having successfully completed one of its treatment programs. The student must demonstrate academic achievement. JAMES G. NEWBILL Awarded to a full-time (12 credits) student at YVCC with a high school GPA of 3.0 or a college GPA of at least 2.5. The student must have completed two quarters with one or more 100-level or above courses. JAMES & ESTHER NOLAN, JR Awarded to full-time student (12 credits). A female returning to school after being home or seeking further training to advance career. Seeking a degree in arts & sciences, technical areas or general studies. NORTH YAKIMA CONSERVATION DISTRICT Awarded to a second-year student enrolled full-time (12 credits) at YVCC whose course of study is natural resources and who has a GPA of 3.0 or higherduringtheirfirstyearatYVCC. BOYD OLOFSON COMPANY Awarded to a full-time (12 credits) student enrolled at YVCC. The student must be majoring in business with an emphasis on accounting. YVCC FOUNDATION SCHOLARSHIP & AWARDS DARYL & SHERRIE PARKER ATHLETICS BEVERLY PARNELL MEMORIAL SCHOLARSHIP Awarded to a YVCC student who has completed 30 credits and may continue at YVCC or transfer to a four-year university. The student must be seeking a degree with a math or math education emphasis and must demonstrate academic achievement (3.0 or higher GPA). DELMAR PEARSON Awarded to a full-time (12 credits) student enrolled at YVCC. The student must be seeking an AA in agriculture orbusiness-relatedfields.Thestudent must have demonstrated academic achievement with a cumulative GPA of 3.0 or higher from high school or college. Financial need not a criterion. ERWINA B. PETERSON Granted to a student enrolled at YVCC who is a family and consumer sciences major with a GPA of 2.5 or higher of a relatedfieldsuchaseducation,health, sciences etc. ANNA & ELIZABETH PETTIGREW Awardedtofirstandsecondyear students enrolled full-time (12 credits) atYVCCandbasedonfinancialneed, scholarship, and leadership potential. TOM PIER MEMORIAL Awarded to a full-time (12 credits) student enrolled at YVCC pursuing an AA degree in arts and sciences, medical, dental, or general studies. The student must also show academic achievement. FRED & DOROTHY PLATH Awarded to a full-time (12 credits) student enrolled at YVCC. Recipient is determined by the YVCC Foundation director. CLEMENTINE J. PRIOR Granted to a student at the end of their second year at YVCC to assist the student in attending a four-year institution. This is a science scholarship to be given to a student majoring in chemistry or bacteriology. The award is based on academic excellence. ELIZABETH PRIOR MEMORIAL Awarded to a woman over 26 years of age who graduated from high school, is entirely or largely self-supporting, is preparing to go on to a four-year college, and is majoring in a program which will prepare her to enter a technical career after graduating from YVCC. The scholarship is awarded in memory of Elizabeth Prior by Dorothy Prior.ElizabethPriorwasthefirst president of Yakima Valley Community College. MARTHA & ARCHIE PRIOR Awarded to a YVCC student who is transferring to a four-year institution. CHARLES RABUNG MEMORIAL A tuition grant awarded to an incomingfirst-yearstudentenrolled full-time (12 credits) at YVCC and who is participating in basketball and/or baseball. The scholarship is renewable for the second year at YVCC. The student must demonstrate academic achievement and reasonable financialneedandshowqualitiesof sportsmanship, citizenship, and good character. The selection is made by the YVCC Athletic Department. GLENN & CHERRY RASMUSSEN Awarded to a full-time (12 credits) student enrolled at YVCC who is seeking an AA degree and who has demonstrated academic achievement with a GPA of 3.0 or higher from high school and college. The student should beafirstorsecondyearstudentwho has participated in varsity basketball in high school and is planning on trying to make or return to the varsity basketball team at YVCC. Financial need is not a criterion. FRED REDMON Awarded to a male student enrolled full-time (12 credits) at YVCC who is seeking an AA degree and who has demonstrated academic achievement by maintaining a GPA of 2.0 or greater. The student should also demonstrate qualities of leadership, friendliness, andinfluenceforthecommongood among fellow students. The student should also be participating in varsity athletics. The selection is made by the Athletic Department. JOHN REDMOND FAMILY Awarded to a full-time (12 credits) student enrolled at YVCC who is working toward an academic degree with a strong interest in poetry or literature. The student shall demonstrate scholarship, good citizenship, responsibility in academic work, and a positive attitude toward succeeding in their academic career. Financial need is not a criterion. ALBERT RING MEMORIAL Grantedattheendofthefirstyearto a YVCC student enrolled full-time (12 credits) who is returning for his second year. The student should be an English major and have an excellent academic record. The scholarship award is made to a physically handicapped student having academic promise and demonstratingfinancialneed. MRS W. W. (GRACE) ROBERTSON Awarded to a returning student enrolled full-time (12 credits) at YVCC who is seeking an AA degree and who has demonstrated responsibility in their academic work with a GPA of 3.0 or higher. The student can be either a man or woman and shall have outstanding English records in the first-yearclass.Thestudentmustbe returning to YVCC. Financial need is not a criterion. CHARLES ROOS Awarded annually to students enrolled full-time (12 credits) at YVCC or any four-year institution after the student has transferred or graduated from YVCC. The student must have exhibited academic excellence by achieving a GPA of 3.0 or higher and be working toward a degree in business or economics or a related course of study. Financial need is not a criterion. WILLIAM RUSSELL Awardedtoafirst-orsecond-year student attending YVCC. The student must show academic achievement. DAVID & ALMA SCHOESSLER Awarded to returning students enrolled full-time (12 credits) at YVCC with a need to meet the cost of tuition in their second year at YVCC. Two scholarships are awarded, one to a business administration major with excellence in accounting courses and one to a student with a strong interest in history or literature. Both students must be in the upper 10 percent of their class. Yakima Valley Community College, 2015-2016 183 184 YVCC FOUNDATION SCHOLARSHIP & AWARDS DALE F. SCHMIDT - SOUTH WEST ROTARY Awarded to a full-time (12 credits) student who has completed one full academic year at YVCC. The student must be seeking an AA degree in business, be recommended by the Business Department and show academic achievement. LUCILLE WEBER SCHREINER Granted to a full-time (12 credits) student enrolled at YVCC who is majoringinahealthoccupationfield (nursing, dental hygiene, radiologic technology, etc.). The award is determined by the health occupation departments. Financial need is a criterion. STANLEY SERAFIN Awarded to a student enrolled full-time (12 credits) at YVCC who is seeking an AA degree and who is deaf or hard of hearing. BURT G. SHELBY MEMORIAL SCHOLARSHIP Awarded to a full-time (12 credits) student enrolled at YVCC who is a graduate of Grandview High School. The student must show academic achievement with a 2.5 to 3.5 GPA. GLEN SHERAR Athletic scholarship which is awarded to a full-time (12 credits) student enrolled at YVCC and who has an interest in athletics. Selection is made by the Athletic Department. EUGENE & GWEN SHIELDS Awardedtoafirstorsecondyear student enrolled full-time (12 credits) who is working toward an AA degree. The student must be an employee or a sibling of an employee of the Shields companies. The students must maintain a 2.5 cumulative GPA. Financial need is a criterion. WILLIAM R. SHIELDS Awarded to an employee or immediate family member of Shields companies. Must be enrolled full-time (12 credits) and maintain a 2.5 GPA while attending YVCC. MARY HUNTZICKER SNYDER Awarded to a full-time (12 credits) student enrolled at YVCC. The student must be in the upper 20% of the graduating class, maintaining a 3.0 GPA after two quarters at YVCC, and planning to major in education. SOROPTOMIST To an enrolled full-time (12 credits) female student enrolled at YVCC whoisineitherherfirstorsecond year, has been employed, and is seeking to further her education and develop additional learning and skills for future employment. She shall demonstrateafinancialneed.The award is determined by Soroptomist International of Yakima. MARGARET SPLAWN Awarded to a student enrolled full-time (12 credits) at YVCC and majoring in history or political science. JESSIE P. STALEY Awarded to a student transferring after her second year at YVCC to WSU. The student must be enrolled full-time (12 credits) at YVCC and be majoring in business administration. Financial need and academic achievement are a consideration. LORENE STAMEY Awarded to a student pursuing an AA degree in natural science. Academic achievement is a consideration. STANLIE & VERA “ST. CLAIR” STANESCU Awarded to a student enrolled full-time (12 credits) at YVCC. The scholarship is based on need and academic achievement and awarded to a working student. MILLIE HEGRENES STENEHJEM STENEHJEM FAMILY Awarded to a full-time (12 credits) student who has completed one full academic year at YVCC and is seeking an AA degree in arts and sciences, technical areas, general studies, biology, or drama. The student must demonstrate academic achievement. DR. HARLOW & REPRESENTATIVE MARY SKINNER MEMORIAL SCHOLARSHIP Awarded to a full-time (12 credits) student at YVCC seeking a degree. The student must demonstrate academic achievement. Financial need is a consideration. Yakima Valley Community College, 2015-2016 ELAINE F. SUNDQUIST NURSING Scholarship AwardedtoaYVCCfirst-yearstudent for use in the second year to pursue studies preparatory to becoming a licensed registered nurse. The student must be enrolled full-time (12 credits) at YVCC, maintain a 3.0 GPA or higher, and demonstratefinancialneed.Selection of the recipient shall be made by a committee of the Nursing Department. The scholarship is awarded in memory of Elaine F. Sundquist, who served actively in establishing the School of Nursing at Yakima Valley Community College. PATRICIA & MARVIN SUNDQUIST A scholarship awarded to a returning student enrolled full-time (12 credits) at YVCC for use in their second year to pursue an AA in the health occupation courses. The student must demonstrate academic achievement by maintaining a 3.0 GPA or higher. Financial need is a criterion. RALPH SUNDQUIST Awardedtoanenteringfirst-year student enrolled full-time (12 credits) at YVCC and who is a graduate of a Yakima or Selah high school; also for renewals for returning sophomores who will attend YVCC. Qualifying students must rank in the upper 10 percent of their class. Students must possess qualities of leadership, friendliness, andinfluenceforgoodamongfellow students. TAYER MEMORIAL Awarded to a student enrolled full-time (12 credits) at YVCC and who is a Selah High School graduate. Special preference for students majoring in English or the arts. Financial need is not a criterion but the student must have a recommendation from teachers and demonstrate academic responsibility. NICHOLE VALENZUELA MEMORIAL Details can be arranged by Scholarship Organization of Youth. ETHEL VOSBURGH Granted to a full-time (12 credits) student enrolled at YVCC, a U. S. citizen, preferably female, who can demonstratefinancialneed. YVCC FOUNDATION SCHOLARSHIP & AWARDS ABBY & RALPH WALSH, CHAPTER BD, PEO Awarded to a returning female student enrolled full-time (12 credits) at YVCC to be used in her second year. The student must demonstrate reasonable responsibility in her academic work and show qualities of leadership, friendliness,andinfluenceforthe common good among her fellow students.Theacademicfieldofstudy must be in accounting or business. WASHINGTON APPLE EDUCATION FOUNDATION Awarded to a student seeking tree fruit/ AG degree. ART WEBER MEMORIAL Awarded to a full-time (12 credits) student seeking a degree in engineering & sciences. Who demonstrates academic achievement. WEST VALLEY KIWANIS Awarded to a full-time (12 credits) student enrolled at YVCC who is seeking an AA degree. The student mustdemonstratefinancialneedand academic achievement. HAZEL WETZEL FOUNDATION FUND Granted to a student enrolled full-time (12 credits) at YVCC who demonstrates academicachievementandfinancial need. YAKIMA KIWANIS / WILLIAM F. CLARK MEMORIAL Awarded to a full-time (12 credits) second-year student seeking a degree inagricultureorarelatedfieldwho demonstrates academic achievement andfinancialneed. YAKIMA LIONS - EYLER ELLIOTT Awarded to a full-time (12 credits) student seeking an associate in arts degreewhodemonstratesfinancial need. Priority is given to students or parents of students with legal blindness. SCHOLARSHIPS NOT ENDOWED: • • • • • • • • • • • • • Ike & Joe Anderson - Agriculture Gar Barnett Victoria Braden/PEO FR Cascade Natural Gas James Carvo Sheila Davidson - Chemical Dependency Leslie Eglin - Education Robert & Maxine McAuley Nancy Olson - Surgical Tech Johanna Rodman Foundation John Sherman Trust - Engineering Vice President's Yakima Federal Savings & Loan WILLIE & MAMIE (TILFORD) WOOD Awarded to a full-time (12 credits) student enrolled at YVCC who is a graduate of a Yakima High School. The student must maintain an excellent GPA, and a strong background of student activities should be outlined showing leadership potential. Financial need may be considered. YAKIMA BPW FUND Awarded to a student enrolled full-time (12 credits) at YVCC. The student must demonstrate academic achievement andfinancialneed.Recommended by Yakima Business and Professional Women. YAKIMA COUNTY DEACONS AND STEWARDS Awarded to a freshman full-time student (12 credits) seeking an AA Degree in Arts & Sciences, technical areas, or general studies. He or she has a 3.0 GPA or above. Financial need is considered. YAKIMA COUNTY DUI SURVIVORS PANEL Awarded to a full-time (12 credits) student enrolled at YVCC. Yakima Valley Community College, 2015-2016 185 186 A PERSONNEL ACKERMAN, ROBERT: Custodian - Facility Operations; 2011 ALAMOS, MICHAEL: Coordinator - MESA Program; 2005 AlVARADO-VALDOVINOS, LORENA: Curriculum Affairs Manager - Instruction and Student Services; 2014 BA, University of Washington AMADOR, RAFAEL: Custodian - Facility Operations; 2013 ANDERSON, ERIC: Anthropology Instructor; 1988 ALA, North Idaho College; BA, University of Montana; MA, Washington State University ANDERSON, RON: Custodian - Facility Operations; 2009 ANDERTON, ERIN: Fiscal Analyst - Business Office; 2009 AA, Spokane Falls Community College; BA, Washington State University ANTHONY, ANGELA: Accountant for Grants and Contracts - Business Office; 2014 AA, Yakima Valley Community College APPERSON, STEFAN: Information Technology/Media Instructor; 2000 BS, Portland State University; MBA, Oregon State University AROSTEGUI, TRACY: English Instructor; 1993 AA, Yakima Valley Community College; BA, MA, Central Washington University; BA, University of Washington ASATO, ELAINE: Retail Clerk - Bookstore - Student Services Division; 1996 ASHWORTH, KATHLEEN: Chemistry Instructor; 1983 BS, Michigan State University; MS, Wayne State University B BACA, ROXANNE: Program Assistant - Student Life; 1980 AAS, Yakima Valley Community College BAKER, WENDY L: Nursing Instructor; 2004 BSN, Vanderbilt University; MS, University of Michigan BALL, TRENT: Viticulture Instructor; 2006 BS, University of Idaho; MA, Washington State University BARTZ, BARBARA: Nursing Instructor; 1992 AAS, Highline Community College; BSN, Washington State University; BA, MSN, University of Washington BATALI, MICHAEL J: Information Technology Instructor; 1999 BS, MEd, Central Washington University; MA, University of Nebraska - Lincoln BAUR, KENNETH: Grounds and Nursery Specialist 2; 2012 BEAUDRY, CHRISTINE: Radiologic Sciences Coordinator/ Instructor; 1998 BS, Weber State University; MEd, Central Washington University BENETTI, JODI: Instruction & Classroom Support Technician - Basic Skills; 2006 AA, Yakima Valley Community College BENITEZ, SAN JUANITA: Bilingual Instructional & Classroom Support Technician - Basic Skills; 1998 BISSONETTE, JOHN: Art/Humanities Instructor; 2014 BA, Columbus College; MA, University of Tennesse Knoxville Yakima Valley Community College, 2015-2016 BLISS, KATHLEEN: Administrative Assistant 2- Facility Opperations; 2013 BICKLEY, TERRI “Alicia”: Drama Instructor; 2004 BA, University of Georgia; MFA, University of Idaho BLACKABY, LESLIE: Dean-Student Services; 2000 BA,SeattlePacificUniversity;MS,CentralWashington University BLINK, DAVID: Music Instructor; 2006 BM, University of Nevada; MM, Central Washington University BLONDIN, MICHELLE: Secretary Supervisor - Arts and Science; 2010 BOND, JEREMY: Web Applications Specialist; 2008 AAS, Yakima Valley Community College; Hardware/ SoftwareCertification,SylvanPrometricTestingFacility BOOTHMAN, RODGER: Manager-Bookstore - Student Services; 2003 BA, Washington State University BOUTAINE, BARBARA: Reference Librarian; 1992 BA, Heritage College; MLIS, University of Oklahoma BOYD, BELINDA: Fiscal Analyst - Business Office; 2001 BUCHANAN, DIANE: Administrative Assistant to the Dean - Basic Skills; 2002 AA, Yakima Valley Community College BUEGGE, JOHN “Jeremy”: Biology Instructor; 2010 BS, Trinity University; MS, Arizona State University BUENO, LUIS: Grounds & Nursery Specialist - Facility Operations; 2015 BUSBY, JUSTIN: Information Technology Specialist Technology Services; 2014 TelecommunicationsTechnologyCertificate,Perry Technical Institute C CALAHAN, TAMMY: Basic Skills Instructor - Integrated Medical Training; 2011 AAS, Yakima Valley Community College; BS, Washington State University CALHOON-DILLAHUNT, CAROLYN: English Instructor; 1999 BA, MA, Washington State University CAMPOS, JOHNNY: Custodian - Facility Operations; 2003 CANTELON, JANET: Financial Aid Director; 2012 BA , University of Southern California CARPENTER, CLAIRE: Biology Instructor; 2003 BA, Colorado College; MS, University of New Mexico CASTANEDA, DELIA: Instructional & Classroom Support Technician - Grandview Campus; 2010 CAVANCESS, KERRIE: Dean - Arts & Sciences; 2005 BS, Central Washington University; MEd, Heritage University CHAMA, RICARDO: Spanish/Second Discipline Instructor; 1990 AA, Yakima Valley Community College; BA, Central Washington University; MA, Middlebury College CHIPREZ, MELINDA: Spanish Instructor, 2008 BA, MA, Washington State University CHHOKAR, DILBAR: Information Technology Specialist Technology Services; 2015 BS, Central Washington University PERSONNEL 187 CIKAUSKAS, REBECCA: Program Assistant - Nursing Program; 2004 AAS, Yakima Valley Community College DeVILLENEUVE, ELIZABETH: Counselor; 2008 BA, Central Washington University; MSW, Eastern Washington University CLARK, LINDA: Procurement & Supply Support Specialist - Purchasing Department; 2002 AA, Yakima Valley Community College DIAZ, ELIVETTE P: Basic Skills Instructor; 2014 BA, University of Florida; MA, University of the Rockies DIBENEDETTO, KELLEY: Office Assistant - Arts & Sciences; 2002 AA, Yakima Valley Community College CLOSNER, MICHELLE: Nursing Instructor; 2014 AAS, Yakima Valley Community College; BS, MS, Washington State University CONRAD, STAN: Chemistry Instructor; 2014 BS, University of Wisconsin; MS, Southern Illinois University Carbondale COOMER, MARC: Assistant Dean-Support Programs in Student Services Division; 1986 BA, MEd, Central Washington University, CORNWELL, JEFFREY: Campus Security Officer; 2009 AAS, Yakima Valley Community College CORONADO, REBECCA: Office Assistant - Arts & Sciences; 2013 BS, Heritage University CORT, REBECCA: Program Assistant - Financial Aid; 2007 AAS, Yakima Valley Community College COZBY, DAVID: Custodian - Facility Operations; 2007 CDLCertificate,YakimaValleyCommunityCollege CRAWFORD, KAYLA: WorkFirst Coordinator; 2013 AA, Lower Columbia College; BS, Washington State University CROSHAW, TRACY: ASL Instructor; 2007 BA, Central Washington University; MS, Idaho State University CUEVAS, MARIA: Chican@ Studies Instructor; 2007 BA, MA, MSW, University of California CUMMINGS, CHUCK: Custodian - Facility Operations; 1995 AAS, Yakima Valley Community College CUNNINGHAM, EVANGELINA R: Reference Librarian; 2015 BS, Eastern Washington University; MLIS, University of Washington D DAHLIN, MARY: English Instructor; 2000 AAS, Yakima Valley Community College; BA, MA, Central Washington University DALTON, DAVID: Information Technology Instructor; 2010 BA, Messenger College; MA, Liberty University DELP, NICOLE: Procurement & Supply Specialist Administrative Services; 2014 AAS, Yakima Valley Community College DELQUADRI, SHEILA: Director-Institutional Effectiveness; 2006 AA, Yakima Valley Community College; BA, Eastern Washington University ; MPS, Pennsylvania State University DeNOME, KELLEY: Veterinary Technology Instructor; 1999 BS, DVM, Washington State University DIN, MANUEL: Custodian - Facility Operations; 2015 DORN, RACHEL: Art/Humanities Instructor; 2006 BA, Coe College; MA, MFA, University of WisconsinMadison DONOVAN, SHERRY: Nursing Instructor; 2011 AAS, Yakima Valley Community College; BSN, Washington State University DULIN, WILMA: Faculty Coordinator-Office of Institutional Effectiveness; 1989 BA, University of Kansas; MS, Central Washington University E EAGAN, SHAUN: Database Manager; 2014 AAS, Yakima Valley Community College; BA, University of Washington ELYEA, JOHN: Assistant Network Administrator; 2007 ITCertificate,MicrosoftCertifiedTechnicalEdCenter EMERSON, HILLARY: Curriculum Advisor; 2001 AA, Yakima Valley Community College; BA, Whitman College ERICKSON, DANIEL: Speech/Communications Instructor; 2004 AA, Yakima Valley Community College; BA, MA, Washington State University EUBANKS, AMON “Brock”: Economics Instructor; 2008 BA, MBA, Washington State University; PhD, University of Idaho EVANSON, JOHN: Business Administration Accounting Instructor; 2010 BA, MBA, University of North Dakota F FERGUSON, DANIEL: Director - Center of Excellence; 2011 BA, MA, Loma Linda University FOLLANSBEE, MICHAEL: English Instructor; 2014 BA, University of Washington; MA, University of New Mexico FORREST, DODIE: English Instructor; 1998 BA, MA, Oregon State University FOSTER, ANGELA: Payroll Coordinator - Payroll Services; 2014 AA, Yakima Valley Community College; BS, Walden University; MS, University of Phoenix; MBA, University of Phoenix FRAZIER, SARAH: Program Assistant - Student Services; 2012 AAS, Yakima Valley Community College FULTON, DONNA: Program Assistant - Dental Hygiene Program; 1987 Yakima Valley Community College, 2015-2016 PERSONNEL 188 FUNK, RAY: Director of Athletics - Student Services; 2005 AAS, Yakima Valley Community College; BA, Washington State University; MS, St Thomas University G GADLEY, DIANNA: Secretary Senior - Dean-Workforce Education; 2006 ExecutiveSecretarialCertificate,TrendBusinessCollege GANDY, GENE: Custodian - Facility Operations; 1998 AA, Yakima Valley Community College GARCIA, AL: Program Coordinator - Upward Bound Program; 2008 GERNER, GORDON: Media Assistant - Library & Media Services; 2009 AA, San Bernadino Valley College GILBERT, JONATHON: Electrician - Facility Operations; 2004 ElectricalTechnologyCertification,PerryTechnical Institute GONZALEZ, HILDA: Administrative Assisitant to Vice President - Instruction and Student Services; 2014 BA, Washington State University GOOCH, JASON: Philosophy Instructor; 2007 BA, University of Evansville; MA, Western Michigan University GOODWILL, JANET FOSTER: Criminal Justice Instructor; 1994 BA, Washington State University; JD, University of Oregon GOODWILL, CAITLIN: Coordinator Student Life - Student Services; 2014 BS, Washington State University; MA, Texas Tech University GOULD, DEBORAH L: Dental Hygiene Instructor; 2010 AAS, Yakima Valley Community College; BS, Eastern Washington University; MEd, Western Governors University GRABENHORST, CHERILYNN: Office Assistant - Student Services; 2007 BS,SeattlePacificUniversity GRAHAM, TAMARA: Financial Aid Assistant Director; 1994 AA, Yakima Valley Community College; BA, Central Washington University GRAVESEN, BRAD: Network Administrator; 2003 TelecommunicationsProgramCertificate,Perry Technical Institute GREEN, MELISSA: Director-Upward Bound Program; 2005 BA, MA Central Washington University H HAGER, KEVIN: Instructional Designer - Technology Services; 2014 M.Ed, University of Rio Grande HALE, QUINN: Registrar and Director - Enrollment Services; 2013 AA, Mt. Hood Community College; BS, Oregon State University; MBA, Western Governors University HARDEN, TRACY: Office Assistant - Student Services; 2014 HAYES, GEORGE: Custodian - Facility Operations; 2002 HENNESSY, JULIA: Fiscal Technician - Administrative Yakima Valley Community College, 2015-2016 Services; 2015 AAS, Yakima Valley Community College HERNANDEZ, PATRICIA: WorkFirst Coordinator; 2008 AA, Wenatchee Valley Community College; BA, MA, Eastern Washington University HOFFMAN, CINDY: Information Technology Specialist Technology Services; 2004 AAS, Yakima Valley Community College HOLLAND, TERESA: Vice President-Administrative Services; 2001 BS, MA Central Washington University HOPKINS, NICOLE: Coordinator - Community Relations, Office of the President; 2003 BA, Seattle University HOPKINS, SHANNON: English Instructor: 1991 BA, Evergreen State College; MA-English Standard, CWU HUMPHERYS, BRYCE: Dean - Grandview Campus and Basic Skills; 2006 AA, Ricks College; BA, MS, Utah State University; EdD, Washington State University HUNT, JEANENE: Media Assistant - Library & Media Services; 2004 HUYCKE, DAVID T: Geology/Second Science Instructor; 1993 BS, University of Puget Sound; MS, University of Wyoming; MA, University of Southwestern Louisiana I ISON, LINDA: Fiscal Technician - Payroll/Business Office; 1983 IVY, CHRISTINE: Nursing/Allied Health Technologies Instructor; 1994 BSN, Washington State University; MSN, Gonzaga University J JARAMILLO, ASHLEY: Coordinator-Special Populations; 2012 JENCK, MICHAEL: Mathematics Instructor; 2003 BS, Southern Oregon State College; MS, Northern Arizona University JENNINGS, DIANA: Coordinator-Grandview Student Services; 1992 AAS, Yakima Valley Community College JENSEN, CONNIE: Program Assistant - Center of Excellence; 2008 AAS, Yakima Valley Community College JENSEN, MEGAN: Administrative Assistant to the President - Office of the President; 2014 JESKE, TIMOTHY: Political Science Instructor; 1994 BA, Boise State University; MA, PhD, University of Washington JEWELL, TERRY: Custodian - Facility Operations; 2004 JIMENEZ, LINEA: Program Assistant - WorkFirst Program; 2001 BS, Heritage University, M.Ed, Heritage University JIMENEZ, MARIBEL: Counselor; 2014 AA, Yakima Valley Community College; BA, MSW, Eastern Washington University PERSONNEL 189 JOHNSTON, LARRY: Stockroom Attendant - Workforce Education; 2009 AAS, Yakima Valley Community College LEWIS, MATTHEW: Mathematics Instructor; 2010 BS, MEd, Eastern Oregon University; MS Western Washington University JONES, STACEY: Program Assistant - Workforce Education; 2014 JUAREZ, SOPHIA Z: Office Assistant - Auxiliary Services; 2015 LIERSEMANN, CHRIS: Maintenance Mechanic - Facility Operations; 1994 LOESER, MATTHEW: Biology Instructor; 2005 BA, University of Montana; MS, PhD, Northern Arizona University K LOPEZ, GEORGE E: Mathematics Instructor; 1997 AA, Sacramento City College; BS, University of California at Davis; MS, Purdue University KAMINSKI, LINDA: President: 1995 BS,MansfieldUniversity;MA,GeorgeWashington University; MS, University of Nebraska at Omaha; EdD, College of William and Mary KEMPER, VIRGINIA “Jill”: Cashier - Business Office; 2003 KENNEDY, MARIE: Information Technology Specialist Technology Services; 1999 AA, Yakima Valley Community College KENNY, STEPHEN: Biology Instructor; 2006 BS, Frostburg State University; MS, North Carolina State University; PhD, Colorado State University KENT, GREG: Mathematics Instructor; 2009 BS, Gonzaga University; MS, Ohio State University; MS, Oregon State University KINZELL, CHRIS: Program Assistant - Financial Aid; 2014 KINZEL, RITVA: Business Administration Instructor; 2010 AA, American River College; BS, California State University; MBA, Washington State University KITE, RYAN: Web Designer; 2013 AAS, Yakima Valley Community College KITT, CRISTI: Business Administration Instructor; 2014 BA, Washington State University; MS, City University KLAUS, SUSAN: Business Technology Instructor; 2008 BS, University of Idaho; MS, Central Washington University KNICKERBOCKER, TANYA: Chemistry Instructor; 2010 BS, University of Wisconsin-Madison; PhD, Harvard University KOESTLER, GORDON: English Instructor; 1992 AA, Green River Community College; BA, Washington State University; MA, Central Washington University KOLUDA, PATTI: Business Technology Instructor; 1984 AA, Wenatchee Valley Community College; BA, Washington State University; MBA, City University KUNKLER, LORI: Adult Basic Education Instructor; 2014 BA, Central Washington University L LANE, MICHAEL: Campus Safety and Security Sergeant Facility Operations; 1991 LAWS, KATHY: Basic Skills Instructor; 1988 BA, MEd, Central Washington University LeBOEUF, CAROLYN: Office Assistant - Duplicating Services; 2008 LeROUE, TAMMERA: Program Assistant - Arts and Sciences; 2013 AAS, Yakima Valley Community College LEWIS, DOUGLAS: Mathematics Instructor; 1992 BA, Washington State University; MAT, Central Washington University LOPEZ, LUIS: Director - Applied Baccalaureate Program; 2014 BS, Central Washington University; MS, University of Phoenix LOPEZ, PAULETTE: Dean-Workforce Education; 2002 AA, Sacramento City College; BA, MS, Purdue University; LOPEZ, SENAIDA: Bilingual Secretary Senior to the DeanGrandview Campus; 1999 AA, Yakima Valley Community College LOPEZ, TONY: Custodian - Facility Operations; 2004 LOPEZ-URENA, VICENTE: Counselor; 2015 BA, Heritage University; MA, Heritage University LUND, MARIA: Credentials Evaluator - Student Services; 2002 AA, Cypress College LYNX, DAVID: Larson Gallery Director; 2012 AA, Bellevue Community College; BA, University of Washington; MLS, University of Oklahoma M MACIAS, JOAQUIN: Bilingual Program Assistant Workforce Education; 1999 AA, Yakima Valley Community College; BA, Central Washington University MacLEOD, SHANNON: Curriculum Advisor - Student Services; 2015 MAHRE, DEBBIE: Dental Hygiene Instructor; 2009 BS, Eastern Washington University; MS, Eastern Washington University MARQUIS, RUSSELL: Basic Skills Instructor; 2008 BA, Western Washington University; MEd, Heritage College MARTIN, CHRISTOPHER L.: Custodian - Facility Operations; 2015 MARTINEZ, ADELINA: Bilingual Office Assistant - Basic Skills; 2008 CosmetologyCertificate,ProfessionalBeautySchool; FamilyServicesCertificate,HeritageCollege MASSON, DEBRA: Program Assistant - Arts & Sciences; 2014 MATLACK, HEIDI: Counselor - Grandview Campus; 2008 BA, University of Wyoming; MA, Washington School of Professional Psychology MAY, LAURA: English Instructor; 2013 BA, California State University; MDiv, Fuller Theological Seminary; MA Oregon State University MAYO, J BENJAMIN: Mathematics Instructor; 1990 AA, Yakima Valley Community College; BA, Whitworth College; MAT, Central Washington University Yakima Valley Community College, 2015-2016 PERSONNEL 190 MAZHARI, SAM: Chemistry Instructor; 2008 MS, Jackson State University; PhD, University of Nevada McBRIDE, DEBBIE: Copy Center Lead - Duplicating Services; 2000 McCALLUM, CAROLYN: Mathematics Instructor; 1990 BS, Michigan State University; MS, Oregon State University McCORMICK, JAMES: Speech Instructor; 1987 BA, Central Washington University; MA, Washington State University McRAE, LIBBY: Allied Health Technologies Instructor; 2005 NationalCertificationinSurgicalTechnology,NCCA McREYNOLDS, DAVID: Communications Instructor; 2013 BA,SeattlePacificUniversity;MA,WesternWashington University MEISTER, MARTIN: Mathematics Instructor; 1998 BA, Carroll College; MA, Montana State University MELTON, MICHAEL: Program Assistant - Allied Health Programs; 2007 AAS, Yakima Valley Community College MENARD, STEFANIE: Communications Consultant Community Relations; 2007 AA, Yakima Valley Community College; BS, Central Washington University MENDOZA, MARICRUZ: Office Assistant - Grandview Campus; 2013 MEREDITH, SUSAN: Program Coordinator - Technology Services; 1998 AA, Yakima Valley Community College MERTELL, JOHN: Maintenance Mechanic - Facility Operations; 1979 MICHALEK, MELISSA: Program Assistant - Student Services; 2015 MS, Indiana State University MILLER, RICHARD: Information Technology Systems Specialist - Technology Services; 1999 TTCertificate,JMPerryInstitute MILLS, JIM: Campus Security Officer - Facility Operations; 1999 BA, Washington State University MOHSENIAN, SHIRLEY: Allied Health Technology Program Instructor; 2000 BSN, University of South Alabama MONDACA, BIATRIS: Instructional and Classroom Support Tech; 2012 AA, Yakima Valley Community College MONTI, TARYN: Tech Prep Coordinator; 2013 BA,Washington State University MOON, PAM: Fiscal Specialist - Workforce Education; 1999 AA, Yakima Valley Community College MOORE, DENISE: Instructional & Classroom Support Technician - Veterinary Technology Program; 2006 AAS, Yakima Valley Community College MOREHEAD, JUDY: Director-Budget Services Administrative Services; 1997 AAS, Yakima Valley Community College MORGAN, JOHN: Information Technology Specialist; 2012 A+Certification,YakimaValleyTechnicalSkillsCenter Yakima Valley Community College, 2015-2016 MORROW, BONNIE FRANCE: Psychology Instructor; 1994 BS, University of California at Los Angeles; PhD, University of California at Irvine MORROW, JEFF: Grounds & Nursery Services Specialist Facility Operations; 2000 BS, Washington State University MOSEBAR, CAROL: Office Assistant - Workforce Education; 2007 AA, Yakima Valley Community College MOUNT, THOMAS: Psychology Instructor; 1989 BA, Western Washington University; MEd, LaTrobe University, Melbourne; MS, University of Melbourne MUGLESTON, BRADY: Director - Auxilliary Services; 2007 AA, Yakima Valley Community College; BA, Brigham Young University N NEWMAN, HEATHER: Human Resources Consultant Assistant - Human Resources Services; 2014 NOLT, KIM: Instructional & Classroom Support Technician - Grandview Writing Center; 2003 AA, Yakima Valley Community College; BA, MEd, Washington State University O OLSON, CORREY: Campus Security Officer - Facility Operations; 2002 OLSON, JOHN: Custodian - Facility Operations; 1989 AA Yakima Valley Community College O’NEIL, MARGARET: Nursing Instructor; 2006 BSN, Idaho State University; MSN, Washington State University ORGILL, GLENDA E: Education Instructor; 1998 AA, Yakima Valley Community College; BA, Central Washington University; MA, Heritage College OVERLAND, KEITH: Custodian - Student Residence Center; 2008 BA, Central Washington University OWEN, KELSIE: Coordinator-Fitness Center - Student Services; 2009 BA, Washington State University; MS, Capella University P PALMATEER, KEVIN: Information Technology/MultiDiscipline Instructor; 2000 AA, Lower Columbia College; BS, MEd, Central Washington University PANARELLO, SARAH: Nutrition Instructor; 2005 BS, Northwest Nazarene College; MS, Bastyr University PANGRAZI, CAMI: Instructional & Classroom Support Technician - Allied Health Programs; 2008 AAS, Yakima Valley Community College PARRA, ILDA: Program Assistant - Student Residence Center; 2006 PATEL, PRAGNA: Retail Clerk Lead - Bookstore; 1994 AAS, Yakima Valley Community College PATTERSON, BRIAN: English Instructor; 2012 BA, University of Massachusetts; MA, San Francisco State University; MFA, Columbia College Chicago PAYTON, JODI: Information Technology Specialist- Technology Services; 1998 AAS, Yakima Valley Community College PERSONNEL PEREZ, RAOUL: Maintenance Mechanic - Facility Operations; 2002 HVACCertification,PerryTechnicalInstitute PERRAULT, SUSAN: Counselor; 2007 BA, Western Washington University; MSW, University of Washington PETERS, DAN: English Instructor; 2001 BA, Willamette University; MA, University of Montana PFIEFFER, BEVERLY: Fiscal Technician - Business Office; 1988 PHILLIPS, KEVIN: Campus Security Officer - Facility Operations; 2003 BasicLawEnforcementCertification,WashingtonState Criminal Justice Training Commission; Military Police Certification,USArmy PHILLIPS, SIRENA: Program Assistant - RSVP; 2002 AA, Yakima Valley Community College PIERPOINT, DESIREE: Instructional and Classroom Support Technician - Vet Tech; 2013 AA, Pierce College PODRUZNY, CHERI: Dental Hygiene Coordinator/ Instructor; 1985 AA, Yakima Valley Community College; BS, Central Washington University, MS, Eastern Washington University POTTENGER, DEBRA: Program Assistant - Student Residence Center; 2005 PRIMROSE, KEVIN: Custodian - Facility Operations; 2005 AAS, Yakima Valley Community College Q QUINTERO, JEANNETTE: Human Resource Generalist Human Resource Services; 2013 BS, University of Idaho R RAJ, RAJKUMAR: Engineering Instructor; 2007 BS, National Institute of Technology; MS, State University of New York RAMIREZ, ALMA: Human Resource Generalist - Human Resource Services; 2013 AA, Yakima Valley Community College, BS, Central Washington University RAMIREZ, RAQUEL: Basic Skills Instructor; 1994 BA, MEd, Eastern Washington University RAMOS, ABRA: Mathematics Instructor; 2013 BS, University of Tennessee; MS, Eastern Washington University RASMUSSEN, CRISTY: Secretary Senior-Dean-Student Services; 2011 AA, Yakima Valley Community College; BA, BS, Central Washington University RATH, DEBBIE: Fiscal Technician-Business Office; 2014 REDIFER, SHARON: Coordinator - Special Funding for Student Services; 2010 AAS, Spokane Falls Community College REYES, KEITH: Sociology Instructor; 2010 BA, Howard Payne University; MA, University of Texas 191 RICE, CASEY: Assistant Director - Facility Operations Administrative Services; 2011 ATA, Lower Columbia College RICE, JENNIFER: Coordinator Running Start and Testing; 2013 BS,MBACaliforniaStateUniversityatBakersfield RICE, LISA: Fiscal Analyst -Business Office; 2000 AA, Lower Columbia College RICH, TAMERA: Program Assistant - Workforce Education; 2013 RIVERA-TRUJILLO, FRANCISCO: Maintenance Mechanic Grandview Campus; 2007 ElectricalTechnologyCertificate,PerryTechnicalInstitute RODRIGUE, STEPHEN: Physics Instructor; 2012 BS, University of New Orleans; MS, University of New Orleans, PhD, University of New Orleans RODRIGUEZ, AMANDA: Administrative Assistant to the Vice President - Administrative Services; 2007 RODRIGUEZ, BROOKE: Office Assistant -Athletics; 2014 RODRIGUEZ, MARGARITA: Bilingual Office Assistant Lead- College Information Desk; 2006 RODRIGUEZ, YESENIA: Director -Workforce Education; 2011 BS, Central Washington University; MEd, Heritage University RODRIGUEZ-FUNK, LONNI: Director - Workfirst Basic Skills; 2015 BA, Heritage University; MA, Heritage University ROEBER, RONALD: Machine Technology Instructor; 2014 ROGSTAD, MARK: Director - Human Resources & Affirmative Action Officer; 1998 BA, Washington State University; MS, Central WashingtonUniversity;SPHRCertification ROMERO, JUANITA: Curriculum Advisor- Student Services; 2011 BA, Central Washington University RUGGLES, MURRAY: Automotive Instructor; 2013 AOS, Universal Technical Institute RUTZ, LILIANA: Bilingual Office Assistant - Upward Bound; 2008 RUTZ, SEAN: Custodian - Facility Operations; 2007 RYAN, THERESA: Library & Archives Paraprofessional Library & Media Services; 2006 RYDER, JANE: Allied Health Technologies Instructor; 2005 BA, Central Washington University S SABOL, LOIS: Sociology/Second Discipline Instructor; 2000 MS, North Dakota State University; PhD, Iowa State University SANDERS, De’ANDRE: Information Technology Specialist Technology Services; 2004 AAS, Yakima Valley Community College SANDLAND, CHARLENE: Fiscal Manager - Basic Skills and Workforce Education Divisions; 2013 AA, Yakima Valley Community College SCHAPIRO, DANIEL J: Mathematics Instructor; 1992 BS, University of Illinois; MA, University of Washington SCHOFIELD, JOHN: Instructional and Classroom Support Technician - Writing Center; 2013 Yakima Valley Community College, 2015-2016 192 BA, Simpson University PERSONNEL SCHLENKER, NEAL: Information Technology Specialist Grandview Campus; 2006 AAS, Yakima Valley Community College SCHILLINGER, RICHARD: Counselor; 2012 AA, Yakima Valley Community College; BA Central Washington University; MEd, Heritage University SCHNEIDER, CAROL: Business Administration Instructor; 1998 BS, MBA, University of Rhode Island SCHROEDER, SANDRA: English Instructor; 1998 AA, Skagit Valley College; BA, MA, Western Washington University SCHUT, CAROLYN: Mathematics/Second Discipline Instructor; 2000 BA, University of Washington; MS, Central Washington University SCOTT, BECKY: Basic Skills Instructor; 1986 AA, Yakima Valley Community College; BA, Central Washington University SEGAL-MAINS, JANESSA: Library and Archives Paraprofessional - Library and Media Services; 2015 AAS, Spokane Falls Community College SEVEYKA, JERRED: Biology Instructor; 2001 BA, MS, University of Montana SHAW, HEIDI: Psychology Instructor; 1995 BA, MS, Central Washington University; PhD, University of Nevada SHEAN, BLAIR: Biology Instructor; 1998 BA, The Evergreen State College; PhD, Colorado State University SIEBENBERG, TAMMY: Reference Librarian; 2006 BS, City University; MLS, University of Washington SIMON, ANDREA: Instruction & Classroom Support Technician - Writing Center; 2008 AA, Yakima Valley Community College SIZEMORE, WILLIAM “Greg”: Parking Guide - Facility Operations; 2004 SMITH, BRAD K: Instructional & Classroom Support Technician - Grandview Campus; 2009 SOUTHARDS, TESSA: Fiscal Analyst - Business Office; 1999 ABMCertificate,TrendBusinessCollege;AA,Yakima Valley Community College SPALETTA, WILLIAM: Nursing Instructor; 2009 AAS, Ricks College; BSN, MPA, Idaho State University; MSN, Washington State University ST GEORGE, JEFFREY: Custodian - Facility Operations; 2007 STALEY, JACQUELINE: eLearning & Assessment Instruction Support Specialist-Technology Services; 2001 AA, Yakima Valley Community College; BS, Governors State University STERBENZ, JASON: Information Technology Systems Specialist- Technology Services; 2000 AA, Yakima Valley Community College STOHR, DEBBIE: Bookstore Buyer - Administrative Services; 2015 AAS, Yakima Valley Community College STRONG, WALLACE: Ethnic Studies Instructor; 1998 AA, University of Kansas; BA, University of California at Yakima Valley Community College, 2015-2016 Los Angeles; MEd, Western Washington University; PhD, University of Illinois STROTHER, DELORES: Fiscal Technician Lead - Business Office; 1980 SULLIVAN, PANYADA: Mathematics Instructor; 2007 BA, Srinakharinwirot University; MA, Kasetsart University; PhD, Oregon State University SWANK, DELORES: Program Assistant - Basic Skills; 2010 SWEDIN, JULIE: English Instructor; 2008 BA, University of Montana; MA, Central Washington University SWIRES, ROBERT: Fiscal Technician - Financial Aid; 2000 AA, Yakima Valley Community College; BA, Central Washington University SWISHER, ELIZABETH: Nursing Instructor; 2013 AAS, Wenatchee Valley College; BSN, Regis University T TANASSE, VICKIE: Radiologic Sciences Instructor; 2004 AAS, Yakima Valley Community College; BS, University of StFrancis;ARRTCertification TAYLOR, RHONDA: Nursing Instructor/Coordinator; 1994 BSN, Washington State University; MSN, Gonzaga University TENG, SHAWN: Laboratory Technician - Arts & Sciences; 2014 BS, Central Washington University TERRY, DEBRA: Instructional & Classroom Support Technician - Basic Skills; 1998 THACKER, RICHARD: Media Assistant - Library & Media Services; 2005 AA, Tacoma Community College; BA, The Evergreen State College TILLETT, SUSAN: Information Technology Specialist Technology Services; 2001 AAS, Yakima Valley Community College TORREZ, GEORGE: Maintenance Mechanic - Facility Operations 2008 TOWNSEND, JENNIFER: Office Assistant - Student Support Services; 2008 AA, Yakima Valley Community College TOWSLEY, SCOTT: Director-Technology Services- Office of the Vice President; 2006 AAS, Embry-Riddle Aeronautics; BS, Wayland Baptist University TREVINO, EUGENE: Custodian - Facility Operations; 2004 TURNER, JEFFREY: Maintenance Mechanic - Facility Operations; 2014 TYE, VERLA: Human Resource Consultant Assistant Human Resource Services; 1980 U UNDERWOOD, SHAWN: Custodian - Facility Operations; 2004 V VACA, REYNALDO: Custodian - Facility Operations; 2008 VALDERHAUG, HELEN: Library & Archives Paraprofessional - Library & Media Services; 2005 AA, Yakima Valley Community College PERSONNEL VALDEZ, VIOLETA: Bilingual Program Assistant - Student Services; 2003 VAN DYKE, PEGGY: Program Assistant - TRiO Student Support Services; 2000 BS, Central Washington University VAN WINSEN, CATHY: Program Assistant - Workforce Education; 1989 AAS, Yakima Valley Community College VASQUEZ, MARIVY: Program Coordinator - Student Services; 2010 AA, Yakiima Valley Community College VERA, DENISE: Program Assistant - Student Services; 2001 VIDMORE, JORDAN: Graphic Designer - Community Relations; 2014 VIGIL, JESSICA: TRiO SSS Coordinator - Student Services; 2013 BA, Eastern Washington University VILLALOVOS, ANDY: Custodian - Student Residence Center; 1992 VIVEROS, MARILU: Bilingual Office Assistant - Basic Skills; 2013 W 193 WOODIE, GENE: Custodian 1; 2012 Y YANEZ-MEJIA, NAYELLI: Bilingual Office Assistant Student Services; 2014 YBARRA, TOMÁS: Vice President-Instruction & Student Services; 2003 BA, MPA, The Evergreen State College YOLO, LAURA: Program Coordinator - Upward Bound; 2013 AA, Yakima Valley Community College, BA, Central Washington University YOUNG, JOSEPH: Coordinator - Applied Baccalaureate Programs; 2015 AAS, Union College; BS, Union College; MBA Washington State University Z ZONTEK, KENNETH: History Instructor; 2004 BA, Montana State University; MA, New Mexico State University; PhD, University of Idaho WALKER, MONTGOMERY: History/Geography; 2000 BA, Humboldt State University; MA, California State University, Chico WARREN, SHERRIE: Office Assistant - Student Services; 1999 WEDAM, SUSAN M: Veterinary Technology Instructor; 1997 BS, DVM, Washington State University WIDNER, JILL: English Instructor; 1993 BA, Sonoma State University; MA, University of Hawaii at Manoa; MFA, University of Iowa WILBANKS, JAMES “Tre”: Custodial Services Manager; 2014 AA, Yakima Valley Community College; BS, Multnomah University WILKINS, SHERI: Basic Skills Instructor; 1994 BA, Western Washington University; MA, Antioch University WILLIAMS, DEBORAH: Mathematics Instructor; 2015 BS, Fayetville State University; MBA, Georgia State University WILSON, DEBORAH: Coordinator-RSVP Program & Alumni; 1999 BA, Central Washington University WILSON, ERNESTINE: Workforce Programs Coordinator; 2013 BA, Heritage University WIMBERLY, ELIZABETH: English Instructor; 2015 BA, Princeton University; MA, Oregon State University WISE, MAHALAGA: Information Technology Specialist Technology Services; 2008 ITCertification,PerryTechnicalInstitute WOLFE, CLARISSA: Director-Accounting Services Administrative Services; 1994 AA, Yakima Valley Community College WOOD, JEFF: Director - Facility Operations Administrative Services; 1989 Journeyman Electrician, JM Perry Institute Yakima Valley Community College, 2015-2016 MAPS 194 Yakima Valley Community College, 2015-2016 MAPS 195 Yakima Valley Community College, 2015-2016 AWARDS 196 Distinguished Alumnus 1982: Catherine May Bedell 1983: J. Alex (Lex) Maxwell 1984: Sid Morrison 1985: James R. Sorenson 1986: Justice Robert Brachtenbach 1987: E. Frederick Velikanje 1988: Bill Barnett 1989: Bill Lee 1990: Gene Shields 1991: Mel Lewis 1992: Dr. Penelope Hitchcock 1993: Pete Rademacher 1994: Dr. David Shinn 1995: Mike Bernazzani 1996: Dr. Erasmo Gamboa 1997: Dr. Elaine Ostrander 1998: Justice Tom J. Chambers 1999: Dr. Richard E. Weller 2000: Mel Stottlemyre 2001: Christopher Wiehl 2002: Clara R. Jimenez 2003: Don Crook 2004: Robert Card 2005: Charles Eccleston 2006:CyndiMullenhoff 2007: Sherlyn Brockway 2008: Dr. David Kenyon 2009: Amy Bragdon 2010: Lis Wiehl 2011: Dr. Lloyd Butler 2012: David Lester 2013: Dr. Gary Tollefson 2014: Walt Bratton 2015: Dr. Margit McGuire Distinguished Service 1982:JohnGriffith 1983: Virginia Hislop 1984: Dr. A.W. Stevenson 1985: The Yakima Herald-Republic 1987: Milton Martin, Dorothy Prior 1988: Darlene Koch 1989: Warren Dean Starr 1990: Fred Iraola 1991: Sister Karen Dufault 1992: Marvin Sundquist 1994: Carl Stevens 1998: Alyn Edmonston 1999: Alex Deccio 2000: Jim Sewell 2001: Helen Jewett Shields 2002: Mel Lewis 2003: Daryl & Sherrie Parker 2004: YVC Corporation, Yakima Youth Baseball 2005: Glenn Rice 2006: Gene Shields 2007: Al DeAtley 2008: Delmar Pearson, Marguerite Hackett 2009: Patrick Strosahl 2010: Dr. Michael Buehler 2011: Millie Stenehjem 2012: John Fairbrook 2013: The Larson Gallery Guild 2014: Gary Christensen 2015: Craig Dwight Emeritus Faculty 1981: George Millard 1982: Richard Marvin 1983:JohnGriffith 1984: Jane Huntzicker 1985: Hazel Leland 1989: Delma Tayer 1998: Roger Carlstrom 1999: Thomas Pier 2000: Brooke Creswell 2001: James Newbill 2002: Millie Stenehjem 2003: Dr. Inga Wiehl 2004: Dr. George Meshke 2005: Chuck Weedin 2006:EllieHeffernan 2007: Judy Kjellman 2008: Dr. Bernal C Baca 2009: Roger Knobel 2010: Michael Harves 2011: Leslie Eglin 2012: Herb Blisard 2013: Sue Myers 2014: Dr. Scott Peterson 2015: Kathryn Bauer Robert M Leadon Excellence in Teaching Faculty Award 1987: 1988: 1989: 1990: 1991: 1992: 1993: 1994: 1995: 1996: 1997: 1998: 1999: 2000: Dr. George Meshke Judith Kjellman Patricia Hakala, James Newbill Rudy Piñon, Millie Stenehjem Mary Patrick, Cecil Terk Paul Anderson, Peggy Keller Dr. Scott Peterson, Dr. Inga Wiehl Patti Koluda, Chuck Weedin Dr. Eric Mould, Joan Norton Dr. Bronwynne Evans Marlene Cousens Dr. Greg Gillespie Herb Blisard Kathleen Ashworth, Nicholas Parisi 2001: Mildred McBride 2002: Carolyn Calhoon-Dillahunt 2003: Beverly Parnell 2004: Dr. Susan Wedam 2005: Gordon Koestler 2006: Cheri Podruzny 2007: Pam Ferguson 2008: Leslie Eglin, Carol Schneider 2009: Audrey Wedin 2010: John DiBari 2011: Dr. Kelley DeNome 2012: Claire Carpenter 2013: Dr. Timothy Jeske 2014: Jerred Seveyka 2015: Eric Anderson Yakima Valley Community College, 2015-2016 Darlene Koch Classified Employee of the Year 1989: Ardes Metz 1990: Verna Shafer 1991: Judy Lee 1992: Janet Shaw 1993: Rachel Toney 1994: Pat Brawley 1995: Shirley Bonneville 1996: Haydee Goldenberg 1997: Brian Bordeaux 1998: Irene Stephens 1999: Chuck Cummings 2000: Linda Ison 2001: Jean Lyon 2002: Judy Morehead 2003: Sharen Uptegrove 2004: Cynthia Barwin 2005: Karen Rathjen 2006: Judi Shaw 2007: Thelma Ryder 2008: Cathy Van Winsen 2009: Jason Sterbenz 2010: Stefanie (Lea) Menard 2011: John Mertell 2012: Joaquin Macias 2013: Debbie McBride 2014: Donna Fulton 2015: De'Andre Sanders Sherrie and Daryl Parker Faculty Award 2012: Dodie Forrest 2013: Rachel Dorn 2014: Julie Swedin 2015: Martin Meister INDEX A Academic Blocks 16 Calendar 4 Code 36 Dishonesty 36 Dismissal 38 Plan 38 Probation 38 Progress Conditions 23 Progress Standards 38 Renewal Policy 39 Rules, Academic 38-46 Suspension 38 Accidents, Security 31 Accounting 63 Accreditation&Affiliations 7 Add/Drop, Registration 17 Admission 11-15 General 11 Former Students 11 Part-time Students 11 Selective Admission 11 Special Admission 12- 15 Adult Basic Skills 12,43-66 English as a Second Language 6 High School Diploma 29 Learning Centers 31 Advanced Placement Program (AP) 43 Advising 28 Advisory Committees 8 Aerospace Machining Technology 66-68 Agriculture 69-74 Alcohol & Drugs 34 Allied Health Technology 74-82 American Sign Language 147-148 Americans with Disabilities Act 34 Anthropology 83 Art 84-85 Art Gallery 29 Assistance Programs 21-22 Associated Students of YVCC 26 Astronomy 86 Athletics 27 Audit, Grade 41 Attendance 39 Automotive Service Technology 86-88 Awards, Employee 196 B Bachelor Degrees Basic Skills Biology Board of Trustees Bookstore Business Administration Business Technology C CADD Calendar, Academic Campus Closures Campus Maps Grandview 49 12, 63-66 78- 79 3 27 91-95 95-100 127-131 4 31 195 Yakima College Resources Career Connection Center Catalog Guidelines CatalogYearSpecification CertificatesofAchievement College Directory College Resources Changing Your Major Chemical Dependency Chemistry Chican@ Studies Child Care Children in College Activities Clubs & Organizations College Academic Skills College Level Exam Program (CLEP) Common Course Numbering Communication Studies Community Service Courses Computer Labs Confidentiality Grades Student Records Cooperative Education Program Counseling & Advising Center Course Challenge Course Numbering Credit Evaluation Criminal Justice D 197 194 26-33 27 34 48 61 5-6 26-33 28 100-102 102-104 104-105 27 36 26 105-106 45 62 106-107 28 27 41 39 28 28 46 62 40 108-110 Dean's List 43 Debts & Student Financial Obligations 18,37 DefinitionsandCodes 62 Degree 47-60 Associate of Applied Science 60 Associate of Applied Science, Transfer 60 Associate in Arts 51 Associate in Business 51 Associate in General Studies 54 Associate in Science - Transfer 54 Associate in Technology (SOCAD) 59 Bachelor Degree 49 Direct Transfer Agreement 53-54 Professional/Technical Degrees 60 Special Degrees 59 YVCC & Perry Technical Combined Degree 60 Dental Assisting 110-111 Dental Hygiene 111-115 Dept of Vocational Rehabilitation 24 Disability Support Services 28 Disclosure Requirements 34 Distribution List, DTA 55-57 Dormitories 32 Drama 116-117 Drama, Playmasters 33 Drug-Free Workplace Act 34 E Early Achievers Grant 24 Early Childhood Education 124-124 Easter Seals Janes’ House Child Care 27 Economics 117-118 Education 118-126 eLearning 8-9 Engineering 127-131 English 132-135 Placement Policy 132 English as a Second Language (ESL) 127 English Language Learning 147 Ethnic Studies 135-136 Evaluation of Transfer Credit 40 Evening Courses 9 Exception Petition 47 F Faculty&Staff 8 FERPA (Privacy Rights) 39 Final Exams 40 Financial Aid 21-25 Additional Sources of Assistance 24 Depart of Voc Rehab 24 Earlier Achievers 24 Opportunity Grant 24 Veterans 24 WorkFirst 24 Refund Policy 19 Special Funding, WED 25 Basic Food, Employment & Training 25 Worker Retraining 25 Financial Obligations 18,37 Fitness Center 32 Foreign Languages (Modern Languages)147-150 Foundation Scholarships, YVCC 33,180-185 G General Ed Development (GED) Geography Geology Gold Card Governance Grades Confidentiality Errors & Changes Grade Point Average Reports Symbols Transcripts Grandview Campus Grandview Student Council Grandview Activity Center Map Grants H High Demand Course Repeat Rule High School Diploma High School Equivalency Exam Hispanic Serving Institution History Honors Program Honor Roll Honors at Graduation Hopf Union Building (HUB) Housing Humanities I Incomplete Grades Yakima Valley Community College, 2015-2016 29 136 137 11,18 7,37 40 41 40 40 40 41-42 40 10 26 26 195 21 42 29 29 10 138-139 29 43 47 26 32 139-140 41 INDEX 198 Information Technology 140-144 I-BEST, Integrated Basic Education and Skill Training 24,63 Integrated Learning (Learning Communities) 9 International Baccalaureate Program (IB) 44 International Student Program 12 J Jane's House Early Learning Center 27 Larson Gallery Learning Communities Learning Options Library & Media Services Yakima Campus Grandview Campus Loans Lost & Found, Security 29 9 8 K-L M 30 30 21 31 Machine Technology, Aerospace Map Grandview Campus Yakima Campus Math Center Mathematics Media Services Medical Assisting Medical Billing & Coding Medical Interpreter Message from the President Military, Active Duty Mission Statement Modern Language Music Musical Performing Ensembles 197 196 30 144-146 30 74 75 75 3 19 7 147-150 150-152 31 No Grade, Credit/No Credit Noncompletion Nondiscrimination Nursing Nutrition 41 23 10 153-157 157 N O Online Writing Center P 66-68 32 Parking, Security 31-32 Pass/Fail Grade 41 Patient Navigation, Allied Health 79 Perry Technical & YVCC Combined Degree 60 Personnel 186-193 Pharmacy Technology 76 Phlebotomy 76 Philosophy 158 Photography 159 Physical Education 159-162 Physical Science 163 Physics 163-164 Placement Reciprocity Plagiarism Playmasters Policies Political Science Prerequisites Prior Experiential Learning President's List Privacy Rights Probation, Academic Professional/Technical Education Psychology Q-R 13 36 33 34-35 164-65 62 46 43 39 38 165 166 Radiologic Sciences 167-170 Reading 171 Reciprocity Agreement 48 Refund Policy 19 Registration 16-17 Repeating a Class 42-43 Requirements, Obtaining Information 37 Residence Halls 32 Residency Active Duty Military /National Guard 19 Washington State 19 Restricted Subject Areas for Transfer 58 Retired Senior Volunteer Program (RSVP) 31 Rights & Responsibilities 36-37 Running Start 13 S Satisfactory Progress 23 Scholarships, YVCC Foundation 33 Security 31-32,34 Senior Discount (Gold Card) 11, 18 Senior Institutions, Transfer 52 Servicemen’s Opportunity College 59 Sign Language (American Sign Language) 147-150 Smoking Policy (see Tobacco Use Policy) 35 Social Science 171 Social Security Number 35 Sociology 171-172 Spanish 147-150 Spanish for Native Speakers 147-150 SpecialDegrees&Certificates 59 SpecificationofCatalogYear 48 Speech, Communication Studies 94-95 Speech Labs 32 STARS Training 123 State Employees Tuition Waivers 18 Student Activities & Programming 26 Associated Students of YVCC (ASYVCC) 26 Clubs & Organizations 26 Code of Rights & Responsibilities 37 Financial Obligations 18,37 IdentifierNumbers 3,5 Participation in Governance 37 Student Development 172-173 Student Residence Center 32 Surgical Technology 76-77 Suspension, Academic 38 T Yakima Valley Community College, 2015-2016 Tech Prep Television/Video Production Textbook Refund/Buy-back Tobacco Use Policy Transcripts Transfer Degrees Restricted Subject Areas Transfer-back Policy TRiO Programs Trustees, Board of Tuition, Fees, and Expenses Tuition Waivers Tutoring Center U 13 173-174 27 35 40 51-57 58 52 32 3 18-20,50 18 32 Underage Student Admission Upward Bound 13-14 32 Veterans Tuition Waivers Veterinary Technology VideoPhone Video Production Vocational Rehabilitation Vocational/Technical Degrees 14, 18, 24 18 174-179 28 173-174 24 60 V W Waitlist 17 Washington National Guard Tuition Waivers 18 Washington State Need Grant Program 23 Washington State Residency 19 Weight Room 32 Wellness & Recreation 32 Withdraw, Grade 42 Withdrawal from College 17 Worker Retraining 25 WorkFirst 23,32 Workforce Education & Training Special Funding 25 Writing Center 32 X-Y-Z Yakima Campus Map YVCC & Perry Tech Combined Degree 194 60 199 Yakima Valley Community College, 2015-2016 200 Yakima Valley Community College, 2015-2016