Dehradun - The Pioneer
Transcription
Dehradun - The Pioneer
7`]]`hfd`_+ 0DXU4QY\i@Y_^UUb @A:?:@?) 8=3803>4BF4;;C>A08B4 ?>:10;>278BC0=0CD= 51,1R5HJQ877(1*5(*'1R8$'2''1 VQSUR__[S_]TQY\i`Y_^UUb H@C=5"# 78;;0AHCAD<?E8ACD0;;H C8438==4F?>;;B 4bcPQ[XbWTS '%# ?dQ[XbWTS5a^\ 34;78;D2:=>F 17>?0; 17D10=4BF0A A0=278A08?DA 270=3860A7347A03D= DA@CE"& BD?4ABC0ABC> C74A4B2D4 347A03D=5A830HB4?C4<14A k %! %*?064B %C! ;PcT2Xch E^[ 8bbdT !$% 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T m @??:185745µC >5HDD5<E7E 69<=39 !#F9F139DI fffSPX[h_X^]TTaR^\ ?VhehZdeZ_FA¶d XR^V`WeYc`_Vd 0ZWX[TbWX]Ud[[ R^\\P]S*d]R[T BWXe_P[`dXcbPb <X]XbcTa_^bc ^U_Pach_aTbXST]c ?8>=44A=4FBB4AE824Q =4F34;78 CF>68A;B60=6A0?43 8=0<0=E870A !013D2C438=380=B8= ;81H05A443)BDB7<0 08b_aTPSX]VXcbfX]Vbc^ cP_]Tf^__^acd]XcXTb T <08=C08=?4024B2 C4;;B:0A=0C0:0C= =Tf3T[WX) CWTBd_aT\T2^dac ^]CWdabSPhb[P\\TScWTCP\X[ =PSdP]S:Pa]PcPZP 6^eTa]\T]cbU^acWTXaUPX[daTc^ bc^__T^_[TUa^\cPZX]Vc^cWT PVXcPcX^]PUcTaXcb^aSTa^]cWT 2PdeTahaXeTafPcTabWPaX]VP]S bPXSXcW^_TSQ^cWBcPcTbfX[[ \PX]cPX]_TPRTP]SaTb_TRcU^a [Pf01T]RW^U9dbcXRT3X_PZ <XbaPP]S9dbcXRTDD;P[XcbPXS bWdcS^f]bP]SPVXcPcX^]bR^d[S ]^cQTP[[^fTS_dabdP]cc^cWT P_TgR^dac^aSTab =Tf3T[WX) Cf^VXa[b &P]S ' hTPab^[SfTaTP[[TVTS[h VP]VaP_TSQhUXeTh^dcWfWX[T cWThfTaTbXccX]V^]PQT]RWX]P _PaZfXcWcWTXa\P[TUaXT]SbX] >dcTa3T[WXb0\P]EXWPaX]cWT fTTW^dab^UCWdabSPh =Tf3T[WX) Cf^8]SXP]cTPRWTab fW^fTaTPQSdRcTSX];XQhP^eTa PhTPaPV^WPeTQTT]aT[TPbTS 4gcTa]P[0UUPXab<X]XbcTaBdbW\P BfPaPYbPXS^]CWdabSPh°8P\ WP__hc^X]U^a\cWPcC6^_P[P ZaXbW]PP]S21P[PaP\:XbWP] fW^fTaTRP_cXeTX];XQhPbX]RT 9d[h!(! $WPeTQTT] aTbRdTS±cWT<X]XbcTacfTTcTS he national Capital on T Thursday continued to reel under vector-borne diseases outbreak with dengue claiming nine more lives at All India Institute of Medical Sciences (AIIMS) and one succumbing to complications triggered by chikungunya at the Sir Ganga Ram Hospital. With the reports of more fatalities from vector borne diseases, death toll from dengue rose to 18 and number of patients died of chikunguyna climbed to 12 even as number of affected people crossed 2,800. JD Madan, 75, from South Delhi died of chikungunya complications at Sir Ganga B?[TPSTaBWXe_P[HPSPePaaXeTbPc2W^fSWdah2WPaP]BX]VW0Xa_^acX];dRZ]^f^]CWdabSPh ?C8 Ram Hospital on Thursday morning. He was the fifth Mulayam Singh Yadav at his res- Delhi, but Akhilesh chose to In another development, chikungunya patient to have idence — 5 Vikramaditya Marg remain in Lucknow. two senior Ministers in the lost life at the hospital in the last — and from there he drove to It is expected that Akhilesh Akhilesh Government, Balram four days. 5 Kalidas Marg — the official and Mulayam might have dis- Yadav and Awdhesh Prasad, “JD Madan, a resident of residence of the Chief Minister. cussed the ‘family feud’ over have refused to take charge of Kalkaji, was admitted on Mulayam, who is caught ‘family dinner’ on Thursday new portfolios. They were August 12 night with combetween his son and brother, night. The two share the same given departments which were plaints of fever and chills along stepped in to defuse the crisis residence in Lucknow. previously headed by Shivpal. with swelling and rashes on and reached Lucknow a day Sources said it was The crisis was precipitated body. He was also a patient of earlier than his scheduled Mulayam who persuaded after Akhilesh sacked Ministers chronic myeloid monocytic arrival on Friday. Sources in the Shivpal to meet Akhilesh Yadav Gayatri Prasad Prajapati and leukemia. He had acute febrile party say that Mulayam had to break the ice between chacha Raj Kishore Singh on Monday illness and was tested positive summoned both Shivpal Singh and bhatija. “The meeting and then removed Chief for chikungunya by rapid PCR Yadav and Akhilesh to New between them was short — just Secretary Deepak Singhal the test, and died at 6.45 am of Delhi on Wednesday. Shivpal, for 13 minutes to be precise,” a following day. chikungunya sepsis with septic who was in Etawah did reach source said. shock and cardio-pulmonary =PcX^]P[RPaaXTac^PSS$PXaRaPUcc^Xcb U[TTcV^X]U^a²cTaaXc^aXP[Tg_P]bX^] 0;;>=1>0A30="! ³?A4BD<433403)805 =Tf3T[WX) CWT!(_T^_[T^] Q^PaScWT0="!_[P]TcWPcfT]c \XbbX]V^eTacWT1Ph^U1T]VP[ ^]9d[h!!WPeTQTT]°_aTbd\TS STPS±P]ScWTXaUP\X[XTb X]U^a\TS8]SPX]0Xa5^aRT ^UUXRXP[bbPXS^]CWdabSPh 4<1A04A340;) 218 4G0<8=8=6<8=A4@D4BC =Tf3T[WX) CWT218^]CWdabSPh bPXSXcfPbTgP\X]X]VcWT 3TUT]RT<X]XbcahaT`dTbcc^ _a^QTP[[TVPcX^]b^UZXRZQPRZbX] cWT_daRWPbT^UcWaTT4\QaPTa PXaRaPUcX]P!'\X[[X^]STP[ SdaX]VD?0ad[TX]!' A5AdXZR_e \Z]]Vc<RccR bfZedaRcej=D <>78C:0=370A8Q 90<<D ne of the founding members of Peoples Democratic Party (PDP) and sitting Member of Parliament from Srinagar Parliamentary constituency, Tariq Hameed Karra, often labelled as ‘giant killer’ ever since he defeated National Conference patriarch Dr Farooq Abdullah in 2014 Lok Sabha polls, Thursday dealt a body blow to the Mehbooba Mufti-led alliance Government in the State by announcing his resignation from the primary membership of the party and the Parliament. “I am resigning from the membership of Parliament and the primary membership of the PDP against the brutal policies of the BJP at the Centre and State Governments complete sell-out and surrender before them,” he told reporters here. Detailed report on P6 O 344?0::D<0A970Q =4F34;78 yeing the higher class rail E passengers, national carrier Air India (AI) has decided to add over 50 aircraft to its fleet during the next year. The AI plans to start leasing aircraft every month from next year January onward. Chairman-cum-Managing 5VReYe`]]Wc`^ UV_XfVcZdVde`") TYZ\f_Xf_jRe`"# BC055A4?>AC4AQ =4F34;78 he crisis in the Samajwadi Party chief Mulayam Singh Yadav’s political pariwar took an interesting turn on Thursday night when his brother Shivpal Singh Yadav resigned both from the Cabinet Minister and State party president posts. Shivpal submitted his resignation from both the posts after a brief meeting with Chief Minister Akhilesh Yadav. The development shows that Akhilesh has taken full command of the Government and is not ready to be seen as being around by his chachas anymore. Shivpal resigned reportedly after Akhilesh refused to return his plum portfolios despite Mulayam’s advice. Earlier, Akhilesh Yadav and Shivpal held a one-on-one meeting here on Thursday evening. The meeting lasted for just 15 minutes after which Shivpal drove to his residence, a senior leader told The Pioneer. Both Akhilesh and Shivpal are in the centre of the raging feud. Their meeting is expected to achieve the breakthrough that could be formalised by Mulayam during the next couple of days. Earlier, Shivpal held an hour-long meeting with 20?BD;4 'HQJXHUDFHVDJDLQVW FKLNXQJXQ\DFODLPV Director (CMD) Ashwani Lohani, who completed one year at the helm recently, said on Thursday that after registering operational profit zone for the first time in two decades, the Air India will go in for 'territorial expansion'. Lohani told The Pioneer that new aircraft like A320, Dreamliners, and ATRs will be added on lease almost every month beginning January 2017. The national carrier has decided to go for leasing of the aircraft for financial viability. For the domestic market, the airline will also get 10 more ATR-72 by the end of March 2017. By mid-2018, the total numbers of ATRs will be 43. AI Express, which currently has 17 Boeing 737s, will get 18 more similar Boeings. Lohani said that in its 'territorial expansion' mode, the AI will focus on Tier-II and Tier III cities with an innovative network titled "Garland Route" where even private carrier are not present. Garland Route for instance will connect Guwahati to Delhi via Kolkatta, Raipur, Bhopal, Indore, Jaipur and vice versa, he said, adding the AI believes that smaller but significant cities like Surat, Chandigarh, Indore, Nashik, Jaipur, Bhopal, Jabalpur, Nagpur, Vijyawada and others will become businesses hubs. crucial for their hunting, resting as well as for breeding in the Arctic region, a study has found. According to scientists, the Arctic is warming at nearly double the global rate as a result of climate change fuelled by mankind's burning of fossil fuels, a process that emits heat-trapping greenhouse gases. The rising temperatures have resulted in ice melting earlier in spring and re-freezing later in the autumn. Satellite data revealed that the total number of ice-covered days across the 19 regions declined at a rate of seven to 19-days per decade from 1979 to 2014, the researchers said. "Polar bears' dependence on sea ice means that climate warming poses the single-most important threat to their persistence," said Harry Stern from the Polar Science Centre at University of Washington. The bears, which have become emblematic of the ravages of global warming, spend most of their time on sheets of frozen ocean water, which melt and recede in warmer months, and then re-form in the winter. When the ice melts, the animals come ashore and survive on stored fat Till Tuesday, at least nine deaths due to dengue were reported this year in the national Capital, though the South Delhi Municipal Corporation (SDMC) which compiles the report on vector-borne diseases has maintained the death toll at four. AIIMS is getting several suspected dengue patients everyday in its fever clinics, though less number are showing confirmed cases compared to chikungunya for which 1,440 blood samples have tested positive till September 13. At least 1,158 cases of dengue have been reported in the national Capital with nearly 390 of them being recorded in the first 10 days of September, the month in which the vector-borne disease begins to peak. ?C8Q =4F34;78 he proposal for the Union T Budget’s overhaul, including merging the Railway 4gcTa]P[0UUPXab<X]XbcTaBdbW\PBfPaPYaTRTXeTb?aX\T<X]XbcTa^U=T_P[?dbW_P:P\P[3PWP[?aPRWP]SP^]WXbPaaXeP[Pc868 0Xa_^acC"X]=Tf3T[WX^]CWdabSPh ?C8 :LWKWKH$UFWLFZDUPLQJ DWQHDUO\GRXEOHWKH JOREDOUDWHDVDUHVXOWRI FOLPDWHFKDQJH3RODU %HDUVDUHLQFUHDVLQJO\ ORVLQJOLIHVXVWDLQLQJVHD LFHFUXFLDOIRUWKHLU KXQWLQJUHVWLQJDVZHOO DVIRUEUHHGLQJD VWXG\KDVIRXQG olar bears, whose global population P is estimated at nearly 25,000, are increasingly losing life-sustaining sea ice arrest,” said a statement issued by Ganga Ram Hospital. AIIMS had confirmed one suspected case on Wednesday. The victim, an old man from Muzaffarnagar, had died earlier this month of multi-organ failure triggered by chikungunya. In a report released on Thursday on vector-borne disease cases at AIIMS, the doctors said, “Nine dengue patients have died from September 1 till date.” A top AIIMS official had on Wednesday confirmed five deaths, which were earlier suspected to have taken place due to dengue. “A total of 96 patients were admitted to AIIMS, out of which 56 have been discharged. Among the patients, 70 per cent belonged to Uttar Pradesh, 10 per cent to Bihar and rest to Delhi,” the report said. 2PQX]Tcc^cPZTd_ 1dSVTcaTeP\_* PSeP]RTFX]cTa BTbbX^]c^PXS 6BCa^[[^dc 5HGXFLQJVHDLFHOHDYHV 3RODU%HDUVRXWLQFROG 80=B Q =4FH>A: 0\P]RPaaXTbPQ^hc^PR[X]XRTb_TRXP[[hbTcd_c^RPcTac^cW^bTbdUUTaX]VUa^\ UTeTa^]T^UcWT\PX]bh\_c^\b^UbTeTaP[\^b`dXc^Q^a]TSXbTPbTbPcAP\ <P]^WPa;^WXP7^b_XcP[X]=Tf3T[WX^]CWdabSPh 0? until it re-freezes, a period that for some has become longer and longer. With longer iceless periods, polar bears have to swim further and further to find solid ground, the study noted. The bears need sea ice for hunting as they cannot outswim seals, their preferred prey. They get around these by waiting near holes in the ice and ambushing the seals as they come up for air. Budget with it and pre-poning the date of its presentation to January-end, will be taken up by the Cabinet next week, while the Budget Session may be advanced by a month to January 24 to get the supporting legislations for the GST rollout approved early. Early presentation of the Budget will ensure that all legislative work is completed before the beginning of the new fiscal, from April, and funds allocated to various Ministries start flowing in from the first quarter. While early convening of the Budget Session may become a norm in the years to come, the Winter Session of Parliament is likely to be convened on November 11 this year. :EcRZUdageVUfTReZ`_R] Z_deZefeVZ_5VYcRUf_ ?=BQ 347A03D= cting on a tip-off on tax evasion, teams of Income Tax Department conducted raids on Thursday on a private educational institute — Baluni Classes, a premier institute in Dehradun that is engaged in teaching engineering and medical aspirants. IT officials also raided the premises of the same institute at Roorkee. The information of the IT officials conducting raids on one private educational institute of the city left the owners of other such Dehradun-based educational institutes panicky. It is learnt that the administration deployed policemen after the I-T officials sought them for security. They sealed the institute, allowing no one to get in as long as the raids were on. However, they remained tight-lipped regarding the details of the raids. The teams questioned the institute’s officials, it is learnt. It is also learnt that the raids were part of the initiatives taken by the IT department on the basis of the A 8C^UUXRXP[bP[b^aPXSTScWT _aT\XbTb^UcWTbP\T X]bcXcdcTPcA^^aZTT complainants received to stop Income Tax evasion by the private institutes. The IT officials reached the Nehru Colony –based institute at 8.30 am on Thursday. Students were in the classes when IT officials arrived. They sealed the office and sought account-related documents from the officials concerned. Officials reviewed the documents for many hours while sitting in the institute. It is learnt that IT officials seized finance-related documents from the institute. The Finance Ministry is overhauling the Budget-making exercise which may see scrapping of the current practice of presenting a separate budget for the Railways as well as shifting to multi-year outcome-based budgeting, sources said. Till now the Budget Session was convened in the third or fourth week of February, and the Union Budget presented on last day of the month. This led to the legislative approvals taking place in two phases spread between February and May. dccPaPZWP]S! 347A03D=k5A830H kB4?C4<14A %! % 8`geeVRTYVcddecZ\VT`_eZ_fVd ?=BQ 347A03D= ith talks failing to make any headway, the strike of W the lecturer and lecturer Teachers (LTs) of Government schools of State continued on Thursday. However it is learnt that the teachers could take an important decision on their strike after meeting Chief Minister Harish Rawat on Friday. The Lecturer and LTs of the Government schools of State Government under the banner of their organisation, Rajkeeya Shikshak Sangh (RSS) are on strike from Monday. The efforts of the state government to break the strike have failed to yield any result. A delegation of teachers was again invited for talks by the government on Thursday night. This meeting too proved a failure. The general secretary of the organization Sohan Singh Majila said that strike of the teachers would continue. Meanwhile the President of the organisation Ram Singh Chauhan and Divisional secretary of Garhwal Shiv Singh Negi who were sitting on an indefinite hunger strike, were lifted by the police on late Wednesday night when their condition deteriorated. In their place Sunder Kunwar and Dr Kannu Joshi sat on the hunger strike. The teachers continued their protests at the offices of Block and District Education Officers in different parts of the CWTcTPRWTabR^]cX]dTScWTXa_a^cTbcbPccWT ^UUXRTb^U1[^RZP]S3XbcaXRc4SdRPcX^]>UUXRTabX] SXUUTaT]c_Pacb^UcWTBcPcTCWTbcaXZT^UPQ^dc !$cTPRWTabWPbPSeTabT[hPUUTRcTSbcdSXTbX] !"6^eTa]\T]cWXVWbRW^^[b P]SX]cTabR^[[TVTb^UBcPcT State. The strike of about 25,000 teachers has adversely affected studies in 2,300 Government high schools and inters colleges of State. On Thursday, the Government accepted one of the demands of striking teachers when it ordered appointment of selected candidates of BRP and CRP examination in the vacant posts. One of leaders of RSS, K K Dimri however said that only partial demand of the organization is accepted by the government. He said that the teachers are now determined to continue their agitation till the GO for all their demands is released. The striking teachers are demanding three days earned leave, increase in grade pays, assured career progression, regular annual transfers, a transparent transfer act, payment of better travel allowance and immediate appointment of selected candidates of BRP and CRP examinations. The President of newly constituted Uttarakhand Raksha Morcha, V K Bahuguna has appealed the teachers to take back their strike in the interests of students. In a statement he said that the morcha fully supports all the legitimate and genuine demands of teachers. Bahuguna called upon the state chief minister to immediately intervene in this matter. 2<X]PdVdaPcTbFXUXbTaeXRTbU^a=PX]XcP[ 7`c^Vc22A T`_gV_Vc ?=BQ 347A03D= Chief Minister Harish Rawat Uttarakhand formally inaugurated Wifi services for Nainital through video conferencing held at Bijapur Guest House on Thursday. He fur ther announced that such facility would be commissioned in Mussoorie to be followed by R ajbhawan and Chief Minister’s residence. As per the scheme, the users will be given first 20 minutes free and thereafter, they will pay as per the rate. Congratulating the people of Nainital and those visiting the lake city as tourists, CM stated that Wifi is a need of the present time. State Government is constantly making efforts to extend the services to as many areas as possible, he said. State government has set target to provide Wifi services in all the 13 district headquarters, major shrines and tourist spots, CM said, adding that the budget would be provided for the purpose. Talking to The Pioneer, secretary Deepak Gairola said they had identified 84 points across all the 13 districts of the state where such service would be installed. ?RfeZjR]W`c^d _VhaRcej ?=BQ 347A03D= ormer State convener of Aam F Adami Party (AAP) Anoop Nautiyal, who resigned from the party along with large number of his supporters, has announced formation of a new political forum, Hamara Uttarakhand jan Manch (HUM) on Thursday. Addressing newsmen, Nautiyal said that central leadership of AAP disappointed the people of the State as it failed to react on any issue raised by the State’s workers. He said that the decision of the AAP not to contest assembly elections shocked the party workers who were enthused by the success of ‘Uttarakhand Bachao Yatra’. Nautiyal further said that the party in the state was ruined by 15 member Prabhari Mandal of AAP in which the leaders of Delhi held sway. He said that it appears that AAP is not interested to confront Congress party for now so it overlooked the misdeeds and corruption of ruling congress in Uttarakhand. The former state convener of AAP said that new forum ‘ HUM’ is launched to fight corruption in Uttarakhand. He said that there is no immediate plan to launch a political party but added that the forum could support some candidates in the ensuing assembly elections. Former State treasurer of AAP Ranvir Chaudhary said that the large number of AAP workers in different parts of state would join HUM in coming days. He claimed that a group of selfish leaders is calling shots in AAP and these leaders would eventually throw Arvind Kejriwal out of the party. Nautiyal has been appointed as patron of HUM while Ranvir Choudhary would be its state convener. AAP leaders Kamal Devradi, Onkar Bhatia, Sameer Mundepi, Abdul Rehman, Bhaskar Chug, Ganesh Kala, Manoj Choudhary and large number of party workers also resigned from the party and joined the new forum. BcPcTa^PSfPhbPS\X] fPa]bPRcX^]PVPX]bc P]hbcaXZTf^aZQ^hR^cc ?=BQ 347A03D= he administration of Uttarakhand roadways has T warned that strict disciplinary action would be initiated against any strike and work boycott. The Uttaranchal Roadways Karamchari Union (URKU) has given a work boycott call for three days commencing from Friday. The URKU has a major presence among the drivers and conductors of roadways and the three day strike call is sure to affect the operation of buses of state transport career. The MD of Uttarakhand Transport Corporation, Brijesh Kumar Sant told The Pioneer that a notice is issued to the association for taking back its work boycott call. He said that appropriate and harsh action would be taken against those participating in the work boycott call. The divisional Secretary of the URKU, K P Singh said that talks with the authorities proved inconclusive and members of the association are determined about the work boycott. “We have informed the management about our plans of work boycott from September 16 to 19. Our organisation has more than 3500 members and most of them are drivers and conductors and all of them would not work on these three days,’’ he said. The URKU is agitated over the fact that the MD of roadways has categorized the contractual workers of the roadways as workers of the outsource agency. It is significant as the cabinet sub committee had recently recommended that all contractual workers working for more than five years would be regularized. There are more than 2000 contractual/ outsource workers in the roadways most of which are drivers and conductors. The state roadways have a fleet of about 1250 buses and more than 1.40 passengers use these buses daily. 3Ydi@Qdb_\E^Ydd_ RUUhdU^TUTd_ dXbUU]_bUSYdYUc ?=BQ 347A03D= ity Patrol Unit (CPU) would be extended to three C more cities — Kashipur, Rudrapur and Roorkee — in the State to control traffic. The unit is presently working in three cities — Dehradun, Haridwar and Haldwani. Speaking of the extension of the unit to new cities across the State, DGP MA Ganapathy said on Thursday that it would go a long way in easing traffic congestion. Besides, he said that the police officers should enhance their skills to cope with the changing pattern of crimes with the criminals becoming tech-savvy. He further said that a training institute for police officers will come up in Dehradun soon to enhance their skills to deal with cyber- related cases. While addressing a police seminar in Haldwani, Ganapathy stressed on qualitative improvement of the investigations. Kumaon DIG Ajay Ratula and Nainital SSP Sweety Aggarwal were also present. DGP said that those to be deployed in Kashipur, Rudrapur and Roorkee are being trained in Dehradun. “They would be sent soon as the training is nearing completion,” he said, adding that the funds recently released by the state government for the police department would help them go for some infrastructural overhaul. He further said that in view of upcoming Assembly election, list of the police officers who have been working at a place for three years, is being prepared. “They would be transferred once list is prepared,” the state’s top cop said. The senior cop while addressing the seminar expressed concern over illegal mining going on unabated in some parts of the state. They said they must be more alert to stamp out the menace. What is more, vigilance department officers would soon submit a report on the policemen facilitating illegal mining activities. Based on the report, action would be taken against the errant cops. <RdYZafccVgV_fV `WWZTVcYV]UW`c RTTVaeZ_XScZSV ?=BQ 347A03D= vigilance team has arrested Kashipur assistant A land consolidation officer Jaiveer Singh Chauhan on Thursday on the charge of accepting a bribe of C15,000 from a complainant. The accused had allegedly sought the bribe from the complainant against mutation regarding a land. Earlier, the complainant registered a complaint in Vigilance Haldwani sector. He stated in his written complaint that the matter related to a plot of land (3.471 hectares) remaining in his grandmother’s name at Takiya in Kashipur. As per the complaint, her grandmother had made a will, giving the land to her four grandsons in 2001. Registry of the land executed in 2001, his grandmother died in June 2016. The complainant said he had approached the assistant land consolidation officer Chauhan to have mutation of the land done with all necessary documents in July this year. However, Chauhan allegedly demanded Rs 15, 000 to have the mutation done. The complainant said he had received the same treatment whenever he approached the officer. With things remaining the same, the complainant decided to throw the bait of bribe to have him exposed. Accordingly, he agreed to pay the bribe. The date and place were fixed. Meanwhile, he approached Haldwani sector vigilance and registered a compliant over the same. Subsequently, Chauhan was caught red-handed while taking the bribe at his office in Kashipur by the vigilance team on Thursday. A case under appropriate sections of Prevention of Corruption Act, 1988 was registered against the accused in Dehradun sector vigilance. Ashok Kumar, director (vigilance), announced reward for the team members led by vigilance Haldwani sector for cracking the case. ADGP Kumar said that in order to check corruption in the state, a toll free number – 1800-180-6666 has been set up and it is available for the people. People can also register complaint on What’s App number- 9456592300 if any government officials demand bribe against the works to be done, he added. CaPX]TT^UUXRTabP[[_aPXbTU^a _^[XRT\P]^UcWT\^]cWPfPaS ?=BQ 347A03D= he trainee police officers from Assam, Manipur, T Meghalaya and Arunachal Pradesh who are now in Uttarakhand under Bharat Darshan Programme are all praise for the award ‘policeman of the month’ being given to the police personnel in Garhwal Range in recognition of their works, taking the daunting challenges head-on. A trainee Hemanta Saikia said that such awards motivate the police personnel to give their best. The trainees also appreciated CCTV cameras being installed in many places across Dehradun, helping police to crack the crimes. Saikia further said that the concept of community policing had caught his imagination. “I feel that community policing can make policing more effective. Uttarakhand is a peaceful state unlike Assam. But I think that CaPX]TT_^[XRT^UUXRTabUa^\ePaX^db8]SXP]BcPcTbPccWT?7@X]3TWaPSd] introduction of community policing in Assam would help the northeastern state combat the crimes better,” he said. He said that they had an interactive session with DGP MA Ganapathy on Wednesday at Police Headquarters during which various issues of making police more effective cropped up. Runa Neog, a lady trainee, also praised the policeman of the month award, saying that it boosted the morale of the policeman, inspiring them to do more for the people. . IG (training) PVK Prasad who interacted with the trainees said that twenty eight police officers, including seven women police officers, of the rank of deputy superintendent of police ?X^]TTa_W^c^ from Assam, Manipur, Meghalaya and Arunachal Pradesh, are now touring the state under Bharat Darshan Programme. Out of 28, six trainees are having engineering back ground, two are from medical background and 20 are post graduates, he said. Trainees visited IMA campus on Thursday morning. They would visit intelligence headquarters and police control rooms in Dehradun, Mussoorie, Rishikesh and Haridwar. Pavan Kumar Sharma, deputy assistant director (police science), who has been accompanying the trainees, said that they are receiving warm welcome from police headquarters they are visiting. $OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\ GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWVVHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV 3ULQWHGDQGSXEOLVKHGE\$MLW6LQKDIRUDQGRQEHKDOIRI&0<.3ULQWHFK/WG))5DMSXU5RDG'HKUDGXQ0RE7HOHID[DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG6KHG1R&3DWHO1DJDU&R2SHUDWLYH,QGXVWULDO$UHD'HKUDGXQ8WWDUDNKDQG(GLWRU&KDQGDQ0LWUD$,5685&+$5*(RI 5H(DVW&DOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL$KPHGDEDG6RXWK%DQJDORUH&KHQQDL&HQWUDO.KDMXUDKR'HOKL 7HOHSKRQHV)D[/XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJ&HQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV dccPaPZWP]S" 347A03D=k5A830H kB4?C4<14A %! % 5V_XfVTRdVdTc`dd)!!^Rc\Z_5``_ ']TfRPbTb aT_^acTS^] CWdabSPhP[^]T ?=B Q 347A03D= he number of dengue affected people in the T State Capital jumped over 800 with the district health department reporting 18 more cases on Thursday. The number of dengue cases in Dehradun district jumped to 809 on the day. The Assistant director Communicable diseases, Dr Pankaj Kumar Singh said that the 911 people in the State have been found positive for the disease so far. He informed that 59 and 30 cases of the disease have been reported so far from Haridwar and Nainital districts. A health department report informs that 25 dengue patients are admitted in the isolation ward of dengue in the associated hospital of Government Doon Medical College (GDMC). In the Government hospital Roorkee in Haridwar district, 10 dengue patients are undergoing treatment. With the patient of Dengue continue to swell the private hospitals and labs are reaping a windfall. These labs are charging an amount of C1,800-2,000 for one rapid test 5^daadaP[WPPcbc^ R^\Td_X]BcPcT ?=B Q 347A03D= hief Minister Harish Rawat’s media in-charge C Surendra Kumar said on Thursday that four rural haats — one each in Pithoragarh, Derhadun, Bhimtaal and Kashipur — will come up in the State. These haats will be developed by SIIDCUL, he further revealed. Reacting sharply to the State BJP demanding a white paper on the disaster 2013, Kumar said that the scamtainted saffron leaders raising hue and cry over the disaster made no sense. “They are themselves involved in disaster scams. The same band of leaders are now crying wolf. Instead of demanding white paper, the party should introspect. They have now taken the scamtainted leaders in their warm embrace. They seem to have forgotten that they served memorandum to the President, demanding actions against them. They named them kings of scams,” Kumar said, pointing fingers at the former Congress leaders who switched to BJP without naming them. He further said that the state government feels no need to issue a white paper on the disaster 2013. “The important fact is that around 12 lakh pilgrims have so far visited the char dhams. These figures are enough to make clear the pains the state government has taken to revamp the disaster-ravaged places. The huge footfalls are possible because we have made roads better and are able to provide the required facilities to the pilgrims,” the close aide to the CM claimed. Speaking volume of the works the Chief Minister Harish Rawat has done for the state, he said that sure of defeat at the next hustings, the BJP leaders are concocting cock and bull stories. Relying to the allegation made by the BJP national spokesperson saying that one lakh fake voters have sneaked their way into the electoral list, Kumar said it is sans any foundation. “The election commission organises campaign to add new voters and delete fake voters online. Instead of going for such baseless allegation to the media, the BJP leaders should approach the election commission and lodge complaint,” Kumar said. ( _T^_[TX]cWTBcPcT WPeTQTT]U^d]S_^bXcXeT U^acWTSXbTPbTb^UPa 0Q^dc$(P]S" RPbTb^UcWTSXbTPbT WPeTQTT]aT_^acTS b^UPaUa^\7PaXSfPaP]S =PX]XcP[SXbcaXRcb of dengue. The dengue scare among people has given these doctors and labs a chance to make a hole in the pockets of 6>EC20?B34=6D4C4BC?A824B Taking cognisance of the open loot of the private labs in name of dengue test, the Government fixed the rates of rapid and ELIZA tests on Thursday. The Municipal Commissioner, of Dehradun Municipal Corporation (DMC) Nitin Bhadoria said that a meeting of representatives of Indian Medical Association (IMA), Chief Medical Superintendents (CMS) and Chief Medical Officer (CMO) was convened in DMC on Thursday in which it was decided that the labs should not charge more than C1,000 for rapid test and C800 for ELISA test. He said that the district administration of Dehradun has constituted two flying squads headed by officers of SDM rank officer to keep an eye on private labs. the common people. The Medical Superintendent (MS) of the associated hospital of GDMC, Dr KK Tamta informed that one kit of rapid test comes with a price tag of C1,900 and ten tests can be done with this kit. “The private labs are charging ten times of the cost from the patients which is most unfortunate,’’ he said. On Thursday the Mayor of Dehradun Vinod Chamoli convened a meeting of the owners of private labs and district health department. A`]]aR_V]e`Y`]UDeReVV]VTe`cR]^RY`edRgZ_@Te ?=B Q 347A03D= o enthuse the voters, particT ularly the young ones, into exercising their franchise for the upcoming Assembly election, the Election Commission would go for State electoral mahotsav2016 in October, said Chief Electoral Officer Radha Raturi. She convened a meeting with the officials in the secretariat on Thursday to review the preparation being made for the election. She said that the youngsters who have completed 18 years will be included into electoral list with this special campaign. The three-daylong State electoral mahotsav will be organised in CWTR^\\XbbX^]f^d[SP[b^^aVP]XbT T[TRcX^]bcP[[bP[^]VfXcWU^^SR^dacbP]S WP]S[^^\TgWXQXcX^]bc^bT]bXcXbT_T^_[T Dehradun and each district would participate. To gather people in large number, EC will organise painting and debate competitions in the schools and the colleges across the State. The winners will be felicitated during the mahotsav. As per the awareness programme schedule, the commission would appoint ambassadors in colleges and univer- sities so as to encourage them into gathering their friends in the awareness campaign. Besides, to sensitise the media, the commission would organise workshops and debates for the journalists. Moreover, the commission would organise election stalls along with food courts and handloom exhibitions. The commission would make use of social media and community 5>T`_gV_Vd^VVeRYVRU`WAcVkgZdZe ?=B Q 347A03D= n view of President Pranab Mukherjee’s scheduled IUttarakhand visit from September 27 to September 30, Dehradun DM Ravinath Raman chaired a meeting with the district officers on Thursday during which he instructed the officials to complete arrangements related to the same. President Mukherjee is proposed visit Kedarnath, Rajbhawan and Harki-Pauri, Haridwar during the time he would be in the state. All the department officers were directed to complete their assigned works by September 20. No agencies or departments will be allowed to dig roads in Dehradun city, Rishikesh and Haridwar between September 25 and September 30. Action will be taken against the errant officers, state government officials said. National Highway, Public Works Department, MDDA, Municipal Corporation officers were directed to submit reports regarding the visit to DM office and protocol department. Dehradun DM stressed on works like repair of roads, installing speed breakers and sign boards being completed in time. Protocol officer was directed to write to BSNL officials with the direction to make arrangements of computer, fax, hotline and others at Jolly Grant Airport, GTC, Helipad, Raj Bhawan and Aashiyana. The power officers were directed to repair all electricity poles from Jolly Grant to Ashiyana, Dehradun. No wires should be found hanging from the electricity poles at the above places. Damaged electricity pole should be replaced with new one within stipulated time frame. radio for the purpose. E arlier, the Election Commission had organised such mahotsavs at the central level. This is the first time such gatherings are being organised at State level. The initiative was taken by CEO Raturi, commission sources said. The meeting was attended by additional secretary higher education Ranjit Sinha, addition chief electoral officer SA Murugeshan, additional secretary Ranjana Kumari, additional secretar y Manoj Chandran, joint director industry Kaushalya Bandhu and special executive officer Mastu Das among others. 34>17>><8380AH BD=8;:D<0A (QLJPDWLF¶*XUX· person who has earned the sobriquet 'Guru', boasts that the most powerful man of the State acts at his bidding and A once he turns his face away from him the boss would lose power. Given his uncanny power over the man who runs the show, the Guru managed to be appointed as vice-president of a board with no norm being followed. When the department officials dare ask him about his field of expertise he snubs them, saying that he is no less than the king maker. When asked where he stays, he brags that he is staying in Bijapur guest house. Unhappy with being provided with 160 liters of fuel per month, the Guru asked the district administration to have the departmental vehicle he has been availing surrendered and to provide him with C40,000 per month as per the Government norms. Now, he is out to have an IAS close to him appointed as a secretary in the department he is literally running courtesy his being the king maker. The corridors of the Babudom are now abuzz with stories of the enigmatic figure who is casting his charm everywhere. ,PSRUWDQFHRIORRNLQJ\RXQJ wake of the BJP top brass deciding to impose bar on Iinnthethetheleaders crossing 75 years from holding important posts party as well as the Governments it leads, a State party leader has recently gone abroad to have hair transplantation to cover his bald head. The objective is clear. He is keen on looking energetic to fox the leadership in not axing his name from the nomination list for the upcoming Assembly election. To impress the leadership that he is still looking youthful, he has circulated his photos after his bald head was duly covered with transplanted hair. However, a question crops up. Would the saffron brass choose to implement its newly introduced age- norm for the crucial Assembly election barely a few months away? In case it is serious on the matter the state party's campaign is likely to lose steam. For, the leader who has the mettle in him to prove a match for immensely resourceful Harish Rawat would be nowhere in the battle as he has well crossed past the age bar. If the party high command proves lenient the leader with newmade hair stands a chance to receive dividends for the pains he has taken to look young. 3\QccUcY^^Ug4__^ =UTYSQ\3_\\UWURUWY^ 9Z_UZW`ce_ZXYe T`_T]fUVd 3Te^cTTbX\\TabTXS^[^U;^aS6P]TbWPX]C^]baXeTaPcCP_ZTbWfPacT\_[T3TWaPSd]^]CWdabSPh ?aPbWP]c1PS^]Xk?X^]TTa Dehradun: The Canara Bank, Dehradun circle marked the conclusion of Hindi fortnight by organising a Hindi Diwas programme. The bank’s regional head AR Agrawal and Uttarakhand Sanskrit Vishwavidhyalaya Vice Chancellor professor Piyosh Kant Deekshit and Dinesh Chandra Ramola, the head of Hindi and Bhasha Vigyan department of the university were among those present on the occasion. Agrawal spoke of the progress made in Hindi in the banks functioning while also informing about the works being conducted by the bank in Hindi. He exhorted all employees to try and use the Hindi language as much as possible in the official works. Deekshit spoke of the historical aspect of Hindi appreciating its aspects of simplicity and accessibility compared to other languages. PNS ?=B Q 347A03D= fter the chaos witnessed a A day earlier, things settled down on Thursday at the Government Doon Medical College. The first batch of MBBS student of the newly setup college had their first class on the day. The Principal of the college, Dr Pradip Bharati Gupta took a session with the students in which he explained curriculum of their studies. He also elaborated on qualities of a good doctor. An introductory session was held in which the faculty members were introduced with the students. Later talking to The Pioneer, Dr Gupta said that college has made all necessary preparation for the smooth functioning of academic and other activities. He informed that students are taught subjects of Anatomy, Physiology and Biochemistry in I year MBBS course. “We have four senior faculty members each for Anatomy and Physiology while three teachers are there for Biochemistry. The library of the college has more than 3000 books and 20 medical journals. The cadavers necessary for anatomy classes are also available,’’ Dr Gupta said. The students have taken occupation in their respective rooms. Many parents were visible in the hostels, arduously arranging things for their wards. Some of the electrical and masonry works were still going on the hostel building but the basic necessities like beds, fans, water, electricity were arranged by the harried college authorities. On Wednesday some of the parents had objected to lack of facilities in the hostel rooms after which the Uttar Pradesh Nirman Nigam Limited and college administration swung into action. “Things have changed for better in less than 24 hours. The college authorities should have shown this swiftness earlier,’’ said one of a parents looking relieved. The college has hired a local vendor to supply the breakfast, lunch and dinner for the students till the process of mess tender is complete. The earlier tender process for mess was cancelled as only one party showed interest in the work. A new tender is released now. EZ^SVc^RWZRReeRT\dW`cVde <P]TPcTa[T^_PaSbc^QTaTWPQX[XcPcTSPcfX[S[XUTcaP]bXcX]2WXSXhP_da XfRcUZ_CR[R[ZEZXVcCVdVcgV ?=B Q 347A03D= ?=BQ 70A83F0A ncidents of criminal elements beating forest guards in Rajaji Tiger Reserve appear to have continued with another such case being reported. Timber mafia lifted a forest guard and dumped him in the forest area after beating him black and blue on Wednesday night. The guard deputed at Senthli beat of Beriwada range of Rajaji Tiger Reserve, was left half dead. He was later rushed to a hospital by the forest officials. Meanwhile, two of the accused Shaukeen and Shahzad were arrested. The assault might have been made to teach forest guard Arjun Singh a “lesson” as he had registered a case against Shaukeen earlier, said department officials. Iliyas Dangi gang was behind the attack, say sources. Police said that over two dozen timber mafias had reached the Senthli police check post on late Wednesday night. They also broke into the forest office to lift Arjun Singh, the lone forest guard on duty. He was later taken to a sugarcane field. The miscreants thrashed him with batons and sticks and while he fell unconscious he was dumped in the forest. I ;Pbc\^]cWc^^PU^aTbc VdPaS_^bcTSX]1TaXfPSP aP]VTfPbPccPRZTSfWT] WTfPb^]_Pca^[[X]VSdch Around 3 am, when Arjun gained consciousness, he managed to reach Tehra and recounted to the officials what happened to him. The forest officers admitted Arjun to the district hospital where he is undergoing treatment. Meanwhile, a case has been registered against 12 unidentified timber mafias. Notably, the southern boundary of Rajaji Tiger Reserve has remained vulnerable with the gangs led by the timber mafias indulging in illegal activities for the past several years with impunity. It is not the first time that the forest guards have been assaulted by mafia. E arlier also in Dhaulkhand and Beriwada forest ranges, cases of timber mafia attacking forest guards were reported. Last month too, a forest guard posted in Beriwada range was attacked when he was on patrolling duty. eopards that have been tagged as man-eaters are now kept at L the department’s wildlife transit and rehabilitation centre in Chidiyapur, Haridwar forest division. These six leopards were captured by the forest department. They have been confined to cramped conditions here for about five years in one case, instead of being handed over to zoos in accordance with the Central Zoo Rules. Citing anomalies in various tasks of the centre, the inspection report of the centre authorised by the Animal Welfare Board of India, recommended that the Chidiyapur centre should be handed over to the Wildlife Institute of India without delay in addition to other measures recommended for improving the centre’s condition. On April 15 this year the AWBI had authorised its member NG Jayasimha and co-opted member Gauri Maulekhi to conduct an inspection of the Chidiyapur centre to check and assess the status of housing, upkeep and maintenance while checking any incidences of cruelty, violation of Central and State animal protection laws in respect of the unauthorised wild animal facility run at Chidiyapur in Haridwar. The inspection report submitted to AWBI on September 14 presents a dismal state of affairs with leopards under protracted torture of confinement in violation of the laws, improper documentation, absence of trained and qualified staff and varied other irregularities. The report observed at the same facility, that a monkey sterilization centre was also run from time to time. There were no monkeys there on the day of the inspection, but documents obtained under RTI Act reveal lapses on the part of the authorities on which a detailed report may be submitted later this week, stated Jayasimha. The report points out that since no officials or documents were available at the centre on the date of the visit, documents pertaining to the housing, upkeep and treatment of the inmates of the entre were obtained under the RTI Act for this report. Key observations state that leopards 0[[[T^_PaSbS^]^c WPeTPRRTbbc^^_T] T]R[^dbdaTbPbcWTaTPaT ^][hcf^bdRWT]R[^bdaTb P]SbXg[T^_PaSb]^]T^U cWT\R^\_PcXQ[T fXcWTPRW^cWTa once captured, are kept at the centre permanently with six leopards at the centre presently. Maximum time elapsed since capture — 62 months — was that of the male leopard tagged a ‘man-eater’ and captured from Garhwal forest division on May 15, 2011. Similarly, 55 months had elapsed since the capture of a male leopard declared ‘maneater’ in December the same year from Nanda Devi national park. Twenty seven, 26, 16 months and 1 month have elapsed since the capture of the other leopards in the centre. “All leopards do not have access to open enclousures as there are only two such enclosures and six leopards, none of them compatible with each other. The reason of capture of all these six leopards is stated to have been their declaration as man-eating leopards. Rather than transferring these leopards to the zoo in accordance with the Central Zoo Rules, they are kept in inadequate and poor housing conditions at the centre. Leopards were obser ved crammed in small rooms due to inadequacy of enclosures. Improper record keeping with suspicion of some post mortem reports having been fraudulently made raises serious concerns about the mortality of animals accorded highest protection under the Wildlife Protection Act, while also alluding to foul play by the persons/officers in charge of the centre,” states the report, while also adding that the post mortem reports were not as per the standard operating procedure for leopard mortality as prescribed by the National Tiger Conservation Authority. Stating that the leopards observed were under stress, the report stated the centre was confining animals in contravention of sections of the Prevention of Cruelty to Animals Act, 1960. “Creating false post mortem reports and absence of any documents regarding release of the leopards requires investigation to establish if any offence under the Indian Penal Code has been committed,” the report states. It recommends that operation of the centre be immediately handed over to the Wildlife Institute of India for proper rehabilitation of the leopards. Leopards that cannot be rehabilitated should be housed in cages as recommended by CZA. The centre must seek recognition from CZA and Supreme Court and adhere to the regulations for such recognition. The centre must not take in any more leopards till sufficient staff and enclosures have been created,” states the report while also stressing on the need for appointment of a full time director and full time veterinary officer for the animals in the centre. ]PcX^]# 347A03D=k5A830H kB4?C4<14A %! % ?`hW]jUZcVTeWc`^4YR_UZXRcYe`DYRc[RY ?=BQ B0B=060A<>70;8 handigarh Airport got conC nected to the world on Thursday with the innauguration of the maiden international flight to Sharjah (UAE), heralding a new phase for the air passengers of the region. Describing the maiden direct international flight from Mohali International Airport as a red letter day, Punjab Chief Minister Parkash Singh Badal said that it was a step further towards emerging the State as ‘hub of air connectivity’ thereby benefiting the Punjabi diaspora settled across the globe. Talking to reporters on the sidelines of the inaugural of first international flight from the airport to Sharjah, he said that it was a matter of great pride and satisfaction for the Punjabis that Punjab was the first in the northern region to have two international airports. He said that this international Airport at Mohali, second in the State after Amritsar, was result of persistent efforts made by the State Government. He said that the commencing of international flights from this airport would give much needed boost to the economy of the State by connecting it with the rest of world. Badal said that this airport would act as a catalyst to boost Industrialisation in the State besides showcasing Punjab as the most preferred investment destination to woo the leading entrepreneurs across the world to make huge investments in the State. He said International air connectivity from Mohali was all the more important because it would connect the entire Northern region comprising Punjab, Haryana, Himachal Pradesh, Jammu & Kashmir, Uttrakhand and even the Western part of Uttar Pradesh with the other parts of the world. He said that in the absence of this international airport daily a large number of passengers from the Northern States were left with no other option but to travel Delhi for boarding the international flights, which not only caused undue harassment to them but also resulted in huge wastage of time, money and energy. Punjab Deputy Chief Minister Sukhbir Singh Badal termed this as a historic occasion, adding that this initiative would go a long way to propel and IT and tourism sector in the State. Sukhbir said he was leading a special delegation of prospective Industrialists from the State to Sharjah to explore more investment avenues so as to bring major investment in different sectors in Punjab. He said the Airport would be instrumental in giving major push to the hosiery, woolen, garments and cycle industry in Ludhiana. He also hoped that with the commissioning of International flights from Mohali Airport, the local farmers of the State would be enormously benefitted especially from the country like Dubai, which had a tremendous export potential of agro and food items. +DU\DQD*RYW FDQFHOVOHDYHRI GRFWRUVRWKHU PHGLFDOVWDII Chandigarh: Har yana Government on Thursday ordered cancellation of leave of all doctors, dentists, paramedical staff and other officials of the Health Department, till further orders, so as to control the spread of dengue and chikungunya. Health Minister Anil Vij on Thursday said that the incidence of dengue and chikungunya is increasing in the districts of the State adjacent to Delhi. In Delhi, chikungunya and dengue are spreading like an epidemic, therefore, he cautioned the people in the State to take preventive measures before commuting between Delhi and the State. Vij also directed the senior officers of the Department including Additional Chief Secretary, PK Mahapatra to take appropriate measures to check the spread of chikungunya and dengue. ?=B &HQWUHVHHNVIHHGEDFNRI&0 8QbiQ^Qd_\Qe^SX\_W_V_b cgQb^ZQiQ^dYSU\URbQdY_^ .KDWWDUIURP6WDWHOHDGHUV ?=BQ 270=3860A7 ollowing the worst violence in five decades of Haryana’s F existence earlier this year under the rule of BJP led Haryana Government, the Central party leadership on Thursday sought feedback of Manohar Lal Khattar’s Government from various State leaders. With BJP-led State Government completing around two years in Haryana, Shiv Prakash, national joint general secretary (organisation), reviewed the performance of the Government in a series of meeting held here. The series of meetings were held with State MLAs, Cabinet Ministers, State MPs and BJP core group, where the senior BJP leader sought the feedback of the performance of first BJP HZeY3;A]VUDeReV8`gVc_^V_e T`^a]VeZ_XRc`f_Ueh`jVRcd Z_9RcjR_RDYZgAcR\RdY _ReZ`_R][`Z_eXV_VcR] dVTcVeRcj`cXR_ZdReZ`_ cVgZVhVUeYVaVcW`c^R_TV`W eYV8`gVc_^V_eZ_RdVcZVd`W ^VVeZ_XYV]UYVcV Government in the State and also enquired about party’s image among people of various communities after February’s violent Jat agitation. BJP’s incharge of Haryana affairs Anil Jain and Chief Minister Manohar Lal also attended the meetings. During various meetings which concluded late Thursday evening, Shiv Prakash also enquired about the status of various central and State Government’s schemes. A senior party leader said that Shiv Prakash has asked the State leaders to strengthen the organisation at grassroot level and to rebuild public faith in the Government. He has asked the MLAs to meet people on regular basis to redress their grievances. Shiv Prakash has also asked the MLAs to celebrate Prime Minister Narendra Modi’s birthday on September 17 as ‘sewa divas’ and hold events of social ser vice in their constituencies. BJP led Har yana Government will complete its two years tenure in October this year. The 62-year-old Manohar Lal Khattar had taken oath as the first Chief Minister of the BJP Government in the State on October 26 in 2014. Ac`TfcV^V_edjdeV^e` X``_]Z_VZ_9RcjR_R ?=BQ 270=3860A7 he crops of farmers in Haryana would be proT cured online through e-procurement from October 1 and its payment would be made direct to the farmers’ bank accounts. Haryana Minister of State for Food, Civil Supplies and Consumer Affairs, Karan Dev Kamboj on Thursday said that initially, all arhatiyas would be connected with Government’s server. Thereafter, the farmers would be connected through the arhatiyas. Kamboj, who was talking to the mediapersons said that this year, farmers would be given option to sell their produce through arhatiyas. The farmers would have to give their consent whether they want to take money from arhatiyas or direct into their bank accounts, said he. For the success of this system, all the arhatiyas would have to computerise their working so that data of all farmers could be accessed easily. Also, the arhatiyas would have to upload data such as name of farmer, address, aadhaar number and other necessary information including mobile phone number on the server. The Government would start paddy procurement from October 1 so that farmers may not face any problem in selling their produce, he added. Chandigarh: Planning to celebrate the golden jubilee year of the State in a big way, the Haryana Government will launch a logo for Swarna Jayanti (golden jubilee) celebrations on September 17 in Gurgaon. Besides, a magnificent Swarna Jayanti Rath Yatra has been planned to be taken out as a pre-cursor to Haryana Swarna Jayanti celebrations from November 1, 2016 to October 31, 2017. The Rath Yatra will comprise five tableaus depicting art, culture, heritage, history, progress and development of the State. The Rath Yatra would pass through all districts and villages or towns falling between one district headquarter to other district headquarter. A meeting of executive committee of Swarna Jayanti Celebrations Authority was held under Chief Secretary DS Dhesi on Thursday to discuss plans for the year long celebrations. Apart from depicting various aspects of life and people of Haryana, about 100 to 200 artistes would also be engaged to perform on the tableaus and create a festive environment from wherever this Yatra passes. The Rath Yatra will also showcase a cultural programme at the district headquarters in the evening. It was informed that the State Government intends to showcase history, economic prowess and achievements of the state over the last five decades since Haryana became an independent state of India. With a view to organise the grand opening ceremony of Haryana Swaran Jayanti Celebrations on November 1 at Tau Devi Lal Stadium, Gurgaon, ³CWT6^ecf^d[SbcPac _PSSh_a^RdaT\T]cUa^\ >Rc^QTa b^cWPcUPa\Tab \Ph]^cUPRTP]h_a^Q[T\ X]bT[[X]VcWTXa_a^SdRT´ E`jY`daZeR]e` YV]a^R\VgZdZee` U`Te`cTYZ]Uda]Rj Kamboj said that eProcurement would not only ensure transparency in the system, but would also put a check on theft of market fee. After development of this system, the arhatiyas would be able to start e-Trading in the entire country. Under this system, they would be able to purchase crops from any part of the country and sell the same online in other parts of the country, he said. The Minister said that the control of online procurement would be at state headquarters and all district headquarters would be linked to it. The Anaj Mandis of districts would work under the supervision of District Food and Supplies Controller. <´=0386<?G>1BCAD2C8>= 4>fcXVUe`cRZdVVT`Z^aRTeZddfV 4]cXaTBPcZ^bXP T]eXa^]\T]c d]STacWaTPc 1890H<8B7A0Q 0=6D; eading environment protection organisations, L Citizen Action Forum (CAF) and Foundation Ecological Security, have urged Chief Minister Naveen Patnaik to raise the issue of environmental impact due to depleted water flow in the Mahanadi in the wake of construction of barrages on the inter-State river by the Chhattisgarh Government at the tripartite meeting in New Delhi on September 17. “Depletion of water flow in river Mahanadi will have a serious impact on the whole ecosystem of the Satkosia Gorge sanctuary, the Satkosia Tiger Reserve, the Mahanadi Elephant Reserve and the Gharial Research and Conservation Unit (GRACU),” the two organisations have said in a memorandum to the Chief Minister. Besides, the Mahanadi estuarine ecosystem and the Mahanadi delta, the Bhittarkanika mangrove forest with high species diversity and the Gahirmatha rookery of Olive Ridley turtles would also be affected, they said. Submitting the memorandum, team leader FES Swapna Sarangi and RP Patnaik and Bijay Mishra of the CAF demanded withholding or cancellation of all the environment clearances to all the projects’ construction by the Chhattisgarh Government on the Mahanadi and direction to stop the works until an environment impact assessment relating to the Satkosia Gorge sanctuary and the Mahanadi estuarine ecosystem is done. Notably, the Mahanadi flows in the heart of the rare ecosystem of the country— the Satkosia Gorge sanctuary. The river extends life support to the sanctuary. Satkosia is the longest and deepest running water system of the world and the meeting point of two bio-geographic regions of the country -- the Deccan Peninsula and the Eastern Ghats -- contributing immensely to biodiversity. The Satkosia Gorge sanctuary consists of the Satkosia Tiger Reserve, the Mahanadi Elephant Reserve and the Gharial Research and Conservation Unit (GRACU). The Satkosia Tiger Reserve comprises two adjoining sanctuaries of central Odisha named as Satkosia Gorge Sanctuar y and Baisipalli Sanctuary. Dubai: Children in Dubai who are frightened of hospitals and doctors will soon be able to take their ‘sick’ toys ‘for treatment’ to help them reduce their own anxiety, a media report said on Thursday. Toys that require surgery will be taken to a special operating room in a toy hospital, where children can watch the procedure being carried out. It is believed that giving children a positive experience in hospitals will help reduce their anxiety if they need medical treatment later on, according to experts from the Mohammed bin Rashid University of Medicine and Health Sciences, Khaleej Times reported. The university will use a simulation centre, where children will meet with health workers, who will ‘assess’ and ‘treat’ the toys. it has been proposed to hire an event management agency to creatively conceptualise the opening ceremony and include various cultural and historical elements of Haryana and showcase the contribution of Haryana to the progress of the country. Also, a project management unit or knowledge partner would be engaged for smooth functioning of all activities like cultural programmes, sports tournaments, prabhat feris and speech competitions. The State Government has also planned to bring together renowned actors, business icons, state leaders, sportspersons, exserviceman and freedom fighters belonging to Haryana on one platform during the mega event to be inaugurated by Prime Minister Narendra Modi on November 1 in Gurgaon. ?=B EP[c^WPST\P]Sb_aXeX[TVT \^cX^]PVPX]bc2^]V <;0b^eTaaT\PaZb :ULWHVOHWWHUWR 6SHDNHU ?=BQ 270=3860A7 day after he was alleged to have passed a casteist A remark against Congress MLA Tarlochan Singh Soond inside the Punjab Vidhan Sabha, the Shiromani Akali Dal MLA Virsa Singh Valtoha on Thursday written a letter to the Assembly Speaker Charanjit Singh Atwal demanding privilege motion against Congress MLAs, including Soond, for their “shameful acts”. “Congress MLA Soond and other Congress MLAs used defamatory language against me and concocted a false story blaming me of using foul and objectionable casteist remarks in a bid to cover up his own sins. By committing such a sin, the Congress MLAs have breached my special privilege in the House,” said Valtoha. He said that despite of feeling sorry for his shameful act, Soond created a false story of caseist remarks in the media to cover up his sin and Congress MLAs also supported him in this cover up act. Valtoha said that he is an amritdhari Sikh, who lives his life as per teaching of Sikh Gurus and respect all religions and castes. He cannot even think of using any caseist remarks against any community, he said. “During the ongoing session, shoe hurling at ruling party chairs by Congress MLA Soondh has lowered the dignity of the House. All MLAs are deeply hurt and saddened by this shameful act of the Congress MLA,” he added. Valtoha said that Congress MLAs had made a mockery of the rich traditions of the Vidhan Sabha, and asked them to explain why they had resorted to drinking sessions of Scotch and Whisky, eating Chicken and Meat in the august House. “There are also reports that some Congress MLAs sharing vulgar video clips between themselves which needed to be investigated…All these incidents prove that the Congress party is deeply frustrated by its inability to rise to the expectations of the people,” he added. Condemning this act of Congress MLAs, Valtoha said that the Speaker, who also remained the Deputy Speaker of the Lok Sabha, is known for his dignity, fairness and transparency, but the Congress MLAs even lowered the dignity of the Chair of the Speaker by throwing books and paper rolls on the chair and using derogatory language against the Speaker. Commenting on the remarks made by Capt Amarinder Singh about him, Valtoha asked the state Congress chief to get congress MLAs treated by doctors who made merry by drinking Scotch whisky besides resorting to jokes and singing sessions in the temple of democracy. &RQJUHVV0/$6RRQGDQGRWKHU&RQJUHVV0/$V XVHGGHIDPDWRU\ODQJXDJHDJDLQVWPHDQG FRQFRFWHGDIDOVHVWRU\EODPLQJPHRIXVLQJIRXO DQGREMHFWLRQDEOHFDVWHLVWUHPDUNVLQDELGWRFRYHU XSKLVRZQVLQV%\FRPPLWWLQJVXFKDVLQWKH &RQJUHVV0/$VKDYHEUHDFKHGP\VSHFLDO SULYLOHJHLQWKH+RXVH 3P]PVTcbC(;1PWaPX]PXS ?=BQ 17D10=4BF0A ana Majhi, who had carried his wife’s body on his D shoulders for around 12 km after being allegedly denied an ambulance at the Kalahandi District Headquarters Hospital (DHH), on Thursday received C9-lakh assistance donated by Bahrain Prime Minister Prince Khalifa bin Salman Al Khalifa. Majhi received the cheque at the Kingdom of Bahrain Embassy in New Delhi. “I will deposit the amount in the accounts of my three daughters and will spend it for their study,” said Majhi. Moved by an article on Dana Majhi in the Akhbar Al Khaleej of Bahrain, the Khalifa had announced the donation. Notably, Dana’s wife Amang died at the Kalahandi DHH at Bhawanipatna due to ³FX[[ST_^bXccWT P\^d]cX]QP]Z PRR^d]cb^U\h "SPdVWcTab´ tuberculosis on August 23. Dana reportedly sought help from the hospital staff to carry the body to his village, 60 km away from the DHH. But after the hospital staff reportedly denied an ambulance, Dana walked with the corpse on his shoulders along with his 12-year-old daughter on August 23 night till people spotted him in the early morning on August 24. Meanwhile, different organisations and people have donated money to Dana while the KISS offered free education to his daughters. BP\QP[_dac^_bX]d]STafTXVWc]TfQ^a]X]>SXbWP Q B0=944E:D<0A?CA> disha’s development story carries little weight when the O latest 2016 data reveal that one in every five newborn in the State is underweight, and Sambalpur district tops with more than two babies born underweight in every five newborns. The worrying fact is that a high of around eight districts have underweight newborns higher than the State average. According to the data available for the period April-August 2016 with the State Health Department, a high of 41 per cent of newborns in Sambalpur are underweight vis-a-vis the State average of 20 per cent. Nabarangpur follows with around 32 per cent underweight newborn. Kandhamal with 31 per cent underweight newborn is lurking closely behind Nabarangpur. Moreover, Kalahandi with around 28 per cent underweight newborn babies and Malkangiri with over 27 per cent underweight babies form the league of top-5 districts with most underweight newborns (babies who were weighed at birth). The data further reveal that while 25 per cent babies born in ?TYcXQXQccUS_^T XYWXUcdY^VQ^d]_bdQ\YdibQdU ?=BQ =4F34;78 sample registration system report for 2014 released by the Registrar General and Census Commissioner of India (SRS). The infant mortality rate (IMR is the number of deaths of infants under one year per 1,000 live births. It is the goto figure to measure a State’s health scenario. For Odisha, the rate is 49. The death rate of girls stands at 53 in villages and the figure for cities is 34. Villages are witnessing more deaths than cities because of high malnutrition rate and poor access to health services. The report reveals that Madhya Pradesh has the highest infant mortality rate in the country. According to the report, Assam also stands second in infant deaths along with Odisha, followed by Uttar Pradesh at the third position, Rajasthan at fourth and Chhattisgarh at the fifth spot. Deogarh are underweight, Balangir with over 24 per cent underweight newborns follows closely. Though Sambalpur district tops the underweight chart, Nabarangpur tops with stillbirth cases. Sambalpur has recorded around 443 stillbirth cases during the period AprilAugust 2016. Ganjam district with around 367 stillbirths comes closest second to Nabarangpur. Mayurbhanj and Koraput follow them to make the top-5 districts with high stillbirth cases. Then Balangir follows the top-5 in stillbirth cases, reveal the data. Stillbirth is the birth of a baby who is born without any signs of life at or after 24 weeks of pregnancy. A baby may have died during late pregnancy (called intrauterine death) or, more unusually, may have died during labour or birth (called intra-partum death). According to the Unicef, pre-eclampsia and heavy bleeding during late pregnancy or during labour constitute a significant factor in Odisha behind stillbirths. Other factors like malaria and bacterial infections (espe- cially Eischeria coli) also play a major role in high stillbirth cases in the State. It is generally observed that the districts with poor sanitation and nutrition condition record high incidences of stillbirths and underweight babies. With such a state of affairs in childbirth, Odisha in the indicator of infant mortality rate (IMR) has failed to make any progress during the last decade (2005-2014) as it stuck at 34th rank (among 36 States and Union Territories) in 2014, the same it had in 2005. disha stands second in infant mortality rate in O the country, says the latest ]PcX^]$ 347A03D=k5A830H kB4?C4<14A %! % :_UZRdfXXVdedAR\hRjd e`daVVUfa#' ""ecZR] ?=BQ =4F34;78 pset with the slow pace of progress in the 26/11 U Mumbai trial going on in Pakistan, Foreign Secretary S Jaishankar has written to his Pakistani counterpart Aizaz Ahmad Choudhry giving suggestions on how to conclude the trial at the earliest. The letter was sent around a time when Pakistan’s Federal Investigating Agency (FIA) dropped charges against Lashkar-e-Tayyeba terrorist Sufiyan Zafar for lack of evidence in this case. The letter by Foreign Secretary, sent on September 6, was delivered to Chaudhry on September 9 by the Indian High Commissioner in Islamabad Gautam Bambawale. However, India is yet to get a response on this letter. While the Government didn’t elaborate on the suggestions, sources indicated it could be sending a Judicial Commission to India to exam- C744=C8A40CC02:F0B?;0==435A>< ?0:8BC0=F0B?4A?4CA0C431H ?0:8BC0=8=0C8>=0;B0;;C744E834=24 0A48=?0:8BC0=1DC4867CH40AB70E4 ?0BB430=3CA80;8B70??4=8=60C0 B=08;³B?024F40A4?A4?0A43C> >554ABD664BC8>=B>=7>F8C20=143>=4 C7A>D67C74?A>?4A;460;270==4;B EXZPbBfPa^^_<40 b_^ZTb_Tab^] ine evidences that Pakistan has been asking New Delhi to handover. These include GPS, satellite-cell phones and weapons etc used by terrorists. Pak wants India to hand over these material evidences to it along with recovery memos. It claims that in the absence of these it still does not have much in hand to move ahead in the case. Underlining that the trial in Pakistan has not progressed expeditiously, although it will be eight years soon since the attack, Ministry of External Affairs spokesperson Vikas Swarup said the Foreign Secretary’s step was prompted by the delay in bringing to book the persons in Pakistan responsible for the Mumbai terror attack. “As you know, the entire attack was planned from Pakistan, was perpetrated by Pakistani nationals, all the evidence are in Pakistan, but eight years have passed and trial is happening at a snail’s pace,” he said. According to Swarup, if Pakistan is serious about bringing to justice the perpetrators of the attack, it must act on the suggestions as India’s focus is to check terrorism and the Government wants to bring the Mumbai case trial to expeditious conclusion. “We are prepared to offer suggestions on how it can be done through the proper legal channels,” he said. Sufayan Zafar was accused of financing C14,800 crore for the attack and providing C3.98 crore to co-accused Shahid Jameel Riaz prior to the attack. Zafar was hiding after being declared proclaimed offender in the Mumbai case. He was arrested early last month from his hideout in KhyberPakhtunkhwa province. A resident of Gujranwala district of Punjab, approximately 80 km from Lahore, Zafar was among 21 absconding suspects wanted in this high-profile case. Six suspects —Abdul Wajid, Mazhar Iqbal, Hammad Amin Sadiq, Shahid Jameel Riaz, Jamil Ahmed and Younus Anjum— have been lodged in the Adiyala Jail, Rawalpindi, since 2009 for abetment to murder, attempted murder, planning and executing the Mumbai attacks. 8]SXPAdbbXPQ^]SfPa\STb_XcTDBbP]RcX^]b E8=44C0?0=34HQ =4F34;78 aving worked firmly together over the years in H the defence and security areas, India and Russia are now moving forward to increase their trade and commerce relationship in a big way. Ahead of President Vladimir Putin’s visit to India this October for the Annual Summit level talks, the two sides are working to ramp up the ties with new collaborations. Defence and security still remain prime collaborating areas, sources said but pointed out that the two sides are moving fast on new dimensions that include aerospace, ship building, port development, diamonds, pharmaceutical, railways, inland waterways, shipbuilding, manufacturing, mining, agriculture and food processing. Apart from these, there are talks for partnership between Indian States like Maharashtra, Andhra Pradesh and Rajasthan with regions in Russia. Sources conceded that economy and trade have shrunk between the two sides 3Tb_XcTbP]RcX^]bQhDB^]AdbbXP8]SXP´b aT[PcX^]bWX_fXcW<^bR^fWPbaT\PX]TS a^QdbcP]S\d[cXSX\T]bX^]P[8]SXPb bTRdaXchaT[PcX^]bWX_fXcWAdbbXPWPbQTT] b^d]X`dTcWPccWTaTXbPbPhX]VcWPcXUcWTaT XbPbTRdaXchbXcdPcX^]X]8]SXPcWTUXabcRP[[ \PSTfX[[RTacPX][hQTc^AdbbXPCWT ±fPa\cW²X]aT[PcX^]QTcfTT]E[PSX\Xa?dcX] P]S=PaT]SaP<^SXbW^d[SbTTcWTcf^ bXSTbbcT__X]Vd_X]cTaPRcX^]bX]b_TRXUXR PaTPbU^aR^[[PQ^aPcX^]bP_PacUa^\cWT caPSXcX^]P[\X[XcPahcTRW]^[^VhT]TaVhP]S RXeX[]dR[TPaR^^_TaPcX^] which they are trying to get back on track. The “warmth” in relation between Putin and Modi should see the two sides stepping up interactions in specific areas for collaborations apart from the traditional military technology, energy, and civil nuclear cooperation. Interestingly, despite sanctions by the United States on Russia, India’s relationship with Moscow has remained robust and multi dimensional. India's security relationship with Russia has been so unique that there is a saying that if there is a security situation in India, the first call made will certainly be to Russia. Russia too has backed India in all odds and evens. The military and civil nuclear partnership remains robust and Russia has helped India immensely in capacity building in this sector. From submarines to helicopters, Sukhois to sophisticated weapons-there is collaboration in all areas. There is also talk of India procuring Fifth Generation Fighter Aircrafts from Russia for which some initial investment seems to have been made by India. Through FGFA, New 8=B7>AC C74;4CC4AF0B B4=C>=B4?C%6>C 34;8E4A43C>?0: 5>A486=B42A4C0AH >=B4?C(0=3 A4?;H8B0F08C43 Delhi is looking at getting some cutting edge technology and “something ahead of curve” for its defence sector. Some progress is expected to be made during Putin’s visit next month on the FGFA. India is also particularly happy with the Kamov 226 deal with Russia. Out of the 200 helicopters that India is buying, 60 will be in fly away conditions with the rest 140 to be jointly made in India. India is happy that this first major defence project under Make in India will help strengthen its own military aviation sector. However, the Indian side is making efforts to encourage more Russian participation through Make in India and have joint ventures with Indian private companies. Though there seems to be a bit of reluctance on the Russian side to get involved with private entities in India as in this niche area they prefer government to Government dealings, the Indian side is trying its best to convince their Russian partners, sources said adding Putin’s involvement may help in this regard. >55824AB>=?>;;3DCH C>64C7>=>A0A8D< =Tf3T[WX) 0RZ]^f[TSVX]VcWT a^[T_[PhTSQh2T]caP[P]SBcPcT _^[XRTU^aRTbX]R^]SdRc^U_^[[b cWT4[TRcX^]2^\\XbbX^]^] CWdabSPhP]]^d]RTScWPcP] W^]^aPaXd\fX[[QT_PXSc^cWT _Tab^]]T[ST_[^hTS^]T[TRcX^] Sdch 34?>B8CC !2A8=5>DA F44:B)B2C>?0ABE=0C7 =Tf3T[WX) CWTBd_aT\T2^dac ^]CWdabSPhSXaTRcTS?Pabe]PcW 1dX[SfT[[?ec;cSc^ST_^bXcC ! Ra^aTfXcWX]U^dafTTZbPb X]cTaTbcQTPaX]VbW^accTa\ ST_^bXcU^aST[PhX]VX]VXeX]V _^bbTbbX^]^UU[Pcbc^ W^\TQdhTabX]Xcb6WPiXPQPS _a^YTRc0QT]RW^U9dbcXRTb 3X_PZ<XbaPP]S2=PVP__P] PbZTScWTR^d]bT[U^a&W^\T QdhTabfW^WPSP__a^PRWTScWT =PcX^]P[2^]bd\Ta3Xb_dcTb ATSaTbbP[2^\\XbbX^] =23A2c^bTTZX]bcadRcX^]b^] fWTcWTacWThf^d[SPVaTTc^cWT _a^_^bTSSTPS[X]T^U3TRT\QTa ! &VXeT]QhcWTSTeT[^_TaP]S cWT`dP]cXUXTS\^]cW[haT]c ?aX\T<X]XbcTa=PaT]SaP<^SXbWPZTbWP]SbfXcW5X]P]RT<X]XbcTa^U<PdaXcXdb?aPeX]S9dV]PdcWPcP\TTcX]VX]=Tf3T[WX ^]CWdabSPh ?C8 B2[Tcb:TaP[PaP_T\daSTaPRRdbTS ^UUVP[[^fbX][PRZ^UTeXST]RT 01A070<C7><0BQ =4F34;78 ive years after the rape-cummurder of a 23-year-old F woman travelling in a local train in Kerala shocked the conscience of entire State, the Supreme Court on Thursday let the accused off the gallows after it found evidence insufficient to nail him for the girl’s death. Though acquitting him of the serious charge of murder, a three-judge bench that heard the appeal filed by the accused Govindaswamy retained him in jail for his entire life for the charge of raping the woman in an injured state as she lay wounded beside the railway track after she fell off the moving train. The bench of Justices Ranjan Gogoi, PC Pant and UU Lalit came to the conclusion that the rape was the most brutal and grotesque act and deserved maximum punishment. It said, “Having regard to the fact that the said offence (rape) was committed on the deceased who had already suffered extreme injuries on her 218aTVXbcTabRPbT #*aVcd`__V]`W2?$#RZcTcRWeµacVdf^VUUVRU¶ PVPX]bcd]Z]^f] 805aT[TPbTb]Tfb However, search for the dent. It is with a feeling of and went missing soon after. “No fewer than 201 search plane in the Bay of Bengal will profound sadness that the IAF officials said Court of Inquiry has recom- and rescue sorties, using all PbbPX[P]cb^UbRaXQT PUcTa^]TP]SWP[U continue, here on Thursday. As regards mended that your son/daugh- suitable aircraft at our reason for informing ter be presumed to have been disposal were undertaken. APYST^AP]YP] \^]cWb^UX]RXST]c the relatives, they said it was done fatally injured,” read the letter Approximately 2,17,800 square ?=BQ =4F34;78 ?8>=44A=4FBB4AE824Q =4F34;78 he CBI on Thursday registered a case against T early one and half months unknown persons in the mur- Nafter an AN-32 transport der of scribe Rajdeo Ranjan in plane went missing, the Indian Siwan. “The CBI has registered a case under Section 302, 120B, 34 of IPC and Section 27 of Arms Act against unknown assailants relating to alleged murder of senior journalist Rajdeo Ranjan on the request of Bihar Government and further notification from Government of India,” a CBI spokesperson said. CBI has taken over the investigation of the said case which was earlier registered vide FIR No 362/2016 on May 13, 2016 at Police Station, Siwan town, Bihar on a complaint from the wife of deceased. The move comes four months after the Bihar Government recommended a CBI probe into the murder of Ranjan, bureau chief of Hindi daily Hindustan. A team of agency sleuths will leave shortly for Siwan, the sources said. The sources said name of former RJD MP Shahabuddin who has been released recently on bail was under the scanner of Bihar Police which was probing the case till recently. Meanwhile, a fact finding team of the Press Council of India (PCI) has found out that Ranjan may have been killed by “political mafia” because of his critical reporting. The PCI accepted the report of the factfinding committee last week. Another fact-finding report which the PCI accepted was regarding the murder of Jharkhand journalist Akhilesh Pratap Singh. The report suggested that he may have been killed over demand of money by a Naxalite group. Air Force (IAF) has informed relatives of Service personnel on board the ill-fated aircraft that they are “presumed dead.” There were 29 personnel in the aircraft when it went missing shortly after take off from Chennai for Port Blair on July 22. to enable the next of kin to enable them to initiate process for insurance and other administrative formalities. “The Court of Inquiry, upon very careful scrutiny of the circumstantial evidence available and in light of extensive search and rescue operations carried out, has concluded that it is unlikely that the missing personnel on board the ill-fated aircraft would have survived the acci- from IAF to the families of those in the aircraft. The letter came annexed with a certificate of presumption of death. There was a woman officer among the missing personnel. Officials said 17 ships of the Navy and Coast Guard including a submarine and 23 aircraft were engaged in the search mission since the plane which took off from Tambaram airbase near Chennai on July 22 nautical miles (Sq Nm) have been covered multiple times by these aircraft,” the letter stated. “International emergency response teams and satellites from USA also did not help in getting any concrete information about the missing aircraft,” it added. The plane is believed to have plunged into the sea from a height of 23,000 feet about 280 nautical miles off Chennai. &%,ILOHVJUDIWFDVH $ViacVddhRjac`[VTed DJDLQVWH[0'RI8%, SVdZUVdFA¶de`SV ]Rf_TYVUd``_+8RU\RcZ ?=BQ =4F34;78 he CBI has registered a corruption case against the forT mer Chairman-cum-Managing Director of United Bank of India (UBI) Archana Bhargava and two private companies. During searches conducted on Thursday, the CBI recovered cash, jeweller y and investment details to the tune of over C10 crore which are allegedly in her and family members’ name, a CBI spokesperson said here. “It was alleged that the then public servant while posted as ED of Canara Bank in the year 2011 and as CMD of UBI in the year 2013 had abused her official position and obtained certain amounts for herself or for a New Delhi based private firm (owned by her husband and her son), from the companies to whom various credit facilities were granted by the banks, where she had worked,” the spokesperson said. The official said searches conducted at the residential premises of accused persons in Delhi, Noida, Mumbai, Kolkata and Howrah led to the recovery of jewellery worth C2.85 crore and C10.50 lakh cash from the bank lockers in her name and family members. In addition deposits of C5.42 crore in her name and family members, C2.26 crore in her bank accounts; documents of two properties including a three-storey bungalow at Noida and a flat at Vasant Kunj, New Delhi besides two properties in the name of her family members in Delhi and Mumbai, the official added. The CBI has booked her under section 120-B (criminal conspiracy) of IPC and relevant sections of the Prevention of Corruption Act against then CMD, a private firm based at New Delhi and another private firm based at Kolkata and other unknown persons. New Delhi: Road Minister Nitin Gadkari on Thursday said that three expressway projects-DelhiAmritsar-Katra, Delhi-Jaipur and Vadodara-Mumbai-worth C1,32,000 crore will be launched soon. Besides a C1,500-crore expressway project between Kanpur and Lucknow in UP will also be launched soon. “We will soon start three important expressway projects that would reduce travel time significantly between DelhiKatra, Delhi-Jaipur and Vadodara-Mumbai. These would entail a total project cost of C1,32,000 crore,” Gadkari said. He hoped that the travel distance to these destinations will reduce significantly once the projects are operationalised. As per the plan, Amritsar could be reached via Delhi in three hours after completion of the C60,000-crore AmritsarDelhi expressway, which will reduce travel duration by over two hours. Also on the anvil is a project connecting Jalandhar to Ajmer that will bring down the travel time to five hours. Meetings in this regard are scheduled with CMs of J&K, Punjab, Haryana, Delhi and Rajasthan. “Detailed project report is being prepared for an eight-lane access controlled expressway between Kanpur and Lucknow. The estimated cost of the project would be around C1,500 crore. Kanpur to Lucknow distance can be travelled in 35-40 minutes,” Gadkari said adding that it will be an elevated road. The Minister said massive road network would be laid in UP and the Government has planned at least C2 lakh crore projects of which work on about C70,000 crore projects is underway. He on Wednesday laid the foundation stones of 12 major NH projects worth C10,596.19 crore at Ropar, Samrala and Jalandhar in the poll bound Punjab. Chandigarh will also be connected by 4-lane roads with all major cities such as Amritsar, Jalandhar and Ludhiana. PNS body, we are of the view that not only the offence under Section 376 IPC (rape) was committed by the accused, the same was so committed in a most brutal and grotesque manner which would justify the imposition of life sentence as awarded by the trial court and confirmed by the Kerala HC.” But the apex court set aside the concurrent death sentence awarded to Govindaswamy by the trial court and High Courts after raising doubts whether the fatal injury caused to the victim was due to pushing her off the train by the accused by way of pushing or was a result of her own action to jump off the train. Justice Gogoi, writing the judgment for the bench said, “The fact that the deceased survived for a couple of days after the incident and eventually died in hospital would clearly militate against any intention of the accused to cause death by the act of keeping the deceased in a supine position.” The incident occurred on February 1, 2011 while the victim was travelling in the ladies compartment of a local train from Ernakulam to Shoranur, the place where she stayed. The accused entered the ladies compartment spotting the victim alone and tried to molest her following which she fell off the train. The accused too jumped out and later raped her. She succumbed to her injuries at the hospital five days later. EXYPh<P[[hPfW^XbPc _aTbT]cX];^]S^] \PSTcWTbdQ\XbbX^] cWa^dVWWXbR^d]bT[ QTU^aTcWT2WXTU <Tca^_^[XcP] <PVXbcaPcTX]PRPbT [^SVTSU^aP[[TVTS[h TePSX]Vbd\\^]bX] R^]]TRcX^]fXcWP54A0eX^[PcX^]\PccTa CWTR^d]bT[bdQ\XccTScWTR^_h^UP]T\PX[ bT]cQh<P[[hPbcPcX]VcWPcWXb_Pbb_^ac fPbbdb_T]STS^]0_aX[!"! %fXcW^dc VXeX]VWX\P]h^__^acd]Xch^UQTX]VWTPaS he Government has dismissed Vijay Mallya’s claim T that he is unable to return India in the absence of a passport as it remains suspended by Indian authorities. Ministry of External Affairs spokesperson Vikas Swarup said on Thursday that any citizen can approach the nearest Indian Embassy or High Commission and apply for an Emergency Certificate to return to the country. Swarup underlined that the Emergency Certificate is specifically meant to provide a travel document to an Indian citizen to return to India in the absence of regular passport and this facility is available to Mallya also if he wishes to apply for it. “Our position is very clear. Any Indian citizen who is outside India and who does not have a valid travel document for any reason, only has to approach the nearest Indian Embassy or High Commission and apply for an Emergency Certificate,” Swarup said. Mallya, who is at present in =Tf3T[WX) 0]P]cX6<Va^d_ 2^P[XcX^]U^aP6<5aTT8]SXP^] CWdabSPhP[[TVTScWPccWT bdQR^\\XccTTR^]bcXcdcTSQh cWTR^d]cahbQX^cTRWaTVd[Pc^a 6402c^TgP\X]TcWTQX^bPUTch SPcP^]6<\dbcPaSSXS]^c WPeTP]hWTP[cWTg_TacP]ScWaTT ^UXcb\T\QTabWPeTR^]U[XRc^U X]cTaTbc B?40:4A;43C40<C> E8B8C=4FI40;0=3 6^ecYd]Zb<P[[hP´b R[PX\bPhbP__[hU^a 4\TaVT]Rh2TacXUXRPcT ?=BQ =4F34;78 ³6402383=>C70E4 0=H740;C74G?4AC´ London, recently made the submission through his counsel before the Chief Metropolitan Magistrate in a case lodged for allegedly evading summons in connection with a FERA violation matter. The counsel submitted the copy of an email sent by Mallya, stating that his passport was suspended on April 23, 2016 without giving him any opportunity of being heard. EnforcementDirectorate (ED), however, told the court that Mallya is already evading proceedings in several other cases and sought time to reply to the plea moved by him on Thursday. On July 9, the court had cancelled the exemption from personal appearance granted to him and had directed him to appear before it. In his application moved through senior advocate Ramesh Gupta, Mallya requested the court that some time be given so that his appearance can be secured. The court has now put up the matter for further hearing on October 4. =Tf3T[WX) 0_Pa[XP\T]cPah ST[TVPcX^][TSQh;^ZBPQWP B_TPZTaBd\XcaP<PWPYP]fX[[ eXbXc=TfITP[P]SUa^\ BT_cT\QTa &c^!!3daX]VXcb eXbXccWTST[TVPcX^]fX[[RP[[^] cWTB_TPZTa^U=TfITP[P]Sb _Pa[XP\T]c3PeXS2PacTaP]S fX[[W^[S\TTcX]VbfXcW \T\QTab^UcWT=TfITP[P]S 8]SXP?Pa[XP\T]cPah5aXT]SbWX_ 6a^d_PcFT[[X]Vc^]CWT ST[TVPcX^]fX[[P[b^\TTccWT 8]SXP]R^\\d]Xch\T\QTabPc P]TeT]cW^bcTSQh=TfITP[P]S 8]SXP]2T]caP[0bb^RXPcX^] =I820X]0dRZ[P]S =6C=>C824C><>45 D?>=F0BC43D<?8=6 =Tf3T[WX) CWT=6C^] CWdabSPhXbbdTS]^cXRTbc^ 4]eXa^]\T]c<X]XbcahP]SD? 6^eTa]\T]cPVPX]bcaP\_P]c Sd\_X]V^UfPbcTP]S T]Ra^PRW\T]cb^]0acWP[P;PZT [^RPcTSR[^bTc^7X]S^]AXeTaX] cWTBcPcTCWXbR^\TbX]cWT fPZT^UP_[TPP[[TVX]VcWPc Sd\_X]V^Ub^[XSfPbcTP]S QX^\TSXRP[fPbcTX]0acWP[P;PZT P]SX]SdbcaXP[TUU[dT]cb SXbRWPaVTSUa^\<^WP]<TPZX] ;cSfPbRPdbX]VVa^d]SfPcTa R^]cP\X]PcX^] =4GC;8BC>5B<0AC 28C84BC>2><4B>>= =Tf3T[WX) CWT2T]caTfX[[ P]]^d]RTcWT]TgcbTc^U!& RXcXTbU^aUX]P]RX]Vd]STacWT <^SX6^eTa]\T]cU[PVbWX_ B\Pac2Xch<XbbX^]]TgcfTTZ D]X^]DaQP]3TeT[^_\T]c <X]XbcTa<ET]ZPXPW=PXSdbPXS fWX[TPSSaTbbX]VcWT !cW8]S^ DB4R^]^\XRBd\\XcWTaT^] CWdabSPh 19?c^STSXRPcT ]PcX^]P[R^d]RX[ \TTcX]Vc^Xcb XST^[^VdT ?=BQ =4F34;78 JP will dedicate National Council meeting in B Kozhikode, to be held on September 23-25, to its ideologue Deen Dayal Upadhyay and along with this Prime Minister Narendra Modi will launch a year-long exercise in his memory. Modi will touch off Upadhyay’s 100th birth anniversary celebrations on September 25, the day he was born. “The meeting will be a tribute to Deen Dayal Upadhyay. PM will launch the year-long exercise and events will be held in India as well as abroad round the year,” its General Secretary Arun Singh said. The part of Swapna Nagari in Kozhikode where the party’s 2,000 delegates will stay will be named after Upadhyay as well. There will also be an exhibition. “We are going to ensure that people get to know of the greatness of his philosophy and leadership,” Singh said. Modi is also scheduled to address a rally in beach town of Kerala on Sep 24 while party president Amit Shah will address the delegates the next day when the PM will also give his concluding address. ]PcX^]% 347A03D=k5A830H kB4?C4<14A %! % 20DE4AH2>=D=3AD< DVTVddZ`_Zded^R\V 4]bdaT_a^cTRcX^]c^:P]]PSXVPb):´cPZP2<c^9PhP YRjE?SR_UYe`URj K :4BCDAE0BD:8Q 14=60;DAD :D<0A274;;0??0=Q 274==08 amil chauvinists and secesT sionists had a field day in Tamil Nadu on Thursday with a brazen display of anti-India slogans and an office of the Indian Oil Corporation in Chennai coming under attack under the guise of antiKarnataka protests for Cauvery waters. The day’s highlight was an attempt of self-immolation by an activist belonging to the Naam Tamilar Party led by Seeman Sebastian, a Tamil leader seeking secession of Tamil Nadu from India. The activist who tried self-immolation during the demonstration organised by the outfit was rescued by policemen and admitted to the general hospital. Major political parties in the State, barring the AIADMK, have declared their support to Friday’s bandh call given by Cauver y Delta Farmers to protest against the intransigent attitude of Karnataka Government in releasing Cauvery waters. People who have planned their trip to Tamil Nadu on Friday could face difficulties to reach their destinations from railway stations and airports as autos and share autos are expected to stay off the roads. All private schools in the State will remain closed on Friday as school managements have declared a holiday. AM Vikramaraja, president, Federation of Traders’ Associations of Tamil Nadu, said that all 21 lakh shops and business establishments would remain closed on Friday. The 11 lakh trucks employed to transport essential commodities too would remain off the roads, said Vikramaraja. The Tea Shop Owners Association said all tea shops across the State would down the shutters on Friday. Secessionists made hay with the 24X7 Tamil news channels vying with one another in telecasting anti-Karnataka and antiCentre speeches made by them. With fringe outfits like May 17 Movement and Dravida Kazhagam, which are known only as frontal organisations of the LTTE, too announcing their support to the general strike, there is fear among the police that the strike could turn violent. Security and Intelligence agencies were baffled by the burning of effigies of Prime Minister Narendra Modi and Congress president Sonia Gandhi by the protesters. The speeches delivered by Seeman and his associates after staging the demonstration were antiIndia in nature substantiating the fears expressed by intelligence agencies whether the secessionists were hijacking the agitation. Thursday’s attack on Indian Oil Corporation office at Teynampet and the tone of speeches delivered by MDMK leader Vaiko lambasting the Centre for the delay in constituting the Cauvery Management Board are seen as attempts by some organisations to beef up the anti-India feelings in Tamil Nadu. “The union government is cheating Tamils in the Cauvery issue,” alleged Vaiko.. N Kalyanasundaram, chronicler of Tamil Nadu’s political history, said the agitation in Tamil Nadu would fizzle out soon. “How do you expect Karnatala to release Cauvery water when there is no water with them? Let the Tamil Nadu farmers go to Karnataka and see for themselves the real state of affairs in the reservoirs. The agitations and bundhs are all unreasonable,” said Kalyanasundaram. SL Bhyrappa, noted historian and author based in Bangalore pointed out that the demand by Tamil Nadu for Cauvery water is unreasonable at this juncture. “The south west monsoon, the main source of water for Cauvery has been weak in 2016. It is almost over this year. But Tamil Nadu stands to gain by the North East Monsoon which is expected to hit the Tamil Nadu coast by October. Hence it is unreasonable for Tamil Nadu to demand for the non-existent water from Karnataka,” said Bhyrappa. ?^[XRTSTcPX]:P]]PSPPRcXeXbcbX] PQdbPbcWThfTaTcahX]Vc^T]cTa cWTAPX[fPhBcPcX^]c^bc^_caPX]b SdaX]VcWTXa_a^cTbc^eTa2PdeTah fPcTaXbbdTX]1T]VP[dad^] CWdabSPh ?C8 arnataka Chief Minister Siddaramaiah sought protection to Kannadigas and their properties living in Tamil Nadu over the State bandh call given by many Tamil organisations on Friday. In a letter written to Tamil Nadu Chief Minister J Jayalalithaa on Thursday Siddaramaiah requested her to ensure protection of lives and properties of Kannada speaking people. He said “I am deeply concerned that certain organisations have called for a bandh in Tamil Nadu tomorrow. You would agree that any escalation of animosity between the two States would be to the collective detriment of both the States.” “I would request you to kindly take all steps to ensure that during the so-called bandh on 16.09.2016, no untoward incident takes place and the lives and properties of Kannada speaking people in Tamil Nadu are protected,” the release said. Siddaramaiah also requested her to issue an advisory to the media to report “responsibly” the incidents relating to the Cauvery agitation as was done by his Government. The bandh has been called by farmers’ and traders’ bodies on Friday to protest against the “violence” targeting Tamils in Karnataka and seek a longterm solution to the water sharing issue. It is supported by DMK, MDMK, PMK, CPI(M), CPI and other Tamil outfits . Siddaramaiah said while the issue of Cauvery water sharing was being adjudicated by the courts and looked into by the Cauvery Supervisory Committee, no benefit can be accrued by anyone through bandhs and agitations. “We have issued an advisory to the media to report responsibly the incidents relating to the Cauvery agitation. I would request you to kindly do the same. “I have instructed my Additional Chief Secretary, Home and Director General of Police to be in touch with your authorities. I would request you to kindly advice your officers to be in touch with their counterparts in Karnataka,” he said. Voicing concern over incidents of violence against Kannada speaking people, ?^[XRTbcP]SVdPaSc^_aTeT]c _a^:Pa]PcPZPPRcXeXbcbUa^\ T]cTaX]VPcaPX]bcPcX^]c^bc^_ caPX]bX]P_a^cTbcPVPX]bccWT ad[X]V^Uc^_R^dac^]2PdeTah aXeTaSXb_dcTX]1T]VP[dad^] CWdabSPh 0? Siddaramaiah had on Monday written a similar letter to Jayalalithaa asking her to ensure their safety and protection while assuring her that interests of Tamils in the state would also be safeguarded. It was a mayhem in Bengaluru on Monday with dozens of buses and lorries with Tamil Nadu number plate being set on fire as mobs let out their fury over reports of some incidents of attack on Kannadigas and their properties in Tamil Nadu. It flared up soon after the apex court gave its amended order, directing Karnataka to release 12,000 cusecs of water daily to Tamil Nadu till September 20. Siddaramaiah also assured Jayalalithaa that Karnataka was committed to protect the lives :^[[hf^^Sc^QTPacWT Qad]c]^CP\X[UX[\b c^QTbW^f]X]:´cPZP :4BCDAE0BD:8Q 14=60;DAD T city Bengaluru and entire Karnataka is a major market for ITamil film industry, popularly :Pa]PcPZPC=6^ecbSaPfB2 U[PZU^aUPX[daTc^R^]ca^[\^Q ?8>=44A=4FBB4AE824Q =4F 34;78 he Karnataka and Tamil T Nadu Governments received flak from the Supreme Court on Thursday for failing to control the mob frenzy and destruction to public property caused by agitators protesting against the apex court’s order asking Karnataka to supply Cauvery water to Tamil Nadu as an interim arrangement for the rain-deficit months. Blaming both State Governments for the violence and subsequent damage, the Bench of Justices Dipak Misra and UU Lalit said, “People cannot take law into their own hands. Hence it is the obligation on part of both the States to pre- vent such actions…We are compelled and constrained to say that it’s the duty of the State to see no agitation or destruction or damage to property takes place.” The Bench was hearing a PIL filed by a Chennai-based social activist P Sivakumar who argued that what happened in Karnataka was a clear violation of apex court’s decision in 2009 where it was the responsibility of the State Government to prepare a report on the damage caused to public property and submit the same to High Court or Supreme Court. The petition sought to fix responsibility on the erring state authorities and assess damage among other remedial measures. The Bench posted the peti- tion for hearing along with the main dispute on Cauvery water sharing coming up on September 20. At the same time, the Court was critical of violent agitation being used as a means by general public to protest against a Court order. It said, “The fundamental purpose is that there should not be any kind of agitation when it relates to an order passed by this court. Any aggrieved party is under an obligation to take recourse to legal remedies for mitigation of grievance.” The Court had on September 5 directed Karnataka to release 15,000 cusecs of water per day to TN but following violent protests in Karnataka, SC revised its order and fixed 12,000 cusecs. and properties of all residents of Karnataka regardless of their religion or language” “I had pointed out to you in my previous letter of 12.09.2016 that incidents of violence against Kannada speaking people in Tamil Nadu would incite passions threatening peace in our state. Unfortunately, violence erupted on (Sept) 12th despite all the precautions taken by us,” he said. The Karnataka CM said, however, the situation was brought under control within hours and a large number of cases had been booked against rioters and strict action taken to ensure violence did not spread. “I have also issued strict instructions to the law and order machinery to ensure that such incidents are not repeated,” he added. known as Kollywood, and the Cauvery tension between two neighbours has dented the tinselworld and its market here. According to sources in the Karnataka Film Chamber of Commerce, no new Tamil Films will be released on this Friday and in entire Karnataka screening of Tamil films have been stopped. A senior official in the chamber said “Bengaluru is the only city in Indian where films from 8 languages are released. Apart from Kannada, English, Hindi, Tamil, Telugu, Malayalam, Konkani, Marathi films are released in Bengaluru on every Friday. Karnataka is a major market for all south Indian films and also to Tamil films”. “The tension has affected the release of Tamil Films on this Friday and hope the issue will be sorted out soon”, the source added. Tamil Films like Sumanth Radhakrsihanan’s Sadhuram 2, Trisha’s horror-comedy Nayagi will not be released this week in Karnataka. Last week, M Sasikumar’s Kidaari was removed from the theatres and release of Vikram’s Iru Mugan was also delayed. Whenever there is a tension between two States, obviously the film industry in both the States is hurt affecting its huge market. Many stars have tweeted for peace and want this tension to end. Kannada star Sudeep tweeted “#RequestPeace. What’s being damaged is the peace of ‘our’ State. Yes Justice needs to be done N I’m sure there WIL B ways to get there. Peace pls,” . “Pls Spread Peace.. Im sure the concerned will surely do the best to get justice,tat our State deserves…,” he added. “I also hope that at no cost should this issue jeopardise the relationship between the people of these two States, who have coexisted as neighbours. I hope we are able to overcome this crisis soon,” Tamil actor Simbu had said in a statement. “Let’s seek justice… But not with such inhuman violence. It’s painful to see children terrified. PEACE pleassss,” tweeted actor Prakash Raj. The film industry is interdependent and most of the big banner Tamil films are simultaneously released in Tamil Nadu and Karnataka. Rajanikanth or Kamala Hassan all of them are equally popular here. These stars have no borders and should play the messengers of peace. The State-wide bandh over the Cauvery issue on September 9 forced many Tamil Films to be withdrawn from the theatre across the State. ³6XP]cZX[[Ta´CPaX`7P\TTS:PaaP D`f^jRcRaV^fcUVc+D4gVcUZTedY`T\d<VcR]R 7TPacQaTPZX]VbPhbeXRcX\³b aTbXV]bUa^\?Pa[XP\T]c?3? I \^\*6^ecc^UX[TaTeXTf_[TP EA90H0A09Q :>278 <>78C:0=370A8Q 90<<D ne of the founding members of Peoples Democratic O Party (PDP) and sitting Member of Parliament from Srinagar Parliamentary constituency, Tariq Hameed Karra, often labelled as ‘giant killer’ ever since he defeated National Conference patriarch Dr Farooq Abdullah in the 2014 Lok Sabha polls, dealt a body blow to Mehbooba Mufti-led alliance Govt in the State on Thursday by announcing his resignation from the primary membership of the party and Parliament. Feeling suffocated and outraged over the manner in which the PDP-BJP alliance Govt was handling the ground situation in the aftermath of killing of Hizbul Mujahideen commander Burhan Wani, the former State Finance Minister, also considered Mufti Mohd Sayeed’s blue eyed boy, told the media in Srinagar, “I am resigning from Parliament and the primary membership of the PDP against the brutal policies of BJP at Centre and State Governments complete sellout and surrender before them.” Karra had earlier raised banner of revolt against the decision of top brass of the party to form an alliance Govt with the BJP in the State. Soon he had to eat a humble pie as he himself accompanied party’s senior MP Muzaffar Hussain Baig along with Mehbooba Mufti to stake claim for the formation of PDP-led alliance Govt in the State. Addressing a Press conference in Srinagar, Karra said, “Locking sufi shrines and mosques on Eid was a defining moment for me to take the final call.” Appealing to all other MPs, MLAs and MLCs to resign, he said, “I leave it to their conscience to decide whether they would like to side with helpless people or let the bloodshed be perpetuated by the RSS-backed BJP and facilitated by the PDP”. Reading out a lengthy statement, Karra said, “For the last more than a year, people are asking him questions to which he has no answer. They are asking about the human rights, selfrule, return of power projects, resuming talks between India and Pakistan, and the fate of political slogans. What happened to the party’s slogan of Grenade se na goli se, baat banaygi boli se? What happened to the philosophy of battle of ideas, which has turned into battle against ideas today?” He said his party was protesting the closure of mosques on Fridays and now it is doing the same and in fact going beyond. He said various mosques and shrines were literally locked by the Government to prevent people from praying on Eid. He said his party was against the pellets but when it assume power it started using more lethal ammunition on people. “My head would go down in shame on all these questions as I have no explanation to offer to these just queries.” Asked why he proposed Mehbooba’s name as party leader that eventually led her to become the CM, Karra said he had no choices, “I only preferred a lesser evil.” Another senior Parliamentarian and former Dy CM Muzaffar Husaain Baig had also suggested Mehbooba to resign within next six months if she failed to implement the ‘Agenda of Alliance’ agreed upon by the PDP-BJP. Reacting to Karra’s resignation, PDP general secretary Nizamuddin Bhat said, “It is unfortunate that he has resigned. He should have discussed the crisis with the party.” The National Conference on Thursday said the resignation of Karra reflected the gravity of situation in Kashmir and scale of “disaffection” for PDP’s “complete sell-out”. “Tariq Karra’s resignation reflected the gravity of the situation in Kashmir and also the enormity and scale of disaffection — both against PDP and within PDP — for its complete sell-out,” said NC spokesperson Junaid Mattu in a statement. “The NC has not asked for the dismissal of this State Government, nor have we asked Mehbooba Mufti to resign. These calls are coming from the topmost leaders in her own party and it is for her own conscience to decide what she would like to do. What lessons she draws from Karra’s resignation is a matter of her own conscience and morality,” said Mattu. In Jammu, historian Prof Hari Om told The Pioneer, Karra’s resignation, which was expected, has left the BJP with no other option but to either implement the divisive and pro-Pakistan agenda agreed upon in PDP-BJP agenda of alliance or come out of the Government. t was with shock and disbelief that Kerala on Thursday received the news of the Supreme Court’s verdict that set aside the death sentence awarded to the convict, Govindachamy, by the trial court and ratified by the High Court in the sensational case pertaining to the brutal rape and murder of 23-year-old Soumya in February, 2011. “The verdict is heartbreaking,” said Sumathy, mother of Soumya, through sobs and tears. Stating that such a verdict came from the apex court only because the lawyers engaged by the State Government handling the case were not good at arguments, Sumathy said, “We did not get justice. I will continue my struggle for justice.” According to the three-judge Supreme Court Bench which set aside the death sentence, the Prosecution had not been able to produce sufficient evidence to prove the charge of murder against Govindachamy, a handicapped Tamil Nadu native, and he deserved the benefit of doubt. The State Government said it would file a review petition in the apex court. The apex court said in the 21-page judgement that it was not interfering with the imprisonment, awarded by the trial court — and confirmed by the High Court — to Govindachamy, who had challenged the death sentence through an appeal, for rape, theft, trespassing and other proven charges. Govindachamy was accused of brutally raping Soumya, hailing from Shoranur in Palakkad district, in a deserted ladies compartment of the Ernakulam-Shoranur aside the death sentence. “The verdict would have been different if lawyer A Suresan (who was Special Prosecutor in the case in the trial court) had argued the case in the Supreme Court,” she added. A political war broke out in the State on Thursday over the apex court verdict with the Congress accusing the CPI(M)-led LDF Government of failing to handle the case properly. The CPI(M) and the Government denied the charge pointing out that it was the tions were held at several places in the State by the Yuva Morcha and the Youth Congress in protest against the verdict. Effigies of Chief Minister Pinarayi were burned by the protestors in many places. Dr Sherly Vasu, who had overseen the postmortem of Soumya’s body, insisted that she was pushed out of the train by Govindachamy himself. According to BA Aloor, counsel for the accused, Soumya had been denied justice. “Soumya would have got jus- C746>E4A=<4=CF>D;358;40 A4E84F?;408=C740?4G2>DAC 0=34=BDA4C7474;?>54558284=C ;0FH4AB5>A64CC8=69DBC8245>A C74E82C8<´B50<8;H Passenger train and murdering her by pushing her out of the slow-running train on the night of February 1, 2011 at a place just a few kilomentres away from her native village. Soumya was admitted to the Government Medical College Hospital, Thrissur in a critical condition. She died on February 6. The Fast Track Court-1 in Thrissur awarded death sentence to Govindachamy, who was arrested on February 2, on November 11, 2011 for murder and the High Court upheld that verdict on December 7, 2013. Amidst arguments in the case on September 8, the Supreme Court had observed that the Prosecution did not have evidences to establish that Govindachamy himself had murdered Soumya by pushing her out of the running train. Chief Minister Pinarayi Vijayan said on Thursday that the Government would file a review plea in the apex court and ensure the help of efficient lawyers for getting justice for the victim’s family while State Congress president VM Sudheeran said the verdict had literally shocked Kerala. State BJP chief Kummanam Rajasekharan also termed the verdict as unfortunate. Soumya’s mother said it was the Prosecution lawyers’ inefficiency and not the absence of evidences that had prompted the court to set ° 2<?8=0A0H8E890H0= previous UDF Government which had constituted the team of government’s lawyers for case in the Supreme Court. Former Chief Minister Oommen Chandy, during whose tenure the lawyers’ team for handling the case in the apex court was constituted, accused the present Government of committing grave mistakes by not ensuring discussions between that team and lawyer Suresan before the case came up in the Supreme Court. Law Minister AK Balan rejected the charge saying that Suresan had not provided help despite the legal team’s requests. At the same time, demonstra- BcPcT2^]V_aTbXST]c E<BdSWTTaP]bPXScWT eTaSXRcWPS[XcTaP[[h bW^RZTS:TaP[P BcPcT19?RWXTU :d\\P]P\ APYPbTZWPaP]P[b^ cTa\TScWTeTaSXRc Pbd]U^acd]PcT tice if the police had investigated the case properly and honestly and collected actual evidences. ]PcX^]& 347A03D=k5A830H kB4?C4<14A %! % 8f[3;ASR_\d`_ScR_U ?^[XcXRXbPcX^]^U_^[XRT QTWX]S[PfP]S^aSTa >`UZafS]ZTZdVdYZdRaa _a^Q[T\bX]D?)APY]PcW =0H0=30E4Q 60=378=060A n the poll-bound Gujarat where Patidar and Dalit agitations are continuously simmering, the ruling BJP is resorting on its biggest brand — Narendra Modi. Both Dalit and Patidar agitations are being led by two leaders in their early twenties — Jignesh Mevani and Hardik Patel. To counter them, State BJP leadership is aggressively promoting Prime Minister Narendra Modi’s mobile application. In order to make BJP Yuva Morcha’s workers conversant with the Modi’s mobile app, a booth has been erected at the State BJP headquarters ‘Shree Kamalam’ on the outskirts of State capital Gandhinagar to make them acquainted with the mobile application. Sources in the BJP said that these trained workers would meet youngsters in different educational institutional and encourage them to connect with Modi. I Even Gujarat Chief Minister Vijay Rupani too promoted the app saying that it would be a great opportunity for the people to connect and greet the Prime Minister through ‘Narendra Modi App’ on his birthday. Meanwhile, the Prime Minister is arriving Gujarat on Friday late in the evening to celebrate his 66th birthday in his home-State and to take blessings of his mother Hira Ba. According to official protocol, Modi is expected to arrive at Ahmedabad airport at around 11 pm and straight away drive down to Raj Bhavan in Gandhinagar where he will have night stay. On September 17, Modi will begin the day by visiting his younger brother Pankaj’s home to take blessings of nonagenarian Hira Ba around 8.30 am. After touching feet of mother, Modi would return to Raj Bhavan and will have important meeting with State BJP functionaries — including Chief Minister, Ministers and important office-bearers of the Gujarat BJP. After the meeting, he would travel to Limkheda near Dahod town in central Gujarat to inaugurate an irrigation project and address a huge gathering of tribal people. Post tribal rally, the Prime Minister would again fly to South Gujarat town Navsari and address Samajik Adhikarita Shibir around 4.50 pm. Post this function, he would reach at Surat airport and travel back to Delhi by an Indian Air Force aircraft. Sources in the Gujarat Administrative Department (GAD) said that Modi would use road routes from Ahmedabad to Gandhinagar on Friday and to reach at his brother’s place on Saturday morning. For Limkheda in Central Gujarat and Navsari functions, the Prime Minister would travel by helicopter, said the official source. Ballia (UP): Union Home Minister Rajnath Singh on Thursday held “politicisation” of the police force responsible for law and order problems in Uttar Pradesh. “Police should not be misused for political purposes. It is capable of handling big criminals. For development, law and order is a must. Due to politicisation of force, law and order problems rise,” he said. On the ongoing dispute in the Samajwadi Party, Rajnath said, “There is a law and order problem in the SP Government, and the dispute is affecting the common man.” The Union Minister claimed, the State Government should give accounts of the huge amounts of money it received from the Centre for natural calamities. Exuding confidence on BJP’s victory in the election next year, Rajnath said the party was given “sanyas” in CWTaTXbP[PfP]S ^aSTa_a^Q[T\X]cWT B?6^eTa]\T]cP]S cWTSXb_dcTXbPUUTRcX]V cWTR^\\^]\P] 2002 by the State’s people, now after “14 years of exile” it will return to power. “It is a matter of pride that in over two years (at the Centre) no one could charge any Minister with corruption,” he said. Rajnath was here to attend a function on death anniversary of former MP Harikewal Prasad. PTI 6YWXdgYdXY^C@cVYbcdVQ]Y\iTeUd_ CRZ_WRZ]de`UR^aV_ cU\VYcX^UUTc^_dXY^WU\cU*=QiQ daZcZed`W8R_VdY UVg`eVVdZ_9jUVcRSRU C ?=BQ ;D2:=>F alling the ongoing feud within the Yadav family as a well-orchestrated drama to divert public attention from the failure of the SP Government, Bahujan Samaj Party (BSP) chief Mayawati on Thursday advised SP chief Mulayam Singh Yadav to “shun love for his son” and “to quit politics as it is the right time to retire”. “It is better for the people of UP and best for the State that Mulayam Singh quits politics. The fight within the SP’s first family is due to selfish needs and nothing else,” she said. She claimed there are dozens of people in the Yadav family who are active in politics and all have their ‘own personal interests’. “Reports of intra-family feud keep on emanating from time to time. But at election time, it seems to be a well thought out script to divert public attention,” she asserted. In a statement released after addressing a meeting of senior leaders at the State BSP headquarters in Lucknow on Thursday, Mayawati said that the SP Government has failed in all sectors and now by pretending that there was a family dispute, the SP was only trying to deflect attention of the masses. “The extraordinary love for his son by the SP chief is damaging the State and hence he should retire from politics,” she added. “The development of UP during the SP regime is merely on papers or through advertisements by misusing public funds. Law and order in the state has worsened while all development works havecome to a standstill,” she alleged. ><4A50A>>@Q 7H34A0103 mid tight security arrangements thousands of Idols A of Lord Ganesh were immersed in Hussain Sagar and 12 other lakes of Hyderabad as the 11-day long Ganesh Chaturthy festival came to an end on Thursday. Heavy downpour which brought the city to a grinding halt from this morning failed to dampen the spirits of the devout as massive number of people turned up to bid the adieu to the elephant-faced God. Khairatabad Ganesh, tallest in the city with a height of 58 feet was among the first to be immersed in Hussain Sagar. Usually this used to be the last big idol to be immersed every year this time organisers agreed to be first for the convenience of the people. Police officials wanted the routine to be changed as last year it was immersed on the second day creating massive jam creating serious problems for the office bearers. Arrangements for putting the 58 feet gigantic idol on a special open trucks had started around midnight last night and the procession started early in the morning despite heavy rain. Finally it reached Tank bund around 1 pm and a huge crane immersed it in the lake at 1:50 pm. Meanwhile, the Balapur Ganesh procession started at around 11 am and crossed the historic Mecca Masjid Charminar complex at around 4 pm. Now it was moving towards Moazzam Jahi Market. Thousands of idols of other areas have also joined the procession at different points including Charminar and Moazzam Jahi Market. The never ending line of the heavy trucks carrying colourful idols in various sizes and shapes and the huge gathering of onlookers brought the normal flow of traffic to a full stop. The arterial road from Charminar to the Hussainsagar lake was barricaded on either aides and other vehicles were not allowed. Hyderabad City Police Commissioner M Mahinder Reddy said that the procession was so far peaceful and no untoward incident was reported from any where. 3Te^cTTbX\\TabX]V;^aS6P]TbWXS^[bPc6XaVPd\2W^f_PcchX]<d\QPX^]CWdabSPh ?C8 0XPEDLNDUVELGHPRWLRQDO DGLHXWR/RUG*DQHVK C=A06C7D=0C70Q <D<108 akhs of Mumbaikars were in their element on L Thursday as they joined most colourful Ganpati idol immersion processions to bid an emotional goodbye to the elephant-headed God after the 10day-long festivities, amid loud but rhythmic drum beats and chants of “Ganpati bappa morya, pudhchya varshi lavkar ya” (Hail Lord Ganesh, do come back early next year). With the Island city and its suburbs having come under thick security blanket, the major Sarvajanik Ganesh idols — including Mumbai’s prestigious Lalbaugcha Raja Ganapati idoli and “Mumbai Cha Raja” — made their way through their from Lalgau in south central Mumbai and passed through Sane Guruji Marg, Byculla west, Nagpada, Suthar Galli, CP Tank, VP road, Opera House, before reaching the Girgaum Chowpatty in south Mumbai at around 9 pm. Both the major Ganpathi idols, which had left Lalbaug at around 11.30 am, took more than nine and a half hours before they reached the Arabian Sea waterfront of Girgaum Chowpatty, where the immersions of small and big Ganesh idols had begun earlier in the afternoon. Like every year, various State-Central Government, civic agencies, Ganpati Mandals and voluntary organisations including the city police, BMC, Navy and Coast Guard, had made elaborate arrangements to ensure the smooth conduct of the immersion proceedings, which was slated to go on till the small hours of Tuesday. In an effort to ensure against any untoward incident in the Ganapati immersion procession routes, the Mumbai police had set up CCTV cameras at strategic places As many as 44,000-odd police personnel, 1o companies of State Reserve Police (SRP), two companies of Rapid Action Force (RAF) personnel and Indo-Tibetan Border Police (IRBP) personnel and 100 home guards were deployed along the procession routes and at the various immersion sites. As many as 7,000 BMC employees were present at various natural and artificial immersion venues. Informed sources that as many as 12,000 huge idols installed by as many Sarvajanik Mandals and at least 2,20,000 domestic idols were immersed at 69 natural and 31 artificial immersion spots this year Like every year, there was a huge turnout of people at various other immersion sites across the city, including Dadar Chowpatty, Juhu Chowpatty, Marve beach, Madh Island, Powai lake, Madh Island, Manori Beach, Gorai beach,Mahim beach, Aarey lake, the Mithi River, its branches and various artificial lakes. The Indian Coast Guard (ICG) had made elaborate arrangements as part of its “Operation Utsav” for’ for pro- viding seaward security and safety cover to the people Mumbai during Ganesh immersion “We had deployed on helicopter, on hovercraft, a fast patrol vessel and interceptor boat for carrying out random patrols during the immersion day. We are being extra vigilant and provide surveillance against seaward threats and assisting civil authorities during Ganpati Visarjan,” ICG spokesperson Commandant Sujeet Dwivedi said. On their part, the Mumbai police had set up as many 58 control rooms set up at major waterfronts, including Girgaum and Dadar chowpatties to keep a close watch of the proceedings. The BMC had kept in readiness at least 600 life guards and 81 motor boats to ensure against any mishap during the immersion proceedings. Maharashtra chief minister Devendra Fadnavis Fadnavis carried en eco-friendly Ganpati idol installed at his official residence “Varsha”at Malbar Hills and immersed it in an artificial lake created near the Mayor’s bungalow at Shivaji Park in north-central Mumbai. Though drowning cases are a common feature on the immersion day every year, the BMC’s disaster control room late on Thursday night that no mishaps had been reported from any part of the city. Meanwhile, the city traffic police had closed several major roads across the city for traffic, to ensure smooth passage of Ganpati processions through their designated routes. ^_X]X^]' 347A03D=k5A830H kB4?C4<14A %! % gggTQY\i`Y_^UUbS_] aRaVchZeYaRddZ`_ AR\ZdeR_^fdeR_dhVc ,QGLDGRHVZHOOWRUDLVH3R.%DORFKLVWDQDW81 aX\T<X]XbcTa=PaT]SaP<^SXfPb`dTbcX^]TSQhbRT_cXRbfWT]WTaPXbTS cWT XbbdT ^U Wd\P] aXVWcb eX^[PcX^]b X] ?PZXbcP]^RRd_XTS :PbW\Xa P]S 1P[^RWXbcP]SdaX]VWXb8]ST_T]ST]RT3Phb_TTRWCWThbPXSXcfPbP]PccT\_c c^SXeTac_dQ[XRPccT]cX^]Ua^\cWT6^eTa]\T]cb²UPX[daTc^R^]cPX]cWTd]aTbc X]:PbW\Xa*P\TaTcXcU^acPcU^a?PZXbcP]bR^]bcP]c]TTS[X]V^U8]SXP*P]ScWPc Xcf^d[SSP\PVT8]SXPbRPbTX]cTa]PcX^]P[[h^]:PbW\Xa8]bW^accWThR[PX\TS ?aX\T<X]XbcTa<^SXfPb_PhX]V[X_bTaeXRTc^cWTRPdbT^U1P[^RWXbcP]P]S?^: CWXbWPbcda]TS^dcc^QT\Xb_[PRTSRaXcXRXb\CWT6^eTa]\T]c^U8]SXPWPbcPZT] cWT]TgcbcT_X]fWPcXbPR[TPa[hSTUX]TSbcaPcTVhc^X]e^ZTcWT_[XVWc^UcWT_T^ _[T^UcWTcf^aTVX^]bQhaPXbX]VcWT\PccTaPccWTD=7d\P]AXVWcb2^d]RX[ X]6T]TeP1hcT[[X]VcWT2^d]RX[cWPc?PZXbcP]fPbdbX]VbcPcT_^fTac^bd_ _aTbbcWTPb_XaPcX^]b^U_T^_[TX]1P[^RWXbcP]P]S?^:8]SXPT]e^h0YXc:d\Pa WPbbW^f]cWT\Xaa^ac^8b[P\PQPS7TQ[d]cTScWTR^]bcP]caTUaPX]Ua^\?PZXbcP] ^eTaP[[TVTSWd\P]aXVWcbeX^[PcX^]bQh8]SXP]bTRdaXchU^aRTbX]9P\\d:PbW\Xa QhaT\PaZX]V°8cfX[[QTX]cWTUXc]Tbb^UcWX]VbXU?PZXbcP]U^RdbTbXcbT]TaVXTb ^]X\_a^eX]VcWTWd\P]aXVWcbbXcdPcX^]fXcWX]?PZXbcP]P]S?^:±FTRP]aTP b^]PQ[hQTbdaTcWPccWXbXbYdbccWTQTVX]]X]V8]SXPP__TPabSTcTa\X]TSP]S aXVWc[hb^c^d_cWTP]cTP]S]P\TP]S bWP\T?PZXbcP]X]UdcdaT^]cWTbTcfX] XbbdTbPcTeTah_^bbXQ[TV[^QP[U^ad\ 8c Xb ^] UXa\ Va^d]S WTaT bX]RT cWT _T^_[T^U?^:P]S1P[^RWXbcP]WPeT ^_T][h aTQT[[TS PVPX]bc 8b[P\PQPSb PdcW^aXcPaXP]Xb\CWTaTXb]^R^\_Pa Xb^]QTcfTT]cWTSTeT[^_\T]cbX]9: P]SX]1P[^RWXbcP]P]S?^:9P\\d :PbW\XaWPbPST\^RaPcXRP[[hT[TRc TS 6^eTa]\T]c cWa^dVW P UPXa P]S caP]b_PaT]c_a^RTbbfWXRWWPbQTT] PRZ]^f[TSVTScWTf^a[S^eTa8cWPb Pa^Qdbc\TRWP]Xb\c^cPRZ[TVaXTe P]RTb^UcWT_T^_[TCWTaTXb]^bdRW bhbcT\_aTeP[T]cX]1P[^RWXbcP]P]S ?^:ATbXST]cb^U?^:aTRT]c[hc^^Z c^ cWT bcaTTcb c^ _a^cTbc PVPX]bc aXVVTS T[TRcX^]b fWX[T cW^bT X] 1P[^RWXbcP]WPeT]TeTaQTT]cad[hX]cT VaPcTSX]cWT?PZXbcP]X\PX]bcaTP\ CWXbbcaPcTVhbW^d[SWPeTQTT]bWP_TSP]SX\_[T\T]cTShTPabPV^CWT_aT eX^db2^]VaTbb[TSD?06^eTa]\T]cfPbc^^\TTZc^PS^_cbdRWPQ^[SSTeX PcX^]Ua^\PfT[[ca^SST]_PcWcWPcWPS[TSdb]^fWTaT2^d]cTaX]V?PZXbcP]b ^UUT]bXeT Qh cWa^fX]V Pc Xc cWT Pca^RXcXTb Xc WPb QTT] R^\\XccX]V X] ?^: P]S 1P[^RWXbcP]fPbR^]bXSTaTSaXbZh2^]eT]cX^]P[fXbS^\fPbcWPcXcf^d[SbcaT]VcW T]?PZXbcP]bRPbTeXbveXb 9:P]ScWPcXcf^d[S\PZT\PccTabf^abTU^a=Tf 3T[WX1dcfWPcf^abTRP]?PZXbcP]S^]^f.BX]RT_PacXcX^]XcWPbcaXTSc^b]PcRW cWTaTVX^]PfPhcWa^dVWR^]eT]cX^]P[fPabP]SQh^cWTa\TcW^SbbdRWPbX]UX[ caPcX]V8]SXPfXcWbcPcTb_^]b^aTS\X[XcP]cb 8]P[[cWTbTSTRPSTb8]SXP]TeTaaPXbTScWT1P[^RWXbcP]XbbdTfXcW8b[P\PQPS ]^aSXSXcQaX]VXcd_^]X]cTa]PcX^]P[_[PcU^a\b0]ShTc?PZXbcP]WPbaT_TPc TS[hPRRdbTS=Tf3T[WXfXcW^dc_a^eXSX]VTeXST]RT^U8]SXP]X]e^[eT\T]cX] cWT1P[^RWd]aTbc8]SXPcWTaTU^aTWPS]^cWX]Vc^[^bTP]STeTahcWX]Vc^VPX] Qh_X]]X]V?PZXbcP]^]cWT\PccTa=^fXc\dbcUPe^daPQ[hR^]bXSTaaT`dTbcb U^aPbh[d\Ua^\RaTSXQ[T1P[^RW[TPSTab ? EYZ_\YVR]eY_`ea`]ZeZTd 'HOKLIDFLQJFULVLVVWRSVFRULQJSHWW\SRLQWV WTR^\X]Vc^P]T]S^UcWTQ[P\TVP\T^eTacWTWP]S[X]V^UeTRc^aQ^a]T SXbTPbTb[XZTRWXZd]Vd]hPP]SST]VdTX]3T[WXfX[[W^_TUd[[hbcaTP\[X]TP]S UPbcU^afPaScWTcaTPc\T]c^U_PcXT]cb0d]XcTSfPa[Pd]RWTSQhcWT3T[WX 6^eTa]\T]cX]R^\_[TcTR^^_TaPcX^]^UcWT2T]caTP]ScWT;XTdcT]P]c6^eTa]^a ;6^U3T[WXfX[[aT[XTeTeXRcX\bP]S^aSX]PahRXcXiT]b^UcWTRP_XcP[P]SPSY^X] X]VPaTPb^UcWTRXchCW^dVWPbTT\X]V[h[^]VcdV^UfPaQTcfTT]cWT;6P]S cWT0aeX]S:TYaXfP[6^eTa]\T]cWPbbWXUcTScWTU^RdbUa^\cWTX]RaTPbX]VWTP[cW \T]PRThTccWTRdaaT]cRWP]VTX]PccXcdSTP\^]VcWTc^__^[XcXRP[Ud]RcX^]Pa XTbRP]QTaTVPaSTSPbP_^bXcXeTbXV]P[Pc[TPbcU^acWTbPZT^UUXVWcX]VcWTSaTPS TS\^b`dXc^Tb8cXbV^^ScWPcX]bcTPS^UcWTTPa[XTa_PbbX]VcWTQdRZPdcW^aX cXTbWPeTQTVd]cPZX]VcWT\dRW]TTSTSPRcX^]8]STTSXcXbcWTRXch³b\d]XRX _P[R^a_^aPcX^]bcWPc\dbcT]bdaTcWPccWT_aX\PahWTP[cWRPaTUPRX[XcXTbPaT\PST aTPSX[hPePX[PQ[TU^aX\\TSXPcTcaTPc\T]c^URWXZd]Vd]hPeXadb278:EFXcW \^aTcWP] STPcWbP]S^eTa _T^_[TaT_^acTS[hbdUUTaX]VUa^\cWTeTR c^aQ^a]TSXbTPbTcWT\d]XRX_P[R^a_^aPcX^]bP[^]VbXSTcWT3T[WX6^eTa]\T]c \dbcbTTc^XccWPccWT_a^Q[T\S^Tb ]^cb_aTPSUdacWTa 8cXbSXbWTPacT]X]Vc^[TPa]cWPccWT 3T[WX6^eTa]\T]cad]W^b_XcP[bPaT ]^cT`dX__TSfXcWcWTRaXcXRP[²aTeTabT caP]bRaX_cX^]_^[h\TaPbTRWPX]aTPR cX^] AC?2A UPRX[XcXTb U^a cTbcX]V fWXRWRP]WT[_\TPbdaTcWTeXaP[[^PS X] bTad\ bP\_[Tb ^U cWT _PcXT]cb CWdbcWTAC?2ARP]QTdbTSUdacWTa Pb P c^^[ U^a UPbcTa STcTRcX^] ^U cWT 278:EP]S\^]Xc^aX]VcWTb_aTPS^U cWTaT_[XRPcX^]^UcWTeXadbX]^cWTaed[ ]TaPQ[TcPaVTcb0b278:EXbP\^b `dXc^caP]b\XccTSP[_WPeXadbRPdbTS \PX][hQhcWT0TSTb PTVh_cXcWTb_T RXP[U^VVX]V_a^VaP\\Tba^[[TS^dcQh cWT \d]XRX_P[ R^a_^aPcX^]b X] TPRW fPaS^UcWTRXchfX[[QT^UVaTPcWT[_ U^a_aTeT]cX]VcWT\T]PRT0SeXb^aXTb XbbdTSc^cWTRXchbRW^^[bU^aX]bcadRcX]VRWX[SaT]c^fTPaUd[[b[TTeTb\Ph[TbbT] cWT]d\QTa^URPbTbP\^]VcWT\PbcWThPaT\^aTed[]TaPQ[Tc^bdRWSXbTPbTb cWP]cWTT[STab 8cXb]^ccWPccWT278:EcTaa^aWPbR^\Tc^cWTRXchU^acWTUXabccX\T1PbXR WTP[cWRPaTUPRX[XcXTbX]RXchW^b_XcP[b_PacXRd[Pa[hPccWT_dQ[XRW^b_XcP[bbX]RTcWTh PaTUaT`dT]cTSQhcWT\^bc]TTShbW^d[SWPeTQTT]P[aTPShd_VaPSTSc^cPRZ [TcWTbP\TFWhXbcWTaTbdRWR^]cX]dTSP_PcWhc^fPaSbcWT\PX]cT]P]RT^U cWTRXchP]ScWT_dQ[XRWTP[cWUPRX[XcXTb.FWhS^fTR^\_[PX]P]SPRc^][hfWT] P]T\TaVT]RhbXcdPcX^]bcaXZTbdb.CWT6^eTa]\T]cbW^d[S]^c]TV[TRc_dQ[XR W^b_XcP[bX]cWTW^_TcWPc_aXePcT^]TbfX[[S^cWT]TTSUd[<TP]fWX[T_T^_[T \dbcQT\PST\^aTPfPaTPQ^dccWTbh\_c^\b^UcWTbTSXbTPbTbP]ScWTh\dbc ST\P]SQTccTaUPRX[XcXTbPc[^RP[WTP[cWRT]caTbfWXRWcWThRP]P__a^PRWX\\T SXPcT[hCWdbQ^cWPfPaT]TbbP]SPST`dPcTWTP[cWRPaT\dbcR^\Tc^VTcWTaX] cWTRP_XcP[RXchUXabc C 3RSXOLVWUHYROWQRWGXH WRJOREDOLVDWLRQLPSDFW 0;;8BC4A740C7 CWTfT[UPaTbcPcTbX]WTaT]cSTUTRcb\TP]cWPc_T^_[TUTT[RPdVWcd_X]P7^QQTbXP]fPaU^aaTb^daRTb1dccWT \XSS[TR[PbbTbbW^d[SSXaTRccWTXaXaTc^fPaSb_^[XcXRXP]bP]SRT]caP[QP]ZTab]^cUaTT\PaZTcb^acTRW]^[^Vh t’s a story we have all become familiar with, a facile narrative that we keep being told explains everything from the rise of Donald Trump to Brexit. It goes something like this: Globalisation, technology and capitalism have helped the highly educated; the welfare state has bailed out the poor; but the middle classes have been hammered and hollowed out. Their old jobs are gone, replaced by precarious, lower paid roles, and their living standards are stagnating, at best, and in free fall, at worst. The result has been a rebellion: Millions of blue and white collar workers are backing populist candidates across the Western world. The new conventional wisdom is that if the Centre-Left and Centre-Right are to have a future, they must dilute their support for free trade, tax the rich to “redistribute” the proceeds of globalisation and embrace new forms of industrial policy. There’s just a problem: This explanation is completely wrong. The supposed facts mentioned are almost all the reverse of the truth. Capitalism and globalisation are still working — for the many, not just the few. The middle classes in the UK and America are getting richer again. Inequality is diminishing. There are many problems, of course, but they are primarily down to the fact that the impact of the Great Recession ended up dragging on for years, with the previous misallocation of resources and capital wiping out a decade’s worth of productivity gains. Three important pieces of evidence published this week confirm that we would be mad to give up on capitalism. The first was the news that American workers — including the country’s vast middle class — have enjoyed their best pay rises since 1965. Last year’s 5.2 per cent rise in real median household income is the largest rise ever recorded. Remarkably, it was the best ever increase for all income deciles apart from the top 20 per cent of earners. The bottom 10 per cent saw their income surge by 7.9 per cent; the top 10 per cent by 2.9 per cent. Income inequality on the Gini index has slumped over the last two years: America is becoming more equal, not less. The middle class is expanding, and the poverty rate fell from 14.8 per cent to 13.5 per cent, its biggest I drop since 1968. The figures still show that median incomes are lower than they once were, and had already reached their present level first in the late Eighties and then in the Nineties. However, with the median household income today just 2.4 per cent lower than its 1999 peak, it’s now all to play for, with a return to genuine income growth finally on the cards. The reality is that the official data is probably too pessimistic: the median American lives in a bigger house and has access to a myriad of goods and services that didn’t exist 30 years ago. It is hard to believe that living standards have genuinely stagnated for so long, despite higher healthcare costs. The second piece of the puzzle came from the Resolution Foundation. In a remarkable piece of work, Adam Corlett, an economist, has demonstrated that it isn’t true that low and middle incomes in the rich world have stagnated. His main target is the ‘elephant curve’ theory of globalisation proposed by Christoph Lakner and Branko Milanovic. 9Q]^_dcSQbUT_V Q^iXYWXS_]]Q^T 9QSSU`dUTdXU 3U^dbUµcc`USYQ\ `QS[QWUV_bdXU W__T_VdXUCdQdU 1^TXbQ@bQTUcX3= °3XQ^TbQRQRe >QYTe 2>A;4CC70B 2AD=2743C74 =D<14AB0608= 0=35>D=3C74< F0=C8=674 34<>=BCA0C4B C70CC74<833;4 2;0BB4B=>C9DBC C7478674BC>5 40A=4AB70E4 3>=4F4;;8= <0=HA827 2>D=CA84B Dubbed “the most powerful chart of the last decade”, it looks like an elephant with its trunk sticking upwards, and is supposed to represent the income gains made by the world’s population between 1988 and 2008. The very poor — the bottom of the elephant’s tail — didn’t gain much, the citizens of the high growth emerging economies — the elephant’s back — did well, and the Chinese — the top of its head — jumped ahead. But the Western middle class — the lower part of the trunk – stagnated — while the global top 1 per cent — the top of the trunk — did wonderfully. Geeks love this sort of stuff. But Corlett has crunched the numbers again, and found them wanting. He demonstrates that in fact the middle classes, not just the highest of earners, have done well in many rich countries. All income groups have progressed dramatically since the late Eighties in the UK; and they have also done reasonably in countries such as France, Spain and Italy, though their weaker GDP growth was translated into commensurately lower B>D=318C4 income growth. There has been no universal hollowing out. The UK is more open to trade than Americam yet our middle class has done better than America’s. The answer, Corlett argues, lies with domestic policy: In countries where incomes have stagnated or declined for some, factors such as housing costs or the Great Recession are to blame. It is nonsense to pin everything on global forces. Politicians should blame themselves, not the multinational corporations. The final piece of the jigsaw came from the Office for National Statistics. The average UK worker’s total pay rose 2.3 per cent year on year, a lot higher than inflation of 0.6 per cent, a decent but not spectacular national pay rise. There are always losers as well as winners from capitalism, globalisation and technology. Old industries have collapsed. Some workers earn less. But while traumatic, such changes are necessary to ensure that economies can rejuvenate themselves. What the Western middle classes now need are as many years as possible of unbroken economic expansion: After the chaos caused by the financial crisis, the old relationship between an increase in the Gross Domestic Product and a rise in wages has finally reestablished itself. This is a hugely encouraging development. So why the rise of populism? While wages are finally improving, there has been no return to boom times. Millions of younger people are despairing at exploding housing costs, fuelled by government-created low supply and rock-bottom interest rates; older workers are facing a nightmarish pensions crisis, also created by ultraloose monetary policy. Voters feel culturally disconnected; they rightly voted for Brexit because they realised that democratic control was being destroyed by technocratic unaccountability. The welfare state’s inherent defects mean that people feel caught up in a Hobbesian war for resources — school places, hospital beds — of all against all, especially with high levels of immigration. But the middle classes should direct their ire towards politicians and central bankers, not free markets or technology. (Courtesy: Daily Telegraph) (The writer is deputy director of content and deputy editor at The Telegraph) DXU`Qbdi\UQTUbcXY` ]QTUQ]YcdQ[URi bU]_fY^W1[XY\UcX IQTQfQcCdQdUSXYUV 2UY^Wd_\TX_gW_Y^W d_QdU]`\U]Q[Uc ]UQ^_^=ec\Y]Yc `\QY^SQ\\_ec>__^U XQcdXUbYWXdd_cQi dXQd8_gT_UcYd QVVUSdQ^i_^U/ CQ]QZgQTY@Qbdi=@ °BQ]7_`Q\IQTQf 1Sd_b °C_XQ1\Y;XQ^ ;4CC4ABC>C74438C>A @_\YdYSQ\WQ]R\U Sir — This refers to the editorial, “Samajwadi Party tussle” (September 15). Tension had been brewing within the Yadav family ever since Akhilesh Yadav was made the Chief Minister of Uttar Pradesh. There is no doubt that Samajwadi Party chief Mulayam Singh Yadav will not leave any stone unturned to restore peace in the family, but it is easier said than done. In a three-cornered fight, such a development will only act as an advantage to both the Bahujan Samaj Party and the BJP. And even if this ongoing rift is resolved, now that Shivpal Yadav has been made the party’s chief in Uttar Pradesh, there will be direct conflict between the Chief Minister and Shivpal Yadav. Whichever way this situation turns, Uttar Pradesh will witness one of the most intense elections in a high-stake political game. Bal Govind Noida 1\\`QbdYUc]Q^ Sir — This refers to the report, “ADMK inducts record members” (September 15). Subburaman Thirunavukkarasar has come to 2ddVceZgV2\YZ]VdYYRd dfcacZdVUYZdV]UVcd C WXbaTUTabc^cWTTSXc^aXP[°BP\PYfPSX?Pachcdbb[T±BT_cT\QTa $CWT b`dPQQ[TQTcfTT]DccPa?aPSTbW2WXTU<X]XbcTa0ZWX[TbWHPSPeP]SWXb d]R[TBWXe_P[HPSPeXb]^[^]VTaPbTRaTc>[ScX\Tab[XZTBWXe_P[HPSPe PaT\XUUTSfXcWcWTfPhcWT²h^d]VP]SaPf³0ZWX[TbWHPSPeWPbQTT]V^e Ta]X]VCWT\dRWQTaPcTS0ZWX[TbWHPSPefW^WPbQTT]PccWTaTRTXeX]VT]S ^UU[PZU^acWTSTcTaX^aPcX]V[PfP]S^aSTaX]cWTBcPcTP__TPabc^QTX]P SP\PVTR^]ca^[\^STfXcWPbTaXTb^USTeT[^_\T]cP[X]XcXPcXeTb 0ZWX[TbWHPSPebaT\PaZb^]cPZX]VWXb²^f]STRXbX^]b³P]SWXbVa^dbT ^eTa²^dcbXSTab³WPa\X]VcWT_PachXbP]X]SXRPcX^]cWPcWTXbWTaTc^bcPh7^fTeTa BWXe_P[HPSPeb_^_d[PaXchX]cWT_PachfXcW[^PSb^UTg_TaXT]RT\TP]bcWPc cWTd]R[T]T_WTfQPcc[TfX[[]^cSXTb^^]D]S^dQcTS[hBP\PYfPSX?PachRWXTU <d[PhP\BX]VWHPSPeXbcWTcP[[Tbc[TPSTafW^RP]SaPfe^cTb^]WXb^f] QdcWXbPVTP]SX[[WTP[cW\Ph_aTeT]cWX\Ua^\PRcXeTRP\_PXV]X]V7T\Ph WPeTc^cPZTPRP[[b^^]^]fW^bTbcTfPaSbWX_cWT_Pach\dbcUXVWc_^[[b 6P]P_PcWX1WPc 0Z^[P experiment himself with partyhopping. Perhaps, he must be the only one to have a unique record of having been a member of almost all political parties in Tamil Nadu, except the communist ones. SA Sharma Via web 3_^cUbfUgQdUb Sir — This refers to the editorial, “Mayhem over Cauvery” (September 14). The cultivation of water-intensive crops such as hybrids and GM crops, apart from depletion of groundwater, is resulting in conflicts. Natural farming helps build humus and the water retention capacity of soils, hence it should be the way forward for both Tamil Nadu and Karnataka. Lessons need to be drawn from the fate of Noyyal, a Cauvery tributary that flows through Coimbatore, which has turned ‘dead’ due to toxic untreated textile industry effluents. The onus lies more on Tamil Nadu to curtail dependence on its neighbour and usher in water self-sufficiency, since it suffers the disadvantage of being at the receiving end, both literally and metaphorically. CV Krishna Manoj Hyderabad @QcdU^TUQf_ebc Sir — This refers to the article, “Kashmir blunder that bleeds us to this day” (September 13) by A Surya Prakash. The Nehruvian blunder on referring the Pakistani invasion on Jammu & Kashmir to the UN Security Council on January 1, 1948, against the advice of Sardar Vallabhbhai Patel, when the Indian troops were about to throw out the aggressors in a few days, is so monumental and reprehensible that no amount of generosity or respect for our first Prime Minister’s role in the freedom struggle and independent India’s initial years, can possibly white-wash it. The author has rightly quoted the IAF chief, Air Marshal Arup Raha’s remarks that Nehru’s tragic thoughtlessness keeps India ‘bleeding to this day’. Alongwith another colossal disaster of Nehru’s romanticism — Hindi-Chini bhaibhai — that occurred in war with China in 1962, Nehru will down in modern Indian history as a Prime Minister whose errors of judgement created serious problems for the nation, some of which remain. M Ratan Via email BT]Shh^daUUTTSQPRZcc^) [TccTabc^_X^]TTa/V\PX[R^\ "aSThT( 347A03D=k5A830H kB4?C4<14A %! % @?9>D2>D=C4A@?9>D BWPWPQdSSX]baT[TPbTUa^\YPX[fPb bcPVT\P]PVTSCWT1XWPa6^eTa]\T]c ST[XQTaPcT[hSXS]^c[TccWTcaXP[QTVX] °19?[TPSTa BDB78;<>38 %HQHILWVRID QHZFDOHQGDU CWTR^]ca^eTabh^eTaBWPWPQdSSX]VTccX]V QPX[XbPRaTPcX^]^UcWT19?P]ScWT\TSXP >][hcWTR^dacbRP]STRXSTbdRWcWX]Vb °A93RWXTU ;0;D?A0B03 EYZ_\Z_X`W]Rde^R_Z_eYV]Z_V 0SeP]RT\T]c^UcWT1dSVTcSPcTfX[[ 'HYHORSPHQWVDFURVVWKHZRUOGUHFHQWDQGLQWKHSDVWGHFDGHVDQGFHQWXULHVKDYHVKRZQWKDWJURZWKDQGSURVSHULW\ T]bdaTR^\_[TcX^]^UP[[[TVXb[PcXeT FDQQRWFRPHE\SDPSHULQJDVHOHFWIHZDQGKRSLQJWKHHOLWHZLOOWKHQZULWHDODUJHUDQGPRUHLQFOXVLYHQDUUDWLYH f^aZbQTU^aTcWTbcPac^UUX]P]RXP[hTPa enough money to pay for education amata Banerjee has won ]!cWT=306^eTa]\T]cd]STacWTcWT]?aX\T <X]XbcTa0cP[1XWPaXEPY_PhTTbfXcRWTScWTcX\X]V ^UcWT_aTbT]cPcX^]^UcWT1dSVTcUa^\cWTRdb c^\Pah$_\c^ P\FWX[TcWXb\^eTfPbbh\ Q^[XRcWTRdaaT]c=30SXb_T]bPcX^]WPb]^fcPZT] P\PY^abcT_QhST[X]ZX]VcWXbTgTaRXbTUa^\cWTeTb cXVTb ^U R^[^]XP[ aPY CWT <^SX6^eTa]\T]cXb[XZT[hc^ PSeP]RTcWT_aTbT]cPcX^]^U cWT1dSVTcUa^\cWT[PbcSPh ^U5TQadPahc^cWT[PbcfTTZ ^U9P]dPah^acWTUXabcfTTZ ^U5TQadPahCWXbfX[[d][TPbW WdVTQT]TUXcb D]STa cWT TgXbcX]V PaaP]VT\T]cQhcWTcX\TcWT 5X]P]RT 1X[[ P]S cWT \PX] 3T\P]SbP]S0__a^_aXPcX^] DCC0<6D?C0 1X[[Xb_PbbTSX]?Pa[XP\T]c P[aTPShUXabcbXgfTTZb^UcWT UX]P]RXP[hTPa0_aX[c^\XS<PhPaT^eTa7T]RTc^ \TTccWTTbbT]cXP[Tg_T]SXcdaTeXibP[PaXTb^eTaWTPSb TcRSdaX]VcWXb_TaX^ScWT6^eTa]\T]cXbU^aRTSc^ bTTZPe^cT^]PRR^d]c8UcWT1dSVTcSPcTXb_aT_^]TS ?Pa[XP\T]cfX[[WPeTcf^Ud[[\^]cWbc^_PbbcWT1X[[b PdcW^aXbX]Vb_T]SX]VU^acWTUd[[hTPa 7^fTeTacWTaTP[QT]TUXcfX[[QTQhcWTfPhP[[ <X]XbcaXTbST_Pac\T]cb fX[[ VTc c^ Z]^f fT[[ X] PSeP]RTPbc^W^f\dRW\^]ThfX[[QTPePX[PQ[Tc^ cWT\U^ab_T]SX]VCWXbfX[[T]PQ[TcWT\c^_a^_Ta[h _[P]cWTXabRWT\Tb_a^VaP\\TbcWTXaX\_[T\T]cPcX^] P]S Tg_T]SXcdaT _PccTa] d][XZT cWT TgcP]c bhbcT\ fWTaTX]cWThTXcWTaT]STSd_Qd]RWX]V\^bc^UcWT Tg_T]bTbSdaX]V[Pbccf^`dPacTab^abdaaT]STaX]Vd] dbTSQP[P]RTb^dc^UcWTP[[^RPcTSUd]Sb CWXbfX[[P[b^cPZTPfPhcWT[TTfPhcWPcXbRdaaT]c[h QTX]VT]Y^hTSX]STTSTg_[^XcTSQhad[X]VTbcPQ[XbW \T]cbc^fX]S^fSaTbbPRR^d]cbfXcWcWTb^[TPX\ ^UcaX\\X]VUXbRP[STUXRXc^][hc^Pe^XSb[X__PVTbP[QTXc ^]_P_TaUa^\cWTbTccPaVTc 0c_aTbT]ccWTaTeXbX^]X]X]R^\TcPgaPcTbPb _a^_^bTSX]cWT1dSVTccW^dVWP__[XRPQ[TUa^\SPh ^]T^UcWTUX]P]RXP[hTPaXT0_aX[ WPbc^fPXccX[[cWT 5X]P]RT1X[[Xb_PbbTS3dTc^d]RTacPX]chPbc^fWPc aPcTfX[[UX]P[[hVTcP__a^eTSQdbX]Tbb\T]P]SX]SX eXSdP[bPaT]^cPQ[Tc^\PZTP]hSTUX]XcT_a^eXbX^]b fXcWaTVPaSbc^cWTXacPg[XPQX[Xch<^aT^eTaXcP[b^WP\ _TabcWTXaPQX[Xchc^\P]PVTRPbWU[^fb FXcWaTVPaSbc^X]SXaTRccPgTbP]haTeXbX^]X] aPcTbPhX]RaTPbTX]TgRXbTSdchcPZTb²X\\TSXPcT³ TUUTRcXT<PaRW 0bPaTbd[cP]h_a^SdRc[TPeX]VP UPRc^ahUa^\cWXbSPcTWPbc^_PhWXVWTgRXbTSdch 0]SX]RPbTcWTWXZTXb]^cP__a^eTSQh?Pa[XP\T]c ^aXUXc_PacXP[[ha^[[bXcQPRZXc[TPSbc^WPbb[TbU^a _a^SdRTabPbcWThWPeTc^bTTZaTUd]SP]SQ[^RZ PVT^Uf^aZX]VRP_XcP[XUcWTaTUd]SVTcbST[PhTS 0cP]^cWTaTgcaT\TaTeXbX^]X]bTaeXRTcPgcPZTb _[PRT _a^b_TRcXeT[h PUcTa cWT 5X]P]RT 1X[[ Xb _PbbTS d][XZTcWTX]R^\TcPgfWTaTRWP]VTbPaTP__[XTSaTc a^b_TRcXeT[hUa^\0_aX[ 5^aX]bcP]RTcWTX]RaTPbT \^^cTSX]! %! &1dSVTcc^ $_TaRT]cfPbTUUTR cXeTUa^\9d]T d_Ua^\ #$_TaRT]c[PbchTPa CWT 6^eTa]\T]c R^]ca^[b cWT \PgX\d\ aTcPX[ _aXRT^UUTacX[XbTabCWTaTeXbX^]bP]]^d]RTSX]cWT 1dSVTccPZTb_[PRTfXcWX\\TSXPcTTUUTRc8]cWT_Pbc P]X]RaTPbTX]cWT\PgX\d\aTcPX[_aXRT^UdaTPWPS c^QTa^[[TSQPRZCWXbd_bTcbcWT1dSVTcPbP[[^RP cX^] U^a bdQbXSh Xb X]eTabT[h aT[PcTS c^ _aXRT 5^a X]bcP]RTPWXZT^UC _Tac^]]T\^^cTSX]cWT ((' (((1dSVTcfPbaTeTabTSX][TbbcWP]cf^ fTTZbCWXb[TUccWTcWT]5X]P]RT<X]XbcTaHPbWfP]c BX]WPVPb_X]VU^aC %Ra^aT CWTPSeP]RT\T]c^UcWT1dSVTcSPcTfX[[aT\^eT bdRWP]^\P[XTbQhT]bdaX]VR^\_[TcX^]^UP[[[TVXb[P cXeTaT`dXaT\T]cbQTU^aTcWTbcPac^UcWTUX]P]RXP[hTPa 0[[cPgaPcTaTeXbX^]bP]S_aXRTbd]STabcPcdc^ahR^] ca^[fX[[cPZTTUUTRcUa^\0_aX[ CWTe^cT^]PRR^d]c fX[[QTPcWX]V^UcWT_PbcP]SP[[<X]XbcaXTbfX[[WPeT c^S^_a^_TaQdSVTcX]VP]S_[P]]X]Vc^b_T]SUa^\ SPh^]TCWTaTfX[[QTVaTPcTaPRR^d]cPQX[XchP]SbR^_T U^aUdSVX]VWdVT[h\X]X\XbTS 0]^cWTa_a^_^bP[c^aTR[PbbXUhb_T]SX]VPb²aTe T]dT³^a²RP_XcP[³PbPVPX]bcTgcP]c²_[P]³^a²]^]_[P] XbP[b^fT[R^\TCWT[PccTaXbPaT[XRbUa^\_[P]]X]V TaPfWT]STeT[^_\T]cfPbX]cTacfX]TSfXcW_[P]]TS bRWT\TbCWXb[TSc^P]P]^\P[^dbbXcdPcX^]fWTaT QhP]hTg_T]bTd]STa]^]_[P]TeT]XUXcXb^URP_X cP[]PcdaTfPbR^]bXSTaTSPbd]_a^SdRcXeTfWTaTPb PaTeT]dTTg_T]bTR^d[SQT_TaRTXeTSPb_a^SdRcXeT YdbcQTRPdbTXcR^\Tbd]STa_[P]RPcTV^ah CWT_a^_^bTSR[PbbXUXRPcX^]Xb]^c^][hX]bh]RfXcW cWTR^]cT\_^aPahaTP[XcXTb^USTeT[^_\T]c_a^_T[[TS QhP\d[cXcdST^Ub^daRTbXc]^[^]VTaaTe^[eTbPa^d]S _[P]]TSbRWT\TbQdcXcfX[[P[b^cad[haTU[TRccWTa^[T _[PhTSQhaTb_TRcXeTXcT\CWdbPWXVWTaRP_XcP[Tg_T] SXcdaTf^d[SR^]]^cTPQ^^bcc^PbbTcRaTPcX^]P]S WT]RT _a^SdRcXeT RP_PRXch ^U cWT TR^]^\h 0]h STRaTPbTX]aTeT]dTTg_T]bTbfX[[QTPbXV]^UX\_a^eTS TUUXRXT]RhX]f^aZX]V FWX[T cWTbT RWP]VTb PaT P V^^S ^\T] cWT 6^eTa]\T]cbW^d[SP[b^_dcP]T]Sc^P_Ta]XRX^db _aPRcXRT^USTUTaaX]VRTacPX]Tg_T]bTb\^bc[hbdQbX SXTb^]UTacX[XbTabU^^SP]SUdT[c^cWTU^[[^fX]VhTPa 5^a^eTacf^STRPSTbbdRRTbbXeTTbcPQ[XbW\T]cb_^bc _^]TSbdQbXSh_Ph\T]cbX]cT]b^UcW^dbP]Sb^URa^aTb cWTaTQhRP\^dU[PVX]VcWTcadT_^bXcX^]^UUXbRP[STUXRXc CWXbRaTPcTbP\Xb[TPSX]VX\PVTPQ^dccWTXaQTX]VUXb RP[[h_adST]cC^T]bdaTcWPcbdRWSXbRX_[X]TXbbcaXRc [hT]U^aRTScWT6^eTa]\T]cbW^d[SX\_[T\T]ccWTaTR ^\\T]SPcX^]b ^U cWT 4g_T]SXcdaT <P]PVT\T]c 2^\\XbbX^]d]STaU^a\Ta6^eTa]^a^UATbTaeT1P]Z ^U8]SXP1X\P[9P[P]c^bfXcRW^eTac^PRRadP[QPbTS PRR^d]cX]V Ua^\ TgcP]c ²RPbWQPbTS PRR^d]cX]V CWXbfX[[]X_X]cWTQdSP]hcT\_cPcX^]c^STUTa_Ph \T]cbXU^][hc^\P]X_d[PcTUXbRP[STUXRXc C^VTcWTafXcWcWT6^^SbP]SBTaeXRTbCPgb[Pc TSc^QT^_TaPcX^]P[Ua^\0_aX[ ! &cWT_aT_^]T \T]c^UcWT1dSVTcSPcTW^[SbcWT_a^\XbT^U\PZ X]VcWT8]SXP]TR^]^\hWTP[cWhP]Sa^QdbcRP_PQ[T ^UcPZX]V^]cWTRWP[[T]VT^US^dQ[TSXVXcVa^fcW M 8 BD38?170CC0270AHH0 CWTeTahaTRT]c WP__T]X]VbX]cWT D:P]ScWTDB bW^fcWPccWT f^aZX]VR[Pbb^[S P]S_^^afPbQPS[h X\_PRcTSQh V[^QP[XbPcX^]8cbPf Y^QbV^P]SfPVTb Sa^_8]\P]h PaTPbcWT_T^_[T P[b^UPRTS ^]b[PdVWcbUa^\ P[XT]XST]cXchP]S Rd[cdaTCWT4DfPb ]^c^]cWTbP\T _PVTPbcWTD: the battle of Singur. She has actually won her war of self-vindication. The Supreme Court verdict has legitimised her political philosophy. It had a simple beginning when Tatas were looking for a suitable piece of land for their Nano project in 2005. The Communist Party of India (Marxist)-led Left regime, which had earlier driven out most industries and then wanted to refurbish its image, wanted to help Tata Motors set up a project in West Bengal. The Tatas were shown land in Kharagpur and Singur, and the firm chose the latter. The Government went out of its way to acquire and hand over the land to Tatas. This is not an isolated incident. Over the years, for so-called development of industry, mining and infrastructure, the interests of farming, forestry, environment and especially ethnic folk and tribes, have been ignored. The theme of the economic impact of British imperialism on India was raised by British Whig politician Edmund Burke who, in 1778 began a seven-year impeachment trial against Warren Hastings and the East India Company on charges including mismanagement of the Indian economy. Contemporary historian Rajat Kanta Ray argues the economy established by the British in the 18th century was a form of plunder and a catastrophe for the traditional economy of Mughal India, depleting food and money stocks and imposing high taxes that helped cause the famine of 1770, which killed a third of the people of Bengal. In post-independence India too, dams, mines, steel plants and nuclear plants were pushed through unjustly. Africa had been ravaged and chopped up and divided by the colonial powers — Belgium, France, Germany, Italy, Portugal, Spain and the United Kingdom. It was the European squabbling for African, Asian and West Asia colonies, and their tremendous wealth, that was a significant cause of the first World War. Africa has historically been vital to the industrialisation of Europe as a source of natural resources and human labour. Modern Europe owes its development to the exploitation of Africa’s natural resources. Postindependence, the old colonialists simply resorted to buying off corrupt African leaders and continued to rape the continent. Few Africans benefited except the elite. The African Economic Outlook 2011 report has found that African states experienced high economic growth during the 2000s due to good macro-economic management, growth in trade, and foreign investments in oil-rich states. However, this growth did not coincide with poverty elimination, because it was not linked to activities and economic sectors that affect the poor. The costs of hosting the World Cup in South Africa were sought to be justified by the economic growth the event was supposed to generate. Expenses now are expected to surpass original estimates by 757 per cent. The expected growth in infrastructure and small local businesses has not come anywhere close to offsetting the funds that were been diverted from long-term priorities such as healthcare and education. Fifa and international corporate sponsors such as McDonald’s and Coca Cola are the 6QY\UT\UQTUb/6edebU \UQTUb/DQ[UQSQ\\ 8UcWT2^]VaTbbXbbTaX^dbPQ^dcT[TePcX]VAPWd[6P]SWXPbcWT_Pach _aTbXST]cXc\dbcS^Xc]^f7TS^Tb]^cWPeTcWT[dgdah^UcX\T s Congress scion Rahul Gandhi finally going to become the president or is it going to be one more kite-flying news? While his supporters want him to take over immediately, the old guard wants Congress president Sonia Gandhi to continue. She became the party president in 1998, and her term will come to an end in December. Many within the party feel that the mother-son duo has not worked well as the workers are confused. There will be added confusion if Priyanka Vadra enters politics. Rahul Gandhi’s supporters give two reasons why he should take over now. First, the line of succession has been clear and it is only a question of time. He has been waiting in the wings for the past 12 years since he entered politics in 2004. He was elevated as the party vice president in January 2013 and has virtually been functioning as the chief since then. Almost all party functionaries report to him directly. Moreover, Congressmen, who are alarmed at the rapid decay of the party, want to see some change. Second, Sonia Gandhi is not keeping good health and may not be able to undertake the rigorous elections tours and other strenuous activities as the party chief. Also, she has been taking a back seat, asking all those who go to her to meet Rahul Gandhi for important decisions. However, there is no doubt that Sonia Gandhi has a stature and oldtimers still prefer her over Rahul Gandhi, who is seen as a reluctant leader. She has proved her mettle in the past 18 years by steering the party to power twice. She failed only once, in 2014. When she took over in 1998, the party was on a low, with people leaving the sinking ship. Her entry checked that erosion. I It took her more than six years to bring the party back on track. She functioned as the first woman leader of Opposition in Parliament. Her efforts brought the party back to power in 2004. She went round mobilising non-BJP ‘secular’ parties on one platform by building the UPA. She also succeeded in keeping the party in power for the next 10 years, and ruled the country through proxy by making Manmohan Singh the Prime Minister. However, good times did not last long as Narendra Modi entered the scene as a macho Prime Minister and won the 2014 poll. Neither Sonia Gandhi nor Rahul Gandhi was a match for him. Where she failed was in building the organisation, which needed a surgery. Unfortunately, while the mother-son duo detected the rootcause of the problem, the two did nothing to improve the situation. As the Congress began to lose State after State and came up with just 44 seats in the 2014 Lok Sabha poll, its lowest ever, the morale of the workers also reached rock bottom. Rahul Gandhi’s experiments in reviving the Youth Congress and other measures came to naught. On biggest beneficiaries of the event, with much of the local South African population unable to even attend the matches. International development can also cause and accentuate inequality between the richer and the poorer factions of one nation’s society. For example, when economic growth boosts development and industrialisation, it can create a class divide by creating demand for more educated people in order to maintain corporate and industrial profitability. The popular demand for education, in turn, drives the cost of education higher through the principle of supply and demand, as people would want to be part of the new economic elite. Higher costs for education lead to a situation where only people with can receive sufficient education to qualify for the better-paying jobs that mass-development brings about. This restricts poorer people to lesser-paying jobs and technological development makes some of these jobs obsolete (for example, by introducing electronic machines to take over a job, or creating a series of machines such as lawn mowers to make people such as gardeners unemployed). The US uses the humanitarian hand-wringing, the dogma of democracy and capitalism and neoliberal economics, to camouflage its quest for hegemony. It is powered by oil, military supremacy and international finance. For the oil weapon to be effective, the US needs to control much of it, everywhere and all the time. The very recent happenings in the UK and the US show that the working class, old and poor, was badly impacted by globalisation; it saw jobs go and wages drop. In many areas, the people also faced onslaughts from alien identity and culture. Further, in the EU, for example, Brussels mostly disregarded indigenous UK public opinion, and was not on the same page. There was, therefore, a felt need to restore decision-making and political dignity from the clutches of remote bureaucracy and politics. All of this made Brexit happen. A similar example is brewing in the US. Protectionism is raising its ugly head there too. US Republican presidential nominee Donald Trump, riding on the waves of such populist anger, may even win the race to the White House, eventually. The point to note is that, development must be inclusive in all respects — particularly in a multi-cultural and multi-occupational society. There is no justification for giving gains to one section at the cost of the other. Such moves boomerang. 6KDSLQJDQHGXFDWLRQ V\VWHPIRUWRPRUURZ :0;H0=8B70=:0A the other hand, the fight between the old guard and the new guard has ruined the chances of the party. Rahul Gandhi has contested three elections successfully, representing Amethi in Parliament. But he has missed several opportunities to prove his leadership qualities. He could have become a Minister in 2004, perhaps even the Prime Minister in 2009, and could have taken over the party any time, as he had (and also has) no challengers. The result is that people think he has no leadership quality. He may be a crowd-puller, but not a vote-catcher, as has been proved in successive elections. Bihar was an exception but that was because of the poll tie-up with the Janata Dal (United). Many have noticed his lack of focus, energy and enthusiasm. He is two decades younger than Modi, but no match to him. Rahul Gandhi has now resorted to road shows and is lunching in Dalit homes to change his image. His temple visits have increased in the past two years, showing a soft Hindutva line. The Congress is now trying to appease both the communities. Rahul Gandhi does not have the luxury of time any longer. Five States are going to polls next year and another eight States in 2018, before the 2019 Lok Sabha poll. He needs to build a new team, enthuse the party workers, build contacts with allies and find more partners to strengthen the UPA. For this, the first step is to do well in the ensuing Uttar Pradesh and Punjab polls. The roadmap is clear. Rahul Gandhi will first oversee the organisational shakeup, followed by taking charge of the party — and thereafter a much needed chintan shivir to look into the reasons for its electoral debacles and the way forward. CWT_a^Q[T\fXcW^daTSdRPcX^]_^[XRhXb]^cYdbc^UUd]SX]V bcP]SPaSbP]S\^aT8c³b^]T^UPbTeTaTXST]cXchRaXbXb he national policy on education, since independence, has gone through various acts of commission and omission. Indeed, for anything to be called a ‘policy’, it has to be formally so stated by an agency which is charged with the responsibility of framing the document. There can be no policy by default. This is not the best place to get into a chronological narrative of the approach of the Parliament or indeed the Indian Government towards an ‘education policy’. Education is something on which many people have some opinion. Therefore, it is not surprising that so many committees and commissions have been appointed on this subject. Further, like in many domains, in the field of education too, post-independence institutions have had a huge shadow of the British legacy. To begin with, we created a University Grants Commission (UGC), perhaps for no better reason than that Britain had such an entity. Imitation is the best form of flattery. But it’s dangerous when it happens blindly in the domain of knowledge management. The result of this kind of institutional framework is not only worrisome, but also pernicious. The distribution of funds for education have got hugely eschewed. It will be useful to remind ourselves that education is a concurrent subject. However, the business of granting recognition for the so-called ‘maintenance of standards’ made the UGC almost the sole arbiter of the T fate of higher education. When this was put on a base of higher secondary and secondary education on which the Centre had much less say, the fit did not quite work out. The response was not clear, though, through some quirk, the Central Board of Secondar y Education finally emerged. The result is there for all to see. Examination after examination, sometimes mutually exclusive if not competitive, dominates the scene. This is besides the competitive entrance tests from everything — medicine to engineering. Parents are confused, children are bewildered, and employers at a loss to make sense of all this. The result is that several employers have begun installing there own competitive examinations. The series appears endless. The truth of the matter is that the escape route came — as it always does — for the resourceful and those who were networked. Almost every two of three so-called influential families have their wards studying outside India. Indeed, this decision had lent them a huge status in many ways: From marriage to employment. The dream of every Indian mother continues to be to get a son-in-law or a daughter-in-law who is either placed abroad or is at least an NRI. From a Government company to a multinational firm operating in India, a clear pattern of recruitment is discernible. The effective career path is to float in at a lateral level E8=0HB78;60DC0< with foreign credentials. Well might one ask: To whom does this country belong? Is it just a pasture for those from outside India? However, to continue with the narrative on education, it is not only a problem of funding, standards, intake, focus on output and more, but one of a severe identity crisis. This is a terrible story to narrate as few ever seem to attempt a way through it with the political and the social will it requires. Hopefully, the national policy on education should be a canvas to clear much of this confusion. The truth of the matter is: Every attempt to do a national policy on education has an overlay of a confusion which is best stated as framed in the statement, ‘Eminence is not omniscience’. Somebody may be very distinguished in his field, but it does not necessarily make him an expert in education too. In fact, an analysis of the composition of the search committees of key functionaries of educational bodies such as the All India Council for Technical Education and others will show that, those who chaired these committees were members who had little notion of the subject matter of the education domain, or for that matter, even of the issues. Casual familiarity with issues of education cannot be a substitute for a deep scholastic insight into the subject matter. That can only happen after decades of concentrated development of expertise. That day is still awaited. \^]Th 347A03D=k5A830H kB4?C4<14A %! % FTfTaTfPXcX]VU^a0XaRT[ caP]bPRcX^]c^R^]bd\\PcT FTWPeTbcPcTScWPcfTWPeT S^]T]TRTbbPahSdTSX[XVT]RT P]SfTPaTPcPSeP]RTSbcPVTb ^UR[^bdaT^Uc^fTacaP]bPRcX^] fWXRWfTW^_Tc^R^]R[dSTX] >Rc^QTa A2><24>5>A2>=BD<4A 1DB8=4BB6DA344?B8=67 2EJJ 6B?= 3?B@?B1D5C C4`^ViaVTede`dV]]e`hVcd Z_@Te2ZcTV]e`UZgVdeZed`h_ =4F 34;78) Telecom operator Reliance Communications is looking to close its long-pending mobile tower sale deal next month that may bring down its debt by around C19,000-20,000 crore. “We were waiting for Aircel transaction to consummate... We have stated that we have done necessary due diligence and we are at advanced stages of closure of tower transaction which we hope to conclude in October,” said RCom CEO for Consumer Business Gurdeep Singh during an investor call on Thursday. Anil Ambani-led Reliance Communications on Wednesday agreed to merge its wireless telecom business with smaller rival Aircel to create the country’s 4thbiggest mobile phone operator with an asset base of more than C65,000 crore. “The C20,000 crore debt (out of about C47,000 crore of RCom) will go away with this deal. Then, there will be tower proceeds. At this point of time, it is not possible to give exact valuation of the tower deal. This is an approximate estimate. Residual debt will be C9,000 crore with little plusminus,” an RCom official said CWT C!Ra^aTSTQc^dc^UPQ^dcC#&Ra^aT^UA2^\fX[[V^PfPh fXcWcWXbSTP[CWT]cWTaTfX[[QTc^fTa_a^RTTSb0ccWXb_^X]c^UcX\TXc Xb]^c_^bbXQ[Tc^VXeTTgPRceP[dPcX^]^UcWTc^fTaSTP[CWXbXbP] P__a^gX\PcTTbcX\PcTATbXSdP[STQcfX[[QTC(Ra^aTfXcW[Xcc[T_[db \X]db²P]A2^\^UUXRXP[bPXSSdaX]VcWTRP[[>]cWT^cWTaWP]S0XaRT[Xb _[P]]X]Vc^bT[[Xcb!\^QX[Tc^fTabc^[^fTaXcbSTQc[^PSc^C # Ra^aTUa^\Pa^d]SC 'Ra^aTQTU^aTR[^bdaT^U\TaVTaSTP[fXcWA2^\ during the call. On the other hand, Aircel is planning to sell its 2,000 mobile towers to lower its debt load to C14,000 crore from around C18,000 crore before closure of merger deal with RCom. “Aircel owns 2,000 towers. Those 2,000 towers will not be part of the merged company. As you know, Aircel has C18,000 crore (debt) on their balancesheet. At the time of merger, they would be paying off C4,000 crore to bring it down to C14,000 crore. That would happen by sale of their BWA spectrum and 2,000 towers,” an RCom official said during the call. At the end of June 30, 2016, RCom net debt stood at C42,071.2 crore. The total debt is estimated to be around C47,000 crore after paying for the spectrum auction. Both the companies have agreed to transfer C14,000 crore each of their bank debt to the merged entity, which will be rebranded as a new company. Besides these, both will transfer their pending payment for spectrum that they acquired during different auctions. “The merged entity is going to have a total of C28,000 crore of bank debt and combined deferred spectrum liability of around C7,000 crore. This will make a total debt of merged company at around C35,000 crore,” the RCom official said. However, another RCom representative clarified that on the day of consummating the deal, the debt in the books will be only C28,000 crore. He said spectrum payment instalment is due in books of the Department of Telecom and the merged company will not be raising any debt for paying those pending instalments. In the largest consolidation in the country’s telecom sector, RCom and Aircel will hold 50 per cent each in the new company. The board of the new company will have equal representation from the two sides. The merged entity has plans to invest $1 billion after its incorporation. “We have received enough interest from international investors for the merged entity as the deal has been announced. We are looking at $1 billion of investment into the company. It will raise another billion from bankers as well if need arises for expansion,” RCom President Punit Garg said. The merged company will have a war chest for future capex expansion and most of the capex expansion will be data led, Garg added. RCom on Thursday also announced transfer of its wireless business undertaking of its subsidiary Reliance Telecom (RTL) to Aircel and its subsidiaries. The turnover of wireless business undertaking of RTL had a turnover of C10,605 crore, accounting for 47.96 per cent of total turnover of RCom at the end of March 2016. “Consolidation of the wireless telecom business of the Company and RTL with AL (Aircel) and DWL (Dishnet Wireless-Aircel) provides an opportunity to the company to acquire equity interest in AL,” RCom cited as one of the reasons for transferring RTL business to Aircel. It said the transfer will further help in expanding the business of AL and DWL into growing markets of India, thereby creating greater value for the shareholders of AL and DWL. The move will also reduce foreign holding in Aircel. Aircel is majority owned by Malaysian firm Maxis Communications. Saudi Telecom, too, has stake in it. ?C8 FTbTTcWPc^da@!Va^fcWXbV^X]V c^QTWXVWTacWP]@ Va^fcW1dcfT S^bTTaXbZbcWPcf^d[SVTcdb c^fPaScTaaXc^ah^US^f]fPaS aTeXbX^]^UVdXSP]RTQTRPdbTcWT Pc\^b_WTaTSdaX]VcWTR^dabT^U@! WPbf^abT]TSR^\_PaTSc^fWPcfT bPfX]cWTQTVX]]X]V^U@!h^dbTT cWTTgP\_[T^UA1B 8=5>BHB24>E8B70;B8::0 5LVNVFRXOGSURPSWGRZQZDUG UHYLVLRQRIJXLGDQFH,QIRV\V =4F34;78: Infosys may slash its revenue guidance for the second time this fiscal, stung by “risks” like challenges in the banking and financial services sector and cancellation of projects. However, in the short term, the Bengaluru-based company remains confident of a “better” second quarter compared to the April-June, 2016 period. “We see that our Q2 growth is going to be higher than Q1 growth. But we do see risks that would get us toward territory of downward revision of guidance because the atmosphere during the course of Q2 has worsened compared to what we saw in the beginning of Q2, you see the example of RBS,” Infosys CEO Vishal Sikka said at the JP Morgan India Investor Summit. Infosys had earlier said it will ramp-down about 3,000 jobs following Royal Bank of Scotland’s decision to cancel its project to set up a separate bank in the UK. While announcing its first quarter earnings, Infosys had slashed its annual sales growth guidance to 10.8-12.3 per cent in US dollar terms for 2016-17, down from the previous forecast of 11.8-13.8 per cent. Sikka admitted there were “some internal execution issues” that had impacted its performance in the first quarter of this *67UROORXWDKHOO RIDFKDOOHQJHVD\V 9LVKDO6LNND =4F34;78) Describing GST rollout “a hell of a challenge”, Infosys CEO Vishal Sikka on Thursday acknowledged that there are pockets of weak preparedness, but there is still time to address them before the April 2017 deadline. “There are many pockets where there is weak preparedness at this moment. But we have time between now and then, and the government is extremely keen to address that (weakness),” Sikka said when asked about the preparedness for the launch. He on Thursday made a presentation to Finance Minister Arun Jaitley and senior officials of the ministry on GST Network (GSTN) and the road map for its operationality, a ministry tweet said. ?C8 fiscal but added that those issues have been resolved. “...This was purely because of internal reasons, because of execution reasons... We have made changes to the management and over the course of Q2, we have arrested the de-growth that we saw in consulting,” he said. Infosys, which is expected to announce its earnings for the July-September 2016 period in October, said some elements of its business tend to flow in towards the end of the quarter. “So we will only know more than this when we do the earnings in the second week of October. We would have factored in, at that time, the impact of RBS and many other projects that we are ramping up,” he added. Top IT firms like TCS and Infosys have highlighted certain issues like softness in the BFSI sector and the cautious approach of clients in the wake of Britain voting to leave the European Union could impact their performance. “We do see some challenges in BFSI but not nearly to the degree to what some other folks have talked about. RBS we have talked about, there are few clients in Europe which are seeing downward pressure but at the same time there are many that are growing significantly for us,” Sikka said. He added that the US is witnessing a similar trend. “A couple of clients have declined but at the same time there are some that are growing very nicely for us. So I don’t see it in the negative sense,” he said. ?C8 5-LRDFFXVHVLQFXPEHQWSOD\HUV RIUHMHFWLQJ013UHTXHVWV ([SRUWVFRQWUDFWIDOOLQ$XJXVW slammed incumbent operators Bhar ti Air tel, Ide a Cellular and Vodafone for allegedly refusing to help their mobile phone users port or switch to the new operator. In a l e tte r to T R A I C hai r man R S Shar ma , Reliance Jio said Bharti Airtel Ltd, Idea Cellular Ltd and Vodafone India Ltd are perpetrating “illegal and perverse actions” by refusing to enable the porting of mobile number connections. “Considering that this is a clear and deliberate breach of the license conditions, TRAI must direct incumbent dominant operators to comply with their license terms and obligations ... Failing which it should recommend cancellation of the respective licenses at the earliest,” Jio wrote. The three firms did not offer any immediate comment on the story. “It is important to note that this is being done in blatant disregard to license xports from India dipped 0.3 per cent to E $21.51 billion owing to =4F 34;78) Reliance Jio has terms and their obligations under t he Telecommunication Mobile Numb er Por t ability Regulations, 2009 and TRAI directions,” Reliance Jio wrote on September 14. Jio said it has been certif ie d as Mobi le Numb er Portability (MNP) compliant by the Telecom Enforcement, Resource and Monitoring Cells of all service area and in this month it wrote to incumb ents ab out commencing services. “Inspite of being under legal and contractual obligation to port the numbers after a valid request is made, the incumbent dominant operators have rejected all the requests made for porting between September 9 and September 12,” it said giving data of port requests rejected. It said the rejections were in addition to “the rejection of MNP request of 4,919 corporate mobile numbers issued to employees and m e mb e rs of R e l i an c e Industries Group by Bharti Airtel in August 2016. This was inspite of a confirmation from Bharti Airtel that there were no outstanding dues and that the MNP process could be completed.” Reliance had last month asked all its employees to shun rival mobile phone operators and shift to Jio. “Almost all of these rejections have been made on the baseless and unsubstantiated ground of ‘violation of contractual obligation’. The incumbent dominant operators have not even bothered to elaborate the contractual obligations that have been violated,” it said. The “baseless and unsubstantiated” ground of violation of contractual obligation was being raised to unnecessarily harass customers and prevent them from availing the services of Jio, the company said. Jio asked TRAI to take serious cognizance of its complaint and intervene by taking strict action against the incumbent operators under the relevant provisions. ?C8 ?=BQ =4F34;78 decline in shipments of products like petroleum and leather. This is the straight second month in a row that exports have contracted. The outward shipments stood at $21.58 billion in August 2015. The country’s imports too contracted by 14 per cent to $29.91 billion, leaving a trade deficit of $7.67 billion in August, which is the lowest figure in three months. The trade gap narrowed in August this year from $12.4 billion in the same month last year, according to the data released by the Commerce Ministry. The main export sectors that recorded negative growth in the month include petroleum (14 per cent), leather (7.82 per cent) and chemicals (5 per cent). Reacting to data, the Federation of Indian Export Organisations (FIEO) said the decline has largely been arrested and now “we can look for positive growth from October onwards”. It would help in taking the shipments to around $280 billion in 2016-17, the FIEO said in a statement. Cumulatively, exports during April-August 2016 contracted by 2.98 per cent to $108.52 billion. Imports during the period too dipped by 15.89 per cent to $143.18 billion, leaving a trade deficit of $34.67 billion. Further, fall in gold imports too helped in bridging the trade gap. The pre c i ou s m e t a l i mp or t s dipped by 77.45 per cent to $1.11 billion in August 2016. Oil imports during the SUHSDUHGQHVVWRUROORXW*67 $GYDQFHWD[6%,,&,&,VHH 3ULPH0LQLVWHUUHYLHZV ?=BQ =4F34;78 rime Minister Narendra Modi has directed offiP cials to stick to the implementation timeline of GST rollout by April 1. In a review meeting held on Wednesday evening, Modi told the officials to keep the time line of all aspects of GST preparedness, including the aspects of IT, establishment and infrastructure. The meeting was attended by Finance Minister Arun Jaitley and t op br a s s of P MO an d Finance Ministry. “In order to ensure that there is no slippage on date of implementation of GST from 1st April, 2017, the Prime Minister reviewed the progress made on various steps needed for the rollout of GST relating to preparation of Model GST laws and rules to be framed, establishment of IT infrastructure for both Centre and States, training of officers of Central and State Governments and outreach for awareness of trade and industry,” said PMO in a statement. “ The Prime Minister directed that all steps must be completed much before 1st April, 2017. The Prime Minister observed that GST Council would need to have intensive meetings to be able to make timely recommendations relating to its mandate provided in Article 279A including making recommendations relating to Model GST laws, GST rates, goods and services that may be subjected to or exempted from GST,” said PMO. VKDUSIDOO/,&5,/SD\PRUH <D<108)Traditionally big taxpayers like large banks failed to cheer taxmen with their second quarter advance tax payouts, but others including steel and cement companies have done comparatively better, helping the department remain hopeful of meeting the annual target. “Tax collection from the city is rising, despite adverse business situation and belowpar performance by several important sectors like banks,” principal chief income tax commissioner of Mumbai D S Saksena told the news agency today. “Mop-up is rising and is likely to improve further going ahead.” Saddled with high bad loans and resultant spike in provisions, largest lender State Bank of India has paid an advance tax of only C1,200 crore for the second quarter, down from C1,620 crore in the year-ago period, showing a fall of 26 per cent, department sources said. Similarly, largest private sector lender ICICI Bank too paid 20 per cent less tax at C1,200 crore. In the September tranche last year, it had paid Rs 1,500 crore. But insurance behemoth LIC’s tax payment has risen 13 per cent to C2,235 crore from C1,970 crore a year ago. Reliance Industries paid 27 per cent more at C2,667 crore. In the second quarter last fiscal, it had paid C2,108 crore in advance taxes. Software major TCS has paid 11 per cent less at C1,550 crore from C1,750 crore a year ago. Private sector banks like HDFC Bank and Yes Bank have done better. While HDFC Bank has paid C2,400 crore, 20 per cent over C2,000 crore a year ago, mortgage lender HDFC paid an advance tax of C860 crore, against C810 crore year ago. Mid-sized private sector lender Yes Bank too has paid higher amount at C435 crore, which is up 40 per cent. Foreign lender Citibank is learnt to have paid C700 crore, down 3 per cent from C720 crore last year. Despite the massive losses reported in the first quarter,state-owned lender Bank of Baroda is learnt to have paid 25 per cent more in advance tax at C625 crore during the second quarter, against C500 crore a year ago. Sectors like steel and pharma have fared well. Tata Steel paid C250 crore, double of what it had paid last year. UltraTech Cement paid 20 per cent more at C180 crore. Auto major M&M paid C200 crore, up 11 per cent over C180 crore in the same period last fiscal year. Among oil majors, IOC’s payment was up by around 62 per cent at C1,275 crore from C785 crore a year ago, while BPCL paid C540 crore, down around 2 per cent. FMCG major HUL paid C500 crore of advance tax, up 9 per cent a year-ago. Bajaj Auto’s payout was down by around 13 per cent at C390 crore. ?C8 month fell by 8.47 per cent to $6.74 billion. Non oil imports dip 15.65 per cent to $22.44 billion in August this year. Exports were in negative zone between December 2014 and May 2016 due to weak global demand and slide in oil prices. Shipments witnessed growth only in June this year thereafter again entered into negative zone in July. The export sector which recorded positive growth includesengineering, textiles, pharmaceuticals, gems and jewelery and iron ore. The statement said that non-petroleum exports in August grew by 1.79 per cent to $19.08 billion. During April-August, the exports dipped by 0.52 per cent to $96.98 billion. It s a i d t h at e x p or t s growth have also fallen for the US (-4.35 per cent), EU (-2.16 per cent), China (4.94 per cent) but Japan exhibited positive growth (8.67 per cent) for June. Oil imports during the first five months of this fiscal declined by 22.08 per cent to USD 32.41 billion. Further, it said services exports in July contracted by 4.11 per cent to $12.77 billion. The net export of services for April-July 2016-17 was estimated at $21.56 billion, which is lower than net export of $22.37 billion in the same period last year, it added. 8=1A845 0??;4B;0B74B8?7>=4%B%B?;DB?A824B1HD? C>C!! =4F34;78)FTTZbPWTPS^UcWTX\_T]SX]V8]SXP[Pd]RW^UX?W^]T& P]S&?[db0__[TWPbb[PbWTS_aXRTb^UcWT_aTeX^dbVT]TaPcX^] WP]SbTcbX?W^]T%BP]S%B?[dbQhd_c^C!!CWTX?W^]T& P]SX?W^]T&?[db[Pd]RWTSTPa[XTacWXb\^]cWX]cWTDBPaTb[PcTSc^ WXccWT8]SXP]\PaZTcUa^\>Rc^QTa&fXcW_aXRTbbcPacX]VPcC% CWTaTXbdbdP[[hP_aXRTSa^_U^acWT_aTeX^dbeTabX^]bfWT]P]Tf \^ST[XbP]]^d]RTSQh0__[T0RR^aSX]Vc^X]Sdbcahb^daRTbcWT X?W^]T%B !'61ePaXP]cfX[[]^fQTPePX[PQ[TPcC%Ua^\Xcb TPa[XTa_aXRTcPV^UC'!PaTSdRcX^]^UC!!CWTX?W^]T%b ?[db !'61ePaXP]cfX[[bTTPbX\X[PaRdcP]SfX[[QTPePX[PQ[TU^a C&CWT%#61eTabX^]^UX?W^]TB4fWXRWfPb[Pd]RWTSX] <PaRWcWXbhTPafX[[]^fQTPePX[PQ[TU^aC##S^f]Ua^\ C#(0__[TSXS]^cR^\\T]c^]cWTaTSdRcX^]X]_aXRTb 228>A34AB?A>140608=BC90H?446A>D?8= <09>A8CH>A34AB =4F34;78) 2^\_TcXcX^]2^\\XbbX^]WPb^aSTaTS_a^QTPVPX]bc 9PX_aPZPbW0bb^RXPcTbcWa^dVW\PY^aXch^aSTabX]cf^bT_PaPcTRPbTb X]e^[eX]VaTP[TbcPcT_a^YTRcbX]cWT]PcX^]P[RP_XcP[aTVX^]U^aP[[TVTS PQdbT^US^\X]P]c\PaZTc_^bXcX^]P]SX\_^bXcX^]^U°d]UPXa± R^]SXcX^]b^]QdhTab8]Q^cWcWTRPbTbcf^\T\QTab^UcWT 2^\_TcXcX^]2^\\XbbX^]^U8]SXP228WPeTVXeT]cWTXaSXbbT]c]^cTb fWX[T^_X]X]VcWPccWTR^\_P]hSXS]^cWT[SPS^\X]P]c_^bXcX^]X] cWTaT[TeP]c\PaZTcP]S°]^RPbTXb\PST^dc±PVPX]bcXc E834>2>=B<0AC?7>=48=CA>3D24B³?0=82 1DCC>=´ =4F34;78* EXST^R^]B\Pac_W^]TWPbX]ca^SdRTS²?P]XR1dcc^]³ PRa^bbXcbT]cXaT_a^SdRc_^acU^[X^Bd__^acX]V6^eTa]\T]c³b_a^eXbX^] ^UP\P]SPc^ah²?P]XR1dcc^]³cWTQaP]SWPbX]ca^SdRTS²B>B1T BPUT³T\TaVT]RhaTb_^]bTP__^]Xcb_^fTa_PRZTSb\Pac_W^]T EXST^R^]2dQT"CWTP__dcX[XiTb_^fTaQdcc^]PbcWT_P]XRQdcc^]c^ bT]SP]P[Tacc^cWT]d\QTabPSSTSX]cWTT\TaVT]Rh[XbcPccWTcX\T ^UaT`dXaT\T]c \^]Th 347A03D=k5A830H kB4?C4<14A %! % jca^l >=62E834B7C>02@D8A4 0338C8>=0;8=C4A4BC8=E0=:>A584;3;>20C43 8=40BCB814A80>5C74ADBB80=5434A0C8>= >=62EXSTbWP]SXcbfW^[[h^f]TSbdQbXSXPah>=62EXSTbWEP]Z^a]TUc?cT;cSBX]VP_^aT>EE;Y^X]c[h bXV]TSSTUX]XcXeTPVaTT\T]cbfXcWA^b]TUccWT]PcX^]P[^X[R^\_P]h^UAdbbXPU^aPR`dXaX]VPSSXcX^]P[ bWPaTbX]9B2EP]Z^a]TUcPR^\_P]h^aVP]XbTSd]STacWT[Pf^UAdbbXP]5TSTaPcX^]fWXRWXbcWT^f]Ta^U EP]Z^a5XT[SP]S=^acWEP]Z^a[XRT]bT4Pa[XTa>=62EXSTbWWPSbdRRTbbUd[[hR[^bTScWTPR`dXbXcX^]^U $_Ta RT]cbWPaTW^[SX]VX]cTaTbc^]" bc<Ph! %0UcTaR[^bX]V^UcWT_aTbT]ccaP]bPRcX^]>=62EXSTbWfX[[aPXbT Xcb_PacXRX_PcX^]bWPaTX]EP]Z^a]TUcc^!%_TaRT]cCWTPR`dXbXcX^]XbbdQYTRcc^aT[TeP]c1^PaS6^8P]S AdbbXP]aTVd[Pc^ahP__a^eP[bP]SXbTg_TRcTSc^R[^bTQhcWTT]S^U! %CWTPVaTT\T]cfPbbXV]TSQh24> <P]PVX]V3XaTRc^a=PaT]SaP:ETa\P^]QTWP[U^U>=62EXSTbWP]S2WPXa\P]1^PaS^U3XaTRc^ab A^b]TUcX]<^bR^f8V^aBTRWX]^] #cWBT_cT\QTa! %EP]Z^aXbA^b]TUcbP]SAdbbXPbcWTbTR^]S [PaVTbcUXT[SQh_a^SdRcX^]P]SPRR^d]cbU^a#_TaRT]c^UAdbbXP]_a^SdRcX^]CWTSPX[h_a^SdRcX^]Ua^\cWT UXT[SXbPa^d]S#! Q_S^URadST^X[^]P]PeTaPVTP]Sc^VTcWTafXcWTPa[XTaPR`dXbXcX^]^U $_TaRT]c >=62EXSTbWbbWPaT^USPX[h^X[_a^SdRcX^]Ua^\EP]Z^afX[[QTPQ^dc Q_SCWTPR`dXbXcX^]^U PSSXcX^]P[ _TaRT]cQTPabbXV]XUXRP]cbcaPcTVXRX\_^acP]RTP]Sf^d[SPSSPQ^dc"_TaRT]cc^cWTTgXbcX]V >=62EXSTbWb_a^SdRcX^]PccWTRdaaT]caPcTP]SP__a^gX\PcT[h!!<<c^U^X[P]S 12<^UVPbP]]dP[[h 7X]SX3XfPbfPbRT[TQaPcTSPc=C?21PSPa_daBcPcX^]6a^d_6<=:BX]WPaT`dTbcTScWT[PaVTVPcWTaX]Vc^ _a^\^cTcWTdbT^U^UUXRXP[[P]VdPVTP]SdbTcWTbP\TX]SPX[hdbTCWThP[b^aT`dTbcc^\PZT7X]SXPV[^QP[ [P]VdPVTP]S_a^\^cTXcPbP]P\QPbbPS^a^UAPYQWPbWP1PSPa_daBcPcX^]WPb^aVP]XbTS7X]SX?PZWfPaPUa^\ bcc^ #cWBT_cT\QTa! %3daX]VcWXb_TaX^SePaX^dbR^\_TcXcX^]bfTaT^aVP]XbTSU^acWTT\_[^hTTbP]S UP\X[h\T\QTab^U=C?2P]S28B5_Tab^]]T[P]SbRW^^[b[^RPcTSX]cWTBcPcX^]_aT\XbTbc^_a^\^cT^UUXRXP[ [P]VdPVT66<P]SbT]X^a^UUXRTabVPeTPfPhcWT_aXiTbc^cWTfX]]Tab^UcWTbTR^\_TcXcX^]b 2<3^U?52<:6^T[aTRTXeX]VcWT_aTbcXVX^db³APYQWPbWP:XacX?aPcWP\?dadbZPaX]cWTRPcTV^ah^UaTVX^] ³0U^acWThTPa! $ %Ua^\cWT?aTbXST]c^U8]SXP?aP]PQ<dZWTaYTTPcAPbWcaP_PcX1WPfP]QhcWT3T_Pac\T]c ^U>UUXRXP[;P]VdPVT<X]Xbcah^U7^\T0UUPXab6^8X]cWT_aTbT]RT^UD]X^]7^\T<X]XbcTaAPY]PcWBX]VWP]S D]X^]<X]XbcTa^UBcPcTU^a7^\T0UUPXab:XaT]AXYXYdCWXb0fPaSfPbaTRTXeTSQh?52U^aCWXaSCX\TX]Pa^f U^aTgRT[[T]cR^]caXQdcX^]\PSTXcU^aX\_[T\T]cPcX^]^U>UUXRXP[;P]VdPVT >558280;F41B8C45>A?<D99F0;0H>90=08BFFF?<D99F0;0H>90=02>< 0ccT]cX^]^U<X]Xbcah^U?Tca^[Td\P]S=PcdaP[6PbWPbQTT]SaPf]c^P]d\QTa^UUPZTfTQbXcTb fWXRWWPeTR^\Td_aTRT]c[hX]R^]]TRcX^]fXcWcWT?aPSWP]<P]caXDYYfP[PH^YP]P8cXbc^QaX]Vc^ cWTZX]S]^cXRT^U6T]TaP[_dQ[XRcWPc^UUXRXP[fTQbXcT^U?aPSWP]<P]caXDYYfP[PH^YP]PXb fff_\dYYfP[Ph^YP]PR^\CWT^UUXRXP[fTQbXcTP[b^R^]cPX]bUaTT[hS^f][^PSPQ[TU^a\bQ^cWX] 4]V[XbWP]S7X]SXc^QTUX[[TSQhcWT_a^b_TRcXeTQT]TUXRXPaXTb6T]TaP[_dQ[XRP]S^cWTabcPZTW^[STab PaTaT`dTbcTSc^eXbXccWT\T]cX^]TSfTQbXcTU^aP]hX]U^a\PcX^]fXcWaTVPaSc^cWTDYYfP[PH^YP]P 8]RPbT^UP]hS^dQcc^[[UaTT]d\QTa '!%%%%(%\PhP[b^QTR^]cPRcTSU^aR[PaXUXRPcX^] >]cWT^RRPbX^]^U7X]SX3XePb #cWBT_cT\QTa! %P:PeXBP\\T[P]fPb^aVP]XbTSPc=PcX^]P[2P_XcP[?^fTa BcPcX^]3PSaX66<=2?B3TQPbXbBPaZPaP]S?aTbXST]c9PVaXcXBP\PY:PbcdaXBPaZPaX]PdVdaPcTScWTTeT]cQh [XVWcX]VcWT[P\_FWX[TPSSaTbbX]VcWTVPcWTaX]V3BPaZPadaVTScWTT\_[^hTTbc^_a^\^cTAPYQWPbWPP]SdbT^U 7X]SX[P]VdPVTX]cWTXaSPhc^SPhf^aZX]VCWT³7X]SX3XePb0__TP[Ua^\BPaZPafPbP[b^aT[TPbTS7TP[b^aT[TPbTS APYQWPbWP0[^ZPaTUTaT]RTWP]SQ^^Z_dQ[XbWTSQhAPYQWPbWPBTRcX^]^U=C?23PSaX06<7A4320]X[:d\Pa 3P]VaTPS^dccWT\TbbPVTP__TP[^U2<3=C?2;X\XcTS6daSTT_BX]VWaT[TPbTS^]cWT^RRPbX^]^U7X]SX3XePb 3a?=BX]VW2<>1W^[P=PcW6<>_TaPcX^]bA7PaXZd\Pa7>37AP]SbT]X^a^UUXRXP[bVaPRTScWT^RRPbX^] CWT"SPhb_TRXP[XbTSTeT]c^U8]SXPCaPST?a^\^cX^]>aVP]XbPcX^]8C?>cWT (cW TSXcX^]^U8]SXP8]cTa]PcX^]P[BTRdaXch4g_^88B4fX[[R^\\T]RTUa^\ (cW BT_cT\QTa! %Pc?aPVPcX<PXSP]=Tf3T[WX28B5XbcWTR^^aVP]XbTa^U8]SXP 8]cTa]PcX^]P[BTRdaXch4g_^0RdacPX]aPXbTafPb^aVP]XbTSPc7P[[=^'^U8C?> ?aPVPcX<PXSP]>]cWT^RRPbX^]2<38C?>?aPVPcX<PXSP];26^hP[ 0SSXcX^]P[3XaTRc^a6T]TaP[28B5A:?PRW]P]SP0361daTPd^U?^[XRTATbTPaRW P]S3TeT[^_\T]c1?A3?PaeTi7PhPcfTaT_aTbT]c^]cWT^RRPbX^] :_W`f_UVcU`^VdeZTS]RT\ ^`_VjdTYV^VT`_WZUV_eZR] ?C8Q =4F34;78 overnment on Thursday said information about G those who declare their black money under the compliance window, ending September 30, will be kept confidential. As regards concerns regarding confidentiality of the information filed under the scheme, it is reiterated that information contained in a valid declaration is confidential and shall not be shared, an official statement said. “In respect of declarations f iled with the Commissioner of Incometax, Centralised Processing C entre, B engalur u [CIT (CPC)], the declaration shall not be shared even with the jurisdictional Principal Commissioner/Commissione r and payments made under the Scheme shall not be visible to the jurisdictional officers,” it said. Form-2 and Form-4 required to be issued in such 8C^UUXRTbc^aT\PX]^_T] cX[[\XS]XVWc^]BT_")83B NEW DELHI: The taxman will undertake a midnight vigil on September 30 as CBDT has directed the Income Tax department to keep their offices country-wide open in order to receive declarations under the domestic black money window the Income Declaration Scheme (IDS). “The last date for making declaration under the IDS, 2016 is September 30, 2016 and hence the declarations can be filed till the midnight of that day. In order to facilitate the filing of declarations even after the office hours, the Principal Chief Commissioners are instructed to ensure that the counters for receiving the declarations under IDS, 2016 remain open till the midnight of September 30, 2016 in all jurisdictions,” the CBDT said in an order on Thursday. The Central Board of Direct Taxes (CBDT) is the policymaking body of the I-T department. Officials said the orders have been received by the tax offices in the country and have been issued after a decision in this regard was approved by the CBDT Chairperson. CBDT boss Rani Singh Nair will also hold a review meeting in this regard on September 17 along with all the I-T regional chiefs of the country. The Government again made it clear that all information and declarations that the I-T department receives till September 30 under IDS will be kept ‘confidential and shall not be shared’ and has suggested that such declarations can also be made online using the e-filing website of the department. PTI cases shall be system generated by the CPC, it said. Similarly, it said, the declaration filed with jurisdictional Principal Commissioner or Commissioner shall not be shared with any authority within or outside the department including the jurisdictional Assessing Officer. “Further, the payments under the Scheme shall neither be reflected in 26AS statement nor can be viewed by the Assessing Officer in the Online Tax Accounting System (OLTAS) of the Department in the interest of confidentiality,” it said. IDS scheme, launched by the government on June 1 to uncover black money, closes on September 30. As per the IDS facility, one can pay tax under the scheme by cash in a bank and no enquiry will be made by any bank official. Under IDS one can come clean by paying tax, penalty and cess totalling 45 per cent of the undisclosed income. 0SWTaTc^cX\T[X]T ^]4<ERWX_QPbTS RPaSb)A18c^QP]Zb MUMBAI: RBI on Thursday asked banks to replace existing magnetic stripe only cards to EMV Chip and PIN cards by the deadline of December 2018 and no extension will be given. EMV chip cards, which come with a microprocessor chip that storeand protect cardholder data, and PINbased cards enhance security and risk mitigation in card transactions. In August 2015, RBI had extended time for banks to issue cards under the Prime Minister Jan Dhan Yojana (PMJDY)/ Basic Savings Bank Deposit Account (BSBDA)/ other government schemes to September 30, 2016, and for other cards the deadline was January 31, 2016. Despite the extension of time given to banks, RBI said that some banks have approached it seeking further extension of the timeline for complying with the instructions. “Keeping in the mind the objective to further enhance the security and risk mitigation in card present transactions, and also the impact it may have on achieving the timeline for complete migration of all existing magstripe cards, it has been decided not to grant any further extension beyond the respective timeline.” PTI BWPaT_d[bTbX\_^ac STP[bX]PSeP]RTfXcW 6^ecbPhb?PbfP] E^SPU^]Tc^caX_[TXcb]Tcf^aZR^]]TRcXeXchfXcW9X^ NEW DELHI: Cracking down on private importers of pulses, the Government on Thursday asked them to be transparent in their transactions and submit information about contracted quantities in advance for better assessment of supplies and formulation of measures to check prices. Food and Consumer Affairs Minister Ram Vilas Paswan held a meeting with pulses importers to review the status of imports. Senior officials of Agriculture, Food, Consumer Affairs, Commerce, Finance and External Affairs Ministries, and investigating agencies like ED were present. “We have decided to have better coordination between pulses traders and the Government. The Minister told them to submit their import plans in advance, for which they have agreed to do,” a Food Ministry official said. PTI elecom operator Vodafone India on Thursday said that T it has decided to increase inter- ?=BQ =4F34;78 connection capacity with Reliance Jio network. “Following guidance from Trai and clarifications from Jio regarding its commercial launch, Vodafone India has decided to increase the points of interconnect (POIs) between the two operators by thrice and accordingly, increase the capacity to connect,” Vodafone India said in a statement. Vodafone is the third incumbent operator, after Idea Cellular and Airtel, that has agreed to increase inter-connection points for Reliance Jio, paving the way for easy exchange of calls between subscribers of the two networks. Inter-connection is required to enable mobile users to make calls to customers of other tele- )RUWUDQVIHURIVHFXULWLHV6HEL HDVHVGRFXPHQWDU\UHTXLUHPHQW NEW DELHI: Easing the process of converting physical securities into demat form, markets regulator Sebi on Thursday gave more flexibility on documentary requirement for the securities held in single name without a nominee. The move is aimed at making transmission of securities more efficient and investor-friendly. For securities held in single name without a nominee, an affidavit from all the legal heirs made on non-judicial stamp paper and claim of legal ownership to the securities might be sought, Sebi said in a circular. “In case the legal heir/claimant is named in the succession certificate or probate of will or will or letter of administration, an affidavit from such legal heir/claimant alone would be sufficient," it added. Besides, for value of securities up to C2 lakh, succession certificate or probate of will or letter of administration or court decree might be required. In absence of these documents, a No objection certificate (NOC) from all legal heirs of the deceased holder or copy of Family Settlement Deed duly notarised would be sought. Transmission refers to the transfer of securities from the account of a deceased holder to that of surviving joint holder, nominee or legal heir. For valuations of securities over C2 lakh, a succession certificate or probate of will or Letter of Administration or court decree is required. PTI C^RaTPcTPcad[hR^]]TRcTSX]R[dbXeTP]S 3XVXcP[8]SXPXcXbeXcP[c^WPeTP[TeT[ _[PhX]VUXT[SQTcfTT]_a^eXSTab^UUTaX]V cWTbP\TbTaeXRTT]R^daPVTX]]^ePcX^]b P]SYdSXRX^db[hdbTP_^acU^[X^^U cTRW]^[^VXTb!6"6P]S#6c^bTaeXRT cWTTe^[eX]V]TTSb^UR^]bd\TabPRa^bb cWTR^d]cahbPhbE^SPU^]T com networks. A mobile operator levies inter-connection usage charge for each incoming call it gets from a subscriber of another network. Incumbent carriers have been demanding higher interconnection charges compared with 14 paise they get for each incoming mobile call on their networks. Reliance Jio, which commercially launched its services on September 5, has accused the existing players of not releasing sufficient inter-connection ports which it feels is leading to call drops. “Vodafone India has always provided points of interconnect (PoIs) to other operators for all their fair, reasonable and legitimate requirements and will continue to do so,” Vodafone said. “Vodafone is hopeful that all issues it has raised with Trai and Jio will be duly considered and resolved at the earliest.” The Telecom Regulatory Authority of India has indicated that it will take strong action against telecom operators found responsible for poor quality of service. Jio has alleged that the situation on its network has deteriorated significantly in the last few weeks due to insufficient PoIs, with over 75 calls failing out of every 100 call attempts. As per the rules, not more than 5 calls can fail in every 1,000 calls made during a month. It further said that over 22 crore calls have failed on the Airtel network while 52 crore have failed cumulatively on the networks of the three incumbent operators -- Airtel, Vodafone and Idea in about last 10 days. “To create a truly connected, inclusive and Digital India, it is vital to have a level-playing field between providers offering the same service, encourage innovations and judiciously use a portfolio of technologies - 2G, 3G and 4G to service the evolving needs of consumers across the country,” Vodafone said. =QebYdYecX_`Ucd_bU]QY^ ]QZ_b649c_ebSUd_9^TYQ ?C8Q =4F34;78 auritius on Thursday expressed hope to remain M one of the biggest investment routes to India post revision of the bilateral tax treaty, as the two nations move ahead with talks on trade liberalisation pacts. After meeting Finance Minister Arun Jaitley, Mauritian Minister of Finance and Economic Development Pravind Kumar Jugnauth said the negotiations on Preferential Trade Agreement (PTA) and Comprehensive Economic Cooperation Partnership Agreement (CECPA)are moving ahead. “In fact, there is now a delegation from Indian side visiting Mauritius. There has been a preliminary draft agreement which will need to be further looked up and discussed. We are looking forward that through that agreement we can extend opportunities for both Mauritius and India. We have to increase trade and investment,” he said. When asked if FDI inflows to India from Mauritius will reduce following revision of the bilateral Double Taxation Avoidance Convention (DTAC), Jugnauth expressed hope that the island nation will continue to ‘play the role of the biggest investment route to India’ because it benefits both the nations. “We need to monitor the situation and we will review and discuss as and when there is necessity,” the visiting minister added. He said the two countries have successfully agreed for changes and the protocol on DTAC has already been signed. “We are looking now how to consolidate the relationship between India and Mauritius,” he said. After long-drawn negotiations, the amendment to the 1983 DTAC was signed by India and Mauritius in May. With the changes, India can impose capital gains tax on investments routed through Mauritius. =ReVcVT`gVcj]ZWedDV_dVi%"aed MUMBAI: Bouncing back towards the fag-end in an otherwise choppy trade, Sensex on Thursday closed 41 points up at 28,412.89 with FMCG, healthcare and realty stocks leading the gains, tracking a mixed global trend. Cautious stance adopted by participants, tracking mixed trend in regional markets ahead of the next week’s US Federal Reserve and Bank of Japan policy meets too influenced trading sentiment. “The investors have adopted a wait-and-watch approach to the global sentiment which is playing between cautious and optimism over the FOMC meet early next week. Currently, FII's are sellers in the market,” said Vinod Nair, Head of Research, Geojit BNP Paribas Financial Services. The 30-share Sensex after shuttling between 28,454.02 and 28,311.11, settled 40.66 points or 0.14 per cent higher at 28,412.89. PTI <X]XbcTa^UBcPcT8]ST_T]ST]c2WPaVTU^a ;PQ^daP]S4\_[^h\T]c6^81P]SPad 3PccPcaThPX]2F0RWXTeT\T]cb8]XcXPcXeTb ^U4B82SdaX]VcWT_Pbccf^hTPab ;<PaZTc3TeT[^_\T]c7TPS6PdcP\6P]Vd[hfXcWA3T_X]STa6a^eTaSdaX]VcWT5Xabc2a^bba^PSb<d[cX 1aP]S2PaF^aZbW^_[Pd]RWX]=^XSP^]CWadbSPhAP]YP]3X\aXkCWT?X^]TTa INDIAN ORDNANCE FACTORIES MACHINE TOOL PROTOTYPE FACTORY AMBARNATH Government of India, Ministry of Defence NOTICE INVITING OPEN TENDER (E-Procurement) The General Manager, Machine Tool Prototype Factory, Ambarnath (India) on behalf of the President of India invites Open Tender (Two Bid System), from the Indian manufacturers for following Item: TE No Item Description Qty Tender Opening Date 16TE220480 Design, manufacturing, supply & prooving of dtd: 23/08/2016 test stand for testing of wheel carriage assembly 01 No 23/09/2016 of Dhanush (bofors) 155MM Assembly as per scope of work attached. 16TE220487 Transportation charges for 'transportation of dtd: 23/08/2016 defence store including loading from MPF 10WJ 30/09/2016 Ambarnath to GCF/ COD Jabalpur Load carrying capacity of truck required 3 MT. (As per scope of work enclosed) Note. All relevant details, & Terms and conditions etc are available on website : www.tenders.gov.in and OFB Website http://ofbeproc.gov.in davp 10201/11/1050/1617 f^a[S ! 347A03D=k5A830H kB4?C4<14A %! % 3KLOLSSLQHV 3UHVLGHQW µRQFHNLOOHG PDQZLWK8]L¶ Manila: Philippine President Rodrigo Duterte allegedly once shot dead a justice department agent with an Uzi submachine gun while serving as mayor of Davao. The allegation was made by Edgar Matobato, a self-confessed former death squad member, before a Senate inquiry on extra-judicial killings. Duterte, he alleged, ordered him and others to kill about 1,000 criminals or political rivals over a 25-year period. One Government Minister called the allegations “lies and fabrications” Justice Secretary Vitaliano Aguirre said Matobato was “obviously not telling the truth” while presidential spokesman Martin Andanar said investigations into the president’s time as mayor had gone nowhere. Matobato, 57, said he had been a member of the Davao Death Squad, a notorious vigilante group allegedly responsible for hundreds of killings. “Our job was to kill criminals like drug pushers, rapists, snatchers,” he said. But he also said that Mr Duterte’s opponents had been targeted too, including four bodyguards of a local rival for mayor, Prospero Nograles. In 1993, he said his group had injured a justice department agent after a confrontation at a road block. Agencies 9Z]]RcjEcf^agZcefR]]j 86WRHQGHPHUJHQF\DJDLQVW0\DQPDU =ZWedR_TeZ`_d @SR^R^VVed eZVUZ__Vha`]]d 2f_XDff<jZ 74?D;;B074038=>78>5;>A830*1>C7A4;40B4 3>2C>ABA4?>AC>=C748A³4G24;;4=C´740;C7 BA0906>?0;0= Q F0B78=6C>= ith Republican Donald Trump surging in a series of new polls, the big lead that Hillary Clinton enjoyed for well over a month has all but vanished and the two are now virtually tied nationally. And in the race for key battleground States as well, Trump has managed to pull ahead of her in Florida and Ohio for now. Even as Clinton resumed her campaign after a three-day layover following her pneumonia-induced medical episode last Sunday and released new medical records along with her doctor’s note that she is “fit to serve” as President, the news from pollsters was anything but cheery. The latest poll from New York Times/CBS News, released on Thursday, said the two were tied 42-42 per cent in a fourway race, with two third-party candidates (Libertarian Gary Johnson and Green Party’s Jill Stein) thrown in the mix. In a head-to-head matchup, the poll said Clinton has a 2 per cent edge against Trump among likely voters. A RealClearPolitics average of nine different polls conducted so far this month also gives Clinton a negligible 1.8 per cent advantage over her ;^]S^])0b[XRT^U@dTT]EXRc^aXP³b fTSSX]VRPZTSPcX]VUa^\cWT (cW RT]cdahWPbUTcRWTS $_^d]Sb PcP]PdRcX^]WTaTCWTRPZTfWXRW WPbbdaeXeTSUa^\@dTT]EXRc^aXP³b fTSSX]Vc^?aX]RT0[QTacX] '# fPbb^[SQh9TabThR^[[TRc^a3PeXS 6PX]bQ^a^dVWA^QTacb 0_aTbT]cPcX^]Q^gX]bRaXQTS fXcW°CWT@dTT]³b1aXSP[2PZT 1dRZX]VWP\?P[PRT5TQh '#±P[b^b^[SfXcWRPZTP[^]V fXcW@dTT]EXRc^aXP³bbXV]PcdaT^] _P_TafXcWcWTa^hP[Rh_WTaCWT \^]PaRW³bZ]XRZTabZThbUa^\cWT CXcP]XRP]SFX]bc^]2WdaRWX[[³bWPc P[b^b^[SUa^\WXbR^[[TRcX^]Pc 2WaXbcXT³bX];^]S^]^]FTS]TbSPh cWT112 aT_^acTS ?C8 BA0906>?0;0=Q F0B78=6C>= resident Barack Obama has announced that the United P States will terminate the national emergency against Myanmar and lift “soon” all the remaining sanctions in recognition of the country’s progress towards democratic reform. Obama made the pledge W B[XRT^U@dTT] EXRc^aXP´bfTSSX]VRPZT b^[SU^a $_^d]Sb 0\P]PaaP]VTb]Tfb_P_Tab Ua^]cX]V_W^c^b^UDB ?aTbXST]c1PaPRZ>QP\PP]S <hP]\Pa´bBcPcT2^d]bT[[^a P]S5^aTXV]<X]XbcTa0d]V BP]Bdd:hX 0? rival — down from a near 8 point lead as of August 9. Other polls focusing on major battleground States also found Trump making swift inroads. A CNN/ORC poll released on Wednesday said Trump now leads Clinton 4641 per cent in Ohio, and 47-44 per cent in Florida. A Bloomberg Politics poll also found him enjoying a 5-point lead (48-43 per cent) in Ohio. The changing outlook indicated in the new polls comes with the Election Day less than eight weeks away and the first of three presidential debates less than two weeks away. Ecf^a¶dZ_gVde^V_eZ_:_UZRe` Z^aRTeFDW`cVZX_a`]ZTj+CVa`ce Washington: Donald Trump’s investments in real estate overseas, including in Indian cities of Pune and Gurgaon, could have implications on America’s foreign policy if the Republican presidential nominee wins the elections and occupies the White House next January, a major US weekly said. In its cover story on Trump’s investments in properties overseas, the Newsweek on Wednesday said as Republican National Convention was about to get underway in July, the Trump Organization declared it was planning a massive expansion in the South Asian country. “That is a chilling example of the many looming conflicts of interest in a Trump presidency,” the weekly noted. “If he plays tough with India, will the government assume it has to clear the way for projects in that ‘aggressive pipeline’ and kill the investigations involving Trump’s Pune partners? And if Trump takes a hard line with Pakistan, will it be for America’s strategic interests or to appease Indian government officials who might jeopardise his profits from Trump Towers Pune?” the weekly asked. According to the weekly, several Indian political leaders including from the both BJP and the Congress have established close relationship with the Trump family as a result of its real estate investment in Pune and Gurgaon. PTI He insisted, “Russia has respected its obligations to fulfil the ceasefire regime in Syria from the first minute.” US officials have voiced scepticism that Russia will fulfil its part of the agreement struck last week between the two former Cold War adversaries after years of bad ADBB80=0A<H278458= CDA:4HC>38B2DBBBHA80 0]ZPaP)AdbbXP³bc^_0a\h6T]TaP[ ^]CWdabSPhfPbW^[SX]VcP[ZbfXcW WXbCdaZXbWR^d]cTa_Pac^]cWT R^]U[XRcX]BhaXPX]cWTWXVWTbc[TeT[ \X[XcPahR^]cPRcQTcfTT]cWTcf^ R^d]caXTbbX]RTPRaXbXbX]aT[PcX^]b CdaZXbWRWXTU^UbcPUU7d[dbX0ZPa fT[R^\TSWXbAdbbXP]R^d]cTa_Pac 6T]TaP[EP[Tah6TaPbX\^ec^ 0]ZPaPX]PRTaT\^]hfXcWUd[[ \X[XcPah_a^c^R^[CdaZXbWcT[TeXbX^] _XRcdaTbbW^fTS Myanmar’s de facto leader Aung >R]RjdZRT`_WZc^dER_kR_ZR UVScZdTR^VWc`^>9$(! 05?Q :D0;0;D<?DA piece of aircraft wreckage found in June off Tanzania A has been confirmed as coming from the doomed airliner MH370, Malaysia said on Thursday. The debris, found on Pemba Island off the Tanzanian coast, is the latest piece of wreckage to be linked to the Malaysia Airlines jet, whose disappearance remains a mystery. Malaysia’s Transport Ministry said the piece of debris, which had been taken to Australia for expert analysis, was found to have part numbers, date stamps and other identifiers confirming it came from the Malaysia Airlines jet. “As such, the experts have concluded that the debris, an outboard flap, originated from the aircraft 9M-MRO, also known as MH370,” a ministry statement said. “Further examination of the debris will continue in hopes that evidence may be uncovered which may provide new insight 5XVVLDQPLOLWDU\86µQRW IXOILOOLQJ¶6\ULDDJUHHPHQW Moscow: Russia on Thursday accused Washington of failing to meet its obligations under the Syria ceasefire agreement, while criticising US officials for voicing scepticism over cooperation with Moscow. Russian military spokesman Igor Konashenkov slammed the US for what he called “rhetorical fog” intended “to hide the fact that it is not fulfilling its part of the obligations.” In a statement, he defined the US role as “first and foremost to separate ‘moderate opposition’ groups from terrorists”. “As of the third day (of the truce), only the Syrian army is observing the regime of silence. At the same time, the ‘moderate opposition’ led by the US is increasing the amount of attacks on residential districts,” Konashenkov said. following a meeting with blood over Moscow’s Ukraine and Syria policies. AFP BHA80A468<4<DBC0;;>F083 34;8E4A84B³8<<4380C4;H´)D= 6T]TeP)CWTD=BhaXPT]e^hPbZTS cWT3P\PbRdb6^eTa]\T]cc^ P[[^fWd\P]XcPaXP]PXSST[XeTaXTb °X\\TSXPcT[h±X]SXRPcX]VcWT aTVX\TWPSQa^ZT]Xcb_[TSVTb^] cWTSXbcaXQdcX^]^U[XUTbPeX]V bd__[XTbBcPUUP]ST<XbcdaPc^[S aT_^acTabX]6T]TePcWPcZTh 6^eTa]\T]cP[[hAdbbXPPVaTTS RadRXP[cX\TfPbQTX]V[^bc^]cWT ST_[^h\T]c^UPXSR^]e^hbfWXRW XbPZTh_Pac^UPRTPbTUXaTcWPc QTVP]<^]SPh into the circumstances surrounding flight MH370.” Authorities had earlier said the piece of debris was “highly likely” to have come from MH370. However, the confirmation appears to have so far shed no fresh light on the plane’s fate. The Malaysia Airlines jet was carrying 239 passengers and crew when it disappeared en route from Kuala Lumpur to Beijing on March 8, 2014. It is believed to have crashed into the Indian Ocean, but an exten- sive deep-sea hunt off Australia’s west coast is drawing to a close with nothing found yet. However, several pieces of debris that apparently drifted thousands of kilometres toward the African coast have been identified as definitely or probably from the Boeing 777. Those finds have confirmed the plane went down but have so far shed no light on why and have fuelled questions over whether the official search is focused in the right area. :Xa_P]RPaahX]VBXZWb^aSTaTS c^[TPeTbc^aTX]2P]PSP ?C8Q C>A>=C> wo elderly Sikh men were stopped by staff and security at a store in Canada and told they could not enter with their kirpans. Harpal Gill, says in the 16 years he has lived in Canada, he has never been told to leave a store because of his kirpan, a ceremonial dagger carried by Sikhs. “It is my religious symbol. How can you stop me?” Gill asked the manager of the Dollarama store. “I showed her the kirpan and she said, ‘It is a weapon, a knife; it is dangerous,’” Gill was quoted as saying by CBC news. Despite the fact the two have been in the store many times before, they were told to leave. “It is allowed in the legislature, it is allowed in the federal Government,” Gill added. A spokesperson at the T Dollarama head office said this is the first time there has been an issue in any of their stores across Canada. Lila Radmanovich, who works for Dollarama’s media relations, said the company has a customer service policy that does not allow discrimination based on ethnicity or religion. The company has reached out to the Manitoba Sikh Society and offered apologies to the men. The company is now working with staff and security at the Winnipeg store to teach them the company’s policy, Radmanovich said. San Suu Kyi in what was her first official visit to Washington. “In part because of the progress that we’ve seen over the last several months, I indicated, after consulting with Daw Suu, that the United States is now prepared to lift sanctions that we have imposed on Burma for quite some time,” Obama said in remarks after a bilateral meeting at the Oval Office on Wednesday. Obama termed it “the right thing to do in order to ensure that the people of Burma see rewards from a new way of doing business and a new Government”. 6;>14 CA>CC8=6 134B7;0FH4A908;43 5>A HAB8=;40:20B4 3WPZP) 01P]V[PSTbWR^dac^] CWdabSPhbT]cT]RTSP[PfhTa^U TgTRdcTS (& fPaRaX\X]P[P]S 1=?[TPSTaBP[PdSSX]@dPSTa 2W^fWSdahc^ hTPabX]YPX[U^a bcTP[X]VP]S[TPZX]VcWTSaPUc eTaSXRc^UP]X]cTa]PcX^]P[ caXQd]P[PWTPS^UXcbST[XeTahX] ! "1P]V[PSTbW2hQTaCaXQd]P[ 9dSVT:<BWP\bd[0[P\P[b^ UX]TS[PfhTa5PZWad[8b[P\CPZP Ra^aT^eTacWT[TPZcWPcWPS b_PaZTS\PbbXeTR^]ca^eTabhPb 2W^fSWdahP]SWXbUP\X[h \T\QTabPccWPccX\TR[PX\TS cWTeTaSXRcfPb_aT_PaTS QTU^aTWP]SQhcWT;Pf<X]Xbcah X]bcTPS^UcWTcaXP[R^dac 5>DA:8;;438=?;0=4 2A0B78=278=0 1TXYX]V) 0[XVWcPXaRaPUcRaPbWTS ^]CWdabSPhSdaX]VP]PXabW^f X]BWXYXPiWdP]VX]7TQTX ?a^eX]RTZX[[X]VP[[U^da_T^_[T ^]Q^PaSCWT_[P]T;4$ \^ST[fXcW#$bTPcbfPb _a^SdRTSQh0E828]Sdbcah2^a_ >U2WX]P0_X[^cP]ScWaTT Rdbc^\TabfTaT^]Q^PaSfWT] cWTPRRXST]cWP__T]TSPc#_\ !C>DA8BCB:8;;438= 10;81>0C4G?;>B8>= 1P[X) Cf^U^aTXV]c^daXbcbfTaT ZX[[TSP]SPQ^dc!^cWTa_T^_[T fTaTX]YdaTSX]P]Tg_[^bX^]^] CWdabSPh^]Pb_TTSQ^PccWPc fPbUTaahX]VcWT\Ua^\cWT 8]S^]TbXP]c^daXbcXb[P]S^U1P[X c^;^\Q^Z_^[XRTbPXS 278=0!=3B?024;01 ;0D=27BD224BB5D; 1TXYX]V) 2WX]P^]CWdabSPh]XVWc bdRRTbbUd[[h[Pd]RWTSXcbbTR^]S Tg_TaX\T]cP[b_PRT[PQ ²CXP]V^]V!³Pb_Pac^UP] P\QXcX^db_a^VaP\\TQhcWT 2^\\d]XbcVXP]cc^QdX[SP \P]]TSb_PRTbcPcX^]Qh!!! cWTcX\TfWT]DB[TS 8]cTa]PcX^]P[B_PRTBcPcX^] Tg_TRcTSc^V^^dc^UbTaeXRT F>A;3B>;34BC<0= 8=8BA04;CDA=B " 9TadbP[T\) CWTf^a[Sb^[STbc \P]cda]TS "^]CWdabSPh P]ScWT7^[^RPdbcbdaeXe^a[XeX]V X]8baPT[aTPSXTSU^acWT1Pa <XciePWWTfPbST]XTSPRT]cdah PV^WXbUP\X[hbPXSHXbaPT[ :aXbcP[P]^QbTaeP]c9TfUa^\ IPa]^fX]fWPcXb]^f?^[P]S P]S[XeX]VX]7PXUPfPbQ^a]^] BT_cT\QTa $ ("cWaTT \^]cWbQTU^aTcWTFaXVWc Qa^cWTabUXabcbdRRTbbUd[ _^fTaTSPXa_[P]TU[XVWc =`_XURjeZ^V_Rad ]Z_\VUe`Z_TcVRdVU UZRSVeVdcZd\ Tokyo: Napping for more than an hour during the day could be linked to 45 per cent increased risk of type 2 diabetes, a new study has warned. Researchers at the University of Tokyo used data from 21 studies involving more than 300,000 people. They found that after 60 minutes napping becomes harmful, with risk increasing the more time a person is asleep. However, there was no link with naps of less than 40 minutes. They said long naps could be a result of disturbed sleep at night, potentially caused by sleep apnoea. This sleeping disorder could increase the risk of heart attacks, stroke, cardiovascular problems and other metabolic disorders, including type-2 diabetes. ;TUcXbc_a^cTbcTabcWa^fP_Tca^[Q^\QPc_^[XRT\T]SdaX]VR[PbWTbX]?PaXb^]CWdabSPh 0? 2YHUHDWLQJRQ(LG2YHU.YLVLW.DUDFKLKRVSLWDOV Karachi: Over 4,000 people went to private and Government hospitals due to ailments linked to overeating on Eid-ul Azha in Karachi, the capital of Pakistan’s southern Sindh province. The Health Department said that people went to private and Government hospitals complaining of diarrhoea, dehydration and vomiting after the festival marked by traditional feasts. More than 2,200 people visited Jinnah Post Graduate Medical Complex, 1,000 people went to Civil Hospital Karachi, 500 had visited to Abbasi Shaheed Hospital, Geo TV reported, quoting a spokesman for the Health Department. Due to overeating gastro, dehydration, vomiting are common on Eid-ul-Azha, Deputy Director Abbasi Shaheed Hospital Dr Huma Ahmed said, adding that people should take minimum meal and try to avoid eating oily and junk food. Director Health Karachi Dr Shakoor Abbasi suggested that people should take vegetables in lunch and dinner beside meat or mutton and avoid soft drink specially heart, diabetic and hypertension patients. Approximately 1,000 people also visited hospitals for injuries sustained while sacrificing animals. eXePRXch " 347A03D=k5A830H kB4?C4<14A %! % &KHHUVWRHOHJDQFH ?^^YP7TVST´b ]TgcUX[\39 322-$+(*'(ODVWVHHQLQ+ULWKLN 5RVKDQVWDUUHU0RKHQMR'DURKDV EHHQFDVWRSSRVLWH$OOX$UMXQLQ XSFRPLQJ7HOXJXILOP'-'XYYDGD -DJDQQDGKDPUHYHDOHGDVRXUFH ´3RRMDKDVEHHQILQDOLVHGDV WKHOHDGLQJODG\IRU'- 6KHSOD\VD FRQWHPSRUDU\JLUOLQ WKLVURPDQWLFGUDPD DQGKHUUROHZLOO DSSHDOWRDOO VHFWLRQVRIWKH DXGLHQFHµVDLGD VRXUFH 7REHKHOPHGE\ +DULVK6KDQNDU WKHSURMHFWZLOOEH EDQNUROOHGE\'LO 5DMXZKRKDV UHXQLWHGZLWK $UMXQDIWHU VHYHQ\HDUV 7KHUHJXODU VKRRWLQJRI WKHSURMHFW ZLOO FRPPHQFH IURP 2FWREHU 7KLVZLOOEH 3RRMD·VWKLUG 7HOXJX RXWLQJDIWHU 0XNXQGD DQG2ND /DLOD.RVDP ³8S^P[^c^U Ud]SaPXbTab U^aRWX[SaT] fW^PaT UXVWcX]V RP]RTa8P\ f^aZX]V^] cWXbU^ahTPab P]S:P_X[BWPa\P WX\bT[URP\Tc^\TP]S cP[ZTSPQ^dcQTX]VP _Pac^UcWXb7TbPXS0P_ \dYWTX]e^[eTZPa^Xb \TX] °EXeTZ>QTa^X 1aX]VX]Vc^VTcWTa^]T^UcWT f^a[S³bQXVVTbcXR^]bfXcWPV[^Q P[R^\TShbcPa30E83142:70< WPbaTd]XcTSfXcW:TeX]7PacU^a cWT]Tf²<^STa]4bbT]cXP[b bT[TRcTSQh3PeXS1TRZWP\³RP\ _PXV]U^a7<CWTR^\\TaRXP[Xb bTc^]Pa^PScaX__XRZX]VcWT bc^ahd_Ua^\cWTXaUXabc7< R^\\TaRXP[c^VTcWTafWTaT:TeX] _aT_PaTSc^_[PhcWTa^[T^U3PeXS X]PQX^_XRUX[\ <PZTab^UC^\ 2adXbTUX[\bdTS 7KHIDPLO\RIDYLFWLP RIWKH&RORPELDSODQH FUDVKWKDWRFFXUUHG GXULQJWKHSURGXFWLRQRI 720&58,6( VWDUUHU$PHULFDQ 0DGHKDVILOHGD ZURQJIXOGHDWKVXLW DJDLQVW,PDJLQH (QWHUWDLQPHQW DQGRWKHU SURGXFWLRQ FRPSDQLHV 7KHVXLWFODLPV WKDWVDIHW\ZDV FRPSURPLVHG EHFDXVHIOLJKW RSHUDWLRQVZHUH UXVKHGWRVDYH PRQH\ZKHQWKH PRYLHZKLFKZDV RULJLQDOO\WLWOHG0HQD IHOOEHKLQG VFKHGXOH ontrary to the perception of India not being a patch on the world wine map, the wine producers of India are swiftly making their mark on national and international markets. The home-grown brews are now being picked up by retail majors and restaurants in the West which is traditionally believed to have a more evolved nose for the good stuff. Marks and Spencers, in fact, recently picked up Sula for its shelves. Over the past decade and a half, wine culture has been making steady inroads into the drinking habits of Indians. Consumption of wine has led to a steady 20 percent growth of the industry, the most consistent growth in the spirits segment despite the tough years between 2005 and 2011. “The Indian drinking culture was dominated by whisky and beers for a long time. But wines have been accepted at last, courtesy women, the youth and the lifestyle seeker. And slowly and quietly, India has worked on terroir, technique and grapes to get the finer taste and finish”, said Sonal Holland, the first Masters of Wine here. “We are one of the fastest growing economies in every aspect and wine is no exception. At the pace at which it is growing, we are well on our way to making our impact on global wine forums,” she added. India is becoming one of the formidable wine-producing countries in the world courtesy the makeover induced by massive spends on research and development. Wine producers also think that this is the right time for the evolution of a wine culture. “Being the fastest growing wine market in the world, there is a great opportunity for Indian wines to gain popularity and compete against the Western brands. India is the market for the next decade”, said Rajeev Samant, founder and CEO of Sula Vineyards. “We sell 95% of our wines in India and only 5% is exported. Our export bouquet has the finest and the most premium range. We have C 8]SXPXbQTR^\X]V^]T ^UcWTU^a\XSPQ[TfX]T _a^SdRX]VR^d]caXTbX] cWTf^a[SP]S^]T^U cWTUPbcTbcVa^fX]V R^]bd\Ta\PaZTcb C40< E8E0 aT_^acb clearly broken the image of being average. This shows the growing market India is becoming.” So what are the growth drivers? “The health benefit of wine is one of the major reasons for increased consumption. The red variety, especially, has medically proven health benefits,” said Ravi Gurnani, director, York Wines. “Apart from that, wine is a perfect social drink. A glass of wine in your hand will say elegant, not hungover or wasted the next day”, he added. Talking about the experiments done in wine-making, he said “The experimentation with wine-making is not extended to the wild limits. We do experiments but not on the cost of quality of wines. The Indian producers of wine are also keen on keeping their product the best. The regular quality check of vines, surveying palate fests worldwide, getting international oenologists from both the new and old worlds for testing and competitive pricing are some of the reasons, The extensive research and adapting the correct procedure for wine-making is also pushing the wine markets on the growth curve. Historically, wines were there over 3,000 years ago. The Moghul kings, who ruled India before the British, are known to have been wine connoisseurs and there is record of wines imported from Persia for them and the nobilities. They also encouraged wine production for their consumption but phylloxera destroyed all the vines in 1890s. No new vines were planted till about 30 years ago. Now that India is enjoying its wine, there are still some problems that need to be attended. “Duties of up to 300% or more make imported wines extremely expensive. There are several other latent costs and procedural barriers since wine is still categorised as liquor. The Indian Constitution is anti-alcohol and exhorts the States to introduce prohibition and gives them the power to form independent policies,” said Subhash Arora, founder president of Delhi Wine Club. “It’s like dealing with different countries, each with its own complex policies,” he added. FWTaTcf^]PcX^]b\TTc 1RWKLQJFDQEHPRUHVRRWKLQJIRUDFRXQWU\ZKLFKKDVZLWQHVVHGDVHULHVRI WHUURUDFWVLQWKHUHFHQWSDVWRWKHUWKDQWRHQJDJHZLWKFXOWXUHDQGDUW $53,7$ 6,1*+ UHSRUWVRQ1DPDVWH)UDQFHDFXOWXUDOIHVWLYDORI,QGLDLQ )UDQFHEHJDQRQ6HSWHPEHUDQGZLOOFRQFOXGH1RYHPEHU all it a cultural bonaza. From films of none other than Satyajit Ray to recitals by dancers Astad Deboo and Raja and Radha Reddy, Namaste France, is a rare art feast to France by India. Indian traditional arts, music, dance, theatre, cinema, yoga, fashion and literature will be showcased at ‘Namaste France’, a festival organised by the Embassy of India in Paris in collaboration with the Indian Council for Cultural Relations (ICCR). Indian classical dancer and choreographer of Odissi dancing style, Sonal Mansingh, who is also performing in the festival, says,“Dance is a dynamic yoga and I am going to present something that would make the Indian dance forms and dancers unique. The presentation will be a a fusion of different art forms, which will be glimpse of life. I will try to present dance as a darshan”, says the dancer, who is also proficient in Bharatnatyam, Kuchipudi, and Chhau . Pandit Bhajan Sopori, the ace santoor maestro, another participant in the festival, says that “It’s a kind of cultural C n effort to make people write again, the multi handA made paper platform-Chamber of Ink has launched ‘PaperBlanks’ and ‘Paper-Oh’ products to the Indian customers. The products include journals, dayplanners, address books and guest books in three sizes, ranging from 1100 to 1900. As per the owners, the prices are high because it also includes some percent of royalty that the brand pays to the artists whose work has been used. “India is a country of art and culture. The inspiration required for our products has been diversely fulfilled here. We as a handmade paper maker believe in eco-friendly products with artistic touch. The notebooks are either Smyth sewn with minimal glue or hand stitched which makes the book open as flat as possible and the pages never fall out”, said Sukriti Jiwarajka, founder of the brand. The writing paper is sourced 100% from sustainable forests and is uncoated with no added veneer and the exchange that youth from France and India will together showcase their cultural tradition.” Sopori adds, “This collaboration of two countries is a good experiment and it will definitely create a long-lasting memory in the heart and mind of the people of both the countries.” “Namaste France will be a milestone, as it is wonderful to bring together people for cultural exchanges”, says Ambassador of France to India Alexandre Ziegler. He further says, “France and India shares a historical tie in the terms of culture, fashion and art, which is also reflected in excellent bilateral relationship. FranceBonjour India, a similar kind of cultural festival will be organised next year in India”. As many as 30 films of Satyajit Ray including The Big City, The Fortress and The Elephant will be screened at the festival. Spiritual leader Sri Sri Ravi Shankar, fashion designer Rahul Mishra and Michelin-starred chef Vineet Bhatia will also be a part of Namaste France. During the mega cultural festival two major Indian festivals-Diwali and Navratri--would be celebrated. Contemporar y Indian dance performance ,‘Divine Rhythms’, by legendar y dancer-choreographer Astad Deboo, kathak by Kumudini Lakhia, recitals by renowned kuchipudi duo Raja and Radha Reddy, by violin maestro L Subramaniam and sarod by Amaan and Ayaan Ali Khan will be the major highlights of the Namaste France Festival. The festival is taking place in 23 cities of France. :DB70=<8CA0 1=5B931DBE3;I518 FWPc0\TaXRP]bRP[[²CadRZb³PaTQXVQdbX]Tbb U^acWTPdc^X]Sdbcah^dcWTaTP]ScWThS^]c VTc\dRWQXVVTacWP]cWTUP\^db5^aS5 $ hat Americans call ‘Trucks’ are big business for the auto W industry out here and they don't get much bigger than the famous Ford F150. As much as we might complain about the size of late SUV’s on Indian roads, these vehicles pale in comparison to these monsters you see in America. Take the newly launched Jeep Grand Cherokee, in the US it looks positively puny in comparison to vehicles such as the Cadillac Escalade. And then there are what Americans call ‘Trucks’, now these are not trucks as you and I know trucks in India, these are large personal vehicles, almost always with a flat-bed to haul your things around, you might have seen the Tata Xenon and Mahindra Getaway, well these are similar, just twice as big. And these were basic, like most American vehicles always were. Simply put together and easily repaired. Luxury was never the American way. But those days are gone, and that is quite evident in the 2017 Ford F150 King Ranch that I recently had a chance to drive on the Ford test track in Dearborn, Michigan. The F150 is by far and away Ford's best-selling vehicle, by some estimates one F150 is sold every thirty seconds. Despite competitors like the Dodge Ram, Chevrolet Silverado and now the Toyota Tundra, the F150 continues to rule the roost. And like all vehicles the F150 has continued to grow. These are some of the headline numbers. The F150 is 6.19 meters long, that is more than twenty feet long. With its (admittedly huge) mirrors out, the car is over eight feet wide. The 4x4 version with the twin-cab weighs over 2.2 tons; but with the mammoth 3.5-litre V6 EcoBoost engine that produces 365 horsepower and vitally 450 pounds-foot of torque - which 610 Newton-meters for those of you guys who love metric figures, this monster can two two monsters, with a towing capacity of five tons. Let me compare those figures with what we would call a large car in India, Ford’s own Endeavor. Which is four feet shorter, a foot thinner and over two hundred kilograms lighter for the top 4x4 model with the 3.2 engine. And as much as I like the Endeavor, albeit with the smaller engine and twowheel drive (will you ever take an SUV out to the country?) as I was to discover the F150 is far more fun to drive as well. Yet, do not for one second think that this is an unrefined lump of meat, this isn’t a redneck wagon. Hell no. Far from it, the latest iteration of the F150 has Ford’s most advanced gearbox yet, possibly one of the most advanced gearboxes in the world - with ten forward speeds. That is no typo, this car has ten forward speeds. And that is what we drove at Ford’s highspeed test-track outside their headquarters in Dearborn, Michigan. The version we drove was the luxurious ‘King ranch’ version, which is kitted out in acres of embossed leather and wood, a state-of-the-art Sony infortainment system that would not be out of place in a German luxury car. The interiors of the car has the feel of a large wooden cabin in the American countryside, which is what Ford was trying to achieve one figures. But that was not it, Ford wanted a whole posse of journalists to try out the new F150 at the highspeed test track for a reason. This behemoth can move at a considerable rate of knots thanks to this new gearbox, to demonstrate that to us on the high-speed track Ford engineers had put ‘Stop’ signs at strategic points, these showcased not only how quickly the new F150 went from a stand start up to the highway speed limit in the US of 70 miles per hour (around 120 kilometers per hour) and beyond but also how the car used the gearbox to achieve some engine braking as well. And the car is surprisingly easy to drive, yes, you know that you command the roads but the F150 does not feel out of place on the track. The steering is light, the gear-changes are smooth and you can even manually shift gears - useful not so much for the track but more for country and hilly roads where you might need to hold a gear. In the early days, the first F150’s in the late-1950’s had a crude three-speed automatic gearbox, but you really appreciate modern technology. This huge beast is also economical by American truck standards, albeit it would probably give an Indian small car owner a heart attack. That said, petrol costs half of what it does in India out here. Sure, this is no Mustang, it isn’t supposed to set the roads alight. But it can really get a move on when it needs to. This might look like a Diplodocus in a world of small raptors, but this can give the raptors a run for their money. Vehicles like the F150 work in a huge country like the United States with large expanses of rural roads and where ranches and farms can often expand as far as the eye can see. Clearly, something like this can only be made for the US and Canada where you need such monstrous vehicles propelled by bigpetrol engines to go anywhere. But you know what, I drove a lot of cars at this Ford track day, the utterly maniacal Focus RS and the new Fusion (which is an amazing car), but it was the F150 that left a smile on my face. 0cadTR^\_P]X^] 2T[TQaPcX]VWd\P] PacXbcahP]SRaPUc ?P_TaQ[P]Z[Pd]RWTS faXcX]VY^da]P[b W^]^daX]VcWTQTPdch^U PacXbcXRRaTPcX^]Qh _PhX]Va^hP[chc^TeTah PacXbcfW^bTf^aZWPb QTT]dbTSX]cWTR^eTa 1h0=:8C0 908= covers from recycled binder boards. Keeping the journals handy, the designers teamed up for an accordion-style memento pouches which is also the signature feature to serve the purpose of storing paper ephemera and other items that can easily be tucked away. But the feature that grabs the attention the most is the closures of the notebooks involving an ornate metal clasp, magnetic wrap or a strap. Clasp closure is an old world charm with a modern flair and the others being offered by several brands too. While grabbing this piece of art, one would eagerly want to know the whereabouts of the design. To answer this query of any passionate writer, the brand has come up with the artisan history or rather the inspirational story at the back of each journal. The brand has launched its products with 50 designs from French textile to Persian Safavid binding art, from Japanese Lacquer box patterns to the traditional embroidery from India's Gujurat region and also the manuscript of Mahatma Gandhi eP[[TheXePRXch # '(+5$'81_)5,'$< _6(37(0%(5 3T\P]SaXbTbU^aSTbXV]TaSTR^aP]S^a]P\T]cPcX^]U^aW^\Tb By Team Valley Vivacity one are the days, when bathrooms were meant to be basic space for bathing and relieving oneself with market trends in recent years pumping up the basic requirement to transform it into a luxurious display of the home owners monetary and social 'position'. No longer remaining a peaceful town known for its "green hedges and grey hair", Dehradun with its increasing population and rise in constructions and commercial activity has now developed into a decent market for manufacturers of décor items and fixtures with various established and more recent brands along with a range of products now being made available locally. According to interior designer Aamir Sheikh, threedimensional wall-papers with designs and matte flooring are in trend. "Wallpapers were available in the past too but now a days such products with digital prints are gaining in popularity. They come in varying shapes, sizes and quality," he said. Sheikh further averred that those people in Dehradun who can afford it, tend to spend an average of about Rs five lakh on bathroom decore. The cost can rise higher G depending on the quality and brand of the product, he added. Akansha Thapar of a local interiors and developers enterprise said that a considerable number of people in town are opting for well established brands in sanitar y ware. C onsidering the various brands, wide range of design and price range, people can conveniently choose their purchase according to their budget and taste, said Thapar. The fittings and fixtures including wash basins, commodes, designer faucets and other items are major factors influencing the feel and look of the bathroom. With changing times, toilets these days are also being perceived and touted by some as symbols of socio-economic class. "Of the total budget for constructing a home, people now spend about five per cent of the total budget on their bathrooms. Then there are those who don't mind spending up to 20 or 25 per cent of their total budget for construction their home, said Varun Agarwal of Parivartan Interiors. He further opined that white, grey and light blue colours are comparatively more popular among customers in Dehraun. Excessive use of colour and gaudy is out of trend with customers in general going for subtle shades with neutral colour tones. "Bath tubs however, have not elicited popular demand from the people of Dehradun. The water here contains calcium which makes it difficult to clean. Also people don't really have time to sit and take long baths in tubs which also occupy considerable space which cannot be afforded by most. While bath tubs have not picked up in popularity, glass panels like the ones used in hotel bathrooms are being preferred by customers, Thapar said. Tulika Aswal of Wall Arts Dehradun averred that Jacuzzis are also being purchased, though in limited numbers, by people in Dehradun. "Some trends seen in Delhi at times are also picked up by people in Dehradun. The bathroom fittings and fixtures which were accorded little importance in the past have been picking up in popularity in recent years. This change in customer choice in recent years has been brought about mainly by factors including rising income, rising urbanisation, and class consciousness influencing middle class," she said. When it comes to the installations of lights, people show a tendency to opt for wall mounted lighting in lamp shapes which emit soft and diffused light instead of harsh directly focused lighting, said Gaurav of Inside Outside. =TTSc^PSSaTbb\T]cP[WTP[cWP]S^cWTaXbbdTbRPdbX]VbdXRXSP[cT]ST]RXTb By Nitika Bhardwaj ecent years have seen a rise in the tendency among some members of society to resort to extreme steps like committing suicide due to varied reasons from relatively small issues to major mental toll taken by the 'modern' lifestyle related issues. The increased commercialisation in society affecting and even replacing traditional value systems which influence social attitudes, suicide trends also reflect the breaking of gender stereotypes in the state. According to data from the State Crime Record Bureau of Uttarakhand (SCRBU) in the past five years, the number of men committing suicide has been higher than that of women who ended their lives. Trends show that there has been a rise in the number of suicides attempted by males in the age group of 15 to 30 years due to various factors including interpersonal relationship issues, failure in academic examinations and substance abuse. During the past five years, 34 cases of men committing suicide goaded by relationship-issues R were reported compared to the 26 women suicides during the same period. Official data points out at a rise in male suicides during the period from 2011 to 2015 whereas a sudden rise in female suicides was recorded in 2015. Failure in examination is another cause of suicides with male suicides due to this factor most comprising those in the 14-29 years age group. Alarmingly, failure in academic examinations appears to be the most common cause for suicides in both the Garhwal and Kumaon regions of Uttarakhand. The female suicides caused by failure in examination involved those in the 15- 29 years age group. Though there has been a general rise in such suicide cases between 2011 and 2014, only one female suicide and six male suicides goaded by academic failure were reported in 2015. The total number of deaths by suicide in the years 2011, 2012, 2013, 2014 and 2015 were recorded as 317, 424, 365, 207 and 475 respectively. These cases also include suicides by persons affected by factors like bankruptcy, inability to pay monetary Kasiga School debts, dowry, extra marital affair, divorce, impotency, infertility, other family issues, physical and mental issues, extreme poverty, unemployment, physical abuse and unknown causes in some cases. Lifestyle issues and rising pressure have caused a rise in the number of people of varied ages who find themselves in a situation which appears hopeless to them without the means to escape from the problem. In some cases, such persons end up choosing the option of committing suicide in desperation to free themselves from the "problematic" situation. Citing an example of a girl studying at an institute in Selaqui, Dehradun based clinical psychologist Dr Pratibha Sharma said that youngsters are attempting suicide more than any other age group. "The girl was in a relationship with a male from Chandigarh who purportedly used to force her for sex. She has separated from the male now but still gets terrified by nightmares and hallucinations of him being in her room and beating her. He used to beat her when she refused his demand for sex," said Sharma. The girl in question had attempted suicide without success and is presently undergoing counseling, she added. Another local psychologist Dr Amit Soni says, "At times, people who consider the option of committing suicide feel that they have lost all control with their problems appearing inescapable. They can't think clearly or make logical decisions. They feel unable to stop the pain or the person causing it. Affected by low self esteem making them view themselves as worthless, such people find themselves unable to end the sadness. They seem to fear that they will never regain control of their life and can't see beyond such a scenario." Regarding causes for suicide, Dr Sharma pointed out the inability to accept failure, academic pressure and disappointments, loss in self esteem and relationship failures as among the major factors behind rising cases of suicide in Doon. Sharma, who also provides her services in the Doon Hospital further said that on an average, she gets 15 to 20 suicide related cases in a month with Dr Soni handling an average of 10 such cases in a month. Dr Sharma pointed out that among the youngsters, girls were generally more vulnerable to get affected by depression and anxiety disorder. "Girls tend to be more emotional, vulnerable and easily get attached to people. These traits, at times make it harder for them to tackle the situation considering social norms and 'family prestige' issues." Psychologists state that 80 per cent youngsters studying in Doon are from other cities and thus are likely to face more problems than the locals residing with their families. Having a family may be an important factor mitigating probability of suicide but it doesn't assure zero suicide attempt. Absence of parents and a family at times causes problems for some who feel stifled, lone and worthless. The absence of emotional connect or emotional support can be fatal at times in the cases of people vulnerable to extreme measures, said Sharma. Every individual may experience differ- ent conditions and display symptoms with varying intensity. "Any sudden change in their behaviour and habits can be a sign. Loss of appetite or overeating, inability to concentrate on day to day work, sleeplessness or stupour, negativity, extreme mood swings are some of the symptoms seen in those vulnerable to committing suicide," said psychologist Dr Rachna Berry. She lays emphasis on the importance of proper parenting. "It is very important to let your child know that no matter what he/she does whatever he/she goes through you are unconditionally there to support them. Such support tends to be missing in proportion of parents in Indian society which may also give rise to suicidal tendencies." Stating that mental health needs to be considered more seriously breaking old stereotypes, psychologists stress that those experiencing protracted or intermittent sleeplessness, depression and similar issues should consult a qualified counselor without delay. language befitting for the occasion. University of Petroleum and Energy Studies Tanushree Khattri pursuing B. Tech Power System Engineering of Electrical Power and Energy from the UPES, Dehradun finished a two months' internship in a French University. She was with 'Ecole Nationale Superiere de Mechanique des Microtechnique, Besancon, France (ESNMM, France) from June to August this year. During her tenure, in the Electrical Engineering Lab at Plateforme Department of ENSMM University, France, Tanushree worked on the project 'Development of a 3D intraoral scanner'. The scanner will be of great help to ortho-dentists and a big relief to patients with denture problems because it would be able to make a 180-degree single scan of the entire denture, instead of sectional scans done these days. Tanushree has been offered masters in ENSMM, France, on a scholarship. Also 146 students at UPES have been offered placement by IBM Ecole Globale International Girls' School The flight of human want has no end, our desires always leave us wanting more. But in truth, happiness can be found in even the smallest of things. Life is beautiful in its essence. This was the soulful message rendered by Atul Pundir in the form of a brilliant poem written by him titled "Tamanna ki Udaan" at a function held to commemorate Hindi Divas by Kasiga School. As the chief guest on the occasion, the prominent lawyer who also enjoys a strong reputation for his writings, Pundir spoke to the students on the subjects of life, aspirations and love. He answered questions about his new book "Itni Si Toh Baat Hai" due for release later this year. Reflecting on the true meaning of love, he expounded his philosophy of love being spiritual in nature and having a very deep interpretation that is often misjudged. "Youngsters often mistake physical attraction between a boy and a girl to be love. However, love is a lot more profound. Love to begin with, is giving without demanding anything in return. To love is to care," said Pundir. He went on to comment that it is unfortunate that love is treated as a sort of a taboo word or something to be secretive about. True love can never be wrong and the younger generation should imbibe the right meaning of love. The Chief Guest's literary talent, relevance of subject and powerful eloquence left the staff and students visibly enthralled. The function was hosted by Nutan, the Hindi teacher at Kasiga who displayed a strong command over the 0LVV)UHVK)DFHVDZKXJHSDUWLFLSDWLRQIURPFLW\ VDVSLULQJPRGHOV 9$ / / ( < * 2 2 ' 7 , 0 ( 6 Valley Vivacity sketches out a weekly listing of the most interesting events happening in Dehradun and around, so that you never miss the coolest thing in town. Have a whale of a time!!! WHAT: Cultural Journey To Himalayan Village DATE: September 16 TIME: 6 am VENUE: Uttarakhand CONTACT: +91-9984464000 WHAT: Mr. And Miss Doon 2016 Auditions DATE: September 18 TIME: 11.30 am VENUE: Dug Out Sports Grill and Lounge CONTACT: 7060458020, 9719067502 WHAT: UK State Ranking Billiards & Snooker Cham DATE:September 16 TIME: 7:00 pm VENUE: 147 Snooker Academy, 2nd Floor, Om Tower, GMS Road, Dehradun CONTACT:Pankaj-8899147147, 9935241641 Ecole Globale International Girls' School won Silver and Bronze medals at the 15th All India Open Karate Championship in Chennai. Almost 200 students from all over India participated in this event. The student ranged from 6 to 16 years in age. Hridita Chaudhary won silver medal and Sonali Sharma won Bronze medal in under 16 categories. Sanjana Singh won Bronze medal in under 18 category. WHAT: Star Wars (Dance and acting talent hunt) DATE: September 21 TIME: 10:00 am VENUE: DAV Inter College, Dehradun CONTACT: 0135 265 4320 WHAT: Finding your life's purpose DATE: September 23 TIME: 06:00am VENUE: Camp Tappu Sera, Dehradun CONTACT: 9811466370 EMAIL ID: mandy@buddhadimension.com WHAT: Dehra County Fest 2K16 DATE: September 22 - 26 TIME: 08:00 am VENUE: Parade Ground, Dehradun CONTACT: 9927399996 WHAT: Booknerds Google Hangout Featuring Kanchana Banerjee DATE: September 17 TIME: 11.30 am VENUE: Indian Institute Of Petroleum, <RXFDQQRZZULWHWRXVDWYDOOH\YLYDFLW\#JPDLOFRP Dehradun CONTACT: 8958260927, 9759360927 WHAT: Dandiya Night- Rock N Dhol DATE: September 24 TIME: 7 pm VENUE: WIC, Dehradun CONTACT: 0135-2740144, 2740132,105 WHAT: Tribute To Ustaad Nusrat Fateh Ali Khan DATE: September 16-17 TIME: 10 am VENUE: Strings and Bowls, Old Mussoorie Road, Dehradun CONTACT: 9897447028 b_^ac $ 347A03D=k5A830H kB4?C4<14A %! % DFA6CDE2CDE@E96C6D4F6 A^]P[S^³b[PcT bcaXZT0VdTa^³b WPccaXRZWT[_ ATP[2Xchc^ bcPacD2; RP\_PXV]^] _^bXcXeT]^cT* ;TXRTbcTafX] QXV^]STQdc fWX[TB_dab U[^]STa 0?Q ?0A8B railing until the 89th minute against Sporting Lisbon, Real Madrid was reminded that becoming the first club to retain the trophy in the Champions League era won't be an easy task. The 11-time champions needed a late winner from substitute Alvaro Morata to prevail 2-1 in their opening game in the competition on a Wednesday night also marked by Premier League champion Leicester's maiden Champions League win. Playing against his former team, Cristiano Ronaldo was on the score sheet at Santiago Bernabeu stadium as he leveled with one minute left from a free kick before Morata's winner in added time. But the Portugal star was unable to match Sergio Aguero, who netted a hat trick with Manchester City. Sergio Aguero kept up his explosive start to the season by scoring a hat trick for Manchester City in a 40 win over Borussia Moenchengladbach in their rescheduled match. After a one-year absence in the tournament, Dortmund celebrated its return by putting six goals past Legia Warsaw, while French clubs Monaco and Lyon made both winning starts. Thrashed by Tottenham 4-1 at White Hart Lane last season in Europa League, Monaco took its revenge on Europe's biggest club stage with a 2-1 win at Wembley. The match was moved to England's national stadium because of construction work at Spurs' home ground and drew 85,011 fans, a club-record home attendance and a record for an English club. Monaco playmaker Bernardo Silva opened the scoring after only 15 minutes before Thomas Lemar doubled the lead near the half-hour mark. Spurs reduced the deficit through Toby T 4]V[XbWRWP\_X^];TXRTbcTa2Xch_[PhTabRT[TQaPcTPV^P[PVPX]bc1T[VXP]RWP\_X^]2[dQ1adVVTX]cWT2WP\_X^]b;TPVdT^]FTS]TbSPh]XVWc 0? 0=6AH0;;46A83>D1CB9DE4³B270=24B 0?Q CDA8= coach Massimiliano Allegri angrily denied his side is favorite to Jwinuventus the Champions League following a 2aXbcXP]^A^]P[S^VTbcdaTbPUcTacWT\PcRW C^bdXc8]SXP]UP]b ;P;XVP\PcRWTbc^ WPeTTPa[hbcPac ?C8Q =4F34;78 a Liga President Javier Tebas on Thursday announced that the kick-off timings of the L Spanish League matches will be changed and there would be early starts to suit the ever increasing Indian football fans. Inaugurating La Liga's New Delhi office, their sixth base of operations overseas, in the presence of LaLiga ambassador Fernando Morientes, Spanish Davis Cup team led by Rafael Nadal and AIFF officials, Tebas said the kick-off timings will be changed to 4:30pm local time in Spain (8pm IST). Indian fans, who normally get to watch the La Liga matches late at night, will now be able to watch these games at prime time in late evening. Tebas was excited about the opening of this APUPT[=PSP[aXVWcP]S5Ta]P]S^<^aXT]cTb_[PhU^^cQP[[ ?C8 new office and the impact it will have for La Liga. "It means a lot; this is one of the most important days in LaLiga's history. Being present in India is very important to us. We have been working hard towards this for a while and have even made changes to kick-off times with Indian fans in mind," Tebas said. One of Spain's most revered strikers Fernando Morientes feels that the Gen-Next of the 'La Rojas' may find it difficult to replicate the success of their 'Golden Generation' as the national team is going through a difficult transition phase. "Spanish national team is going through a change. The transition phase for any national team is a difficult one. In Europe, the gap between quality of various teams is decreasing. There are far too many competitive teams now," Morientes, who is here as a La Liga ambassador. 0? massive outlay in the transfer market in the offseason. In the transfer window, Juventus had a summer spending spree which included signing last season's top goalscorer Gonzalo Higuain from Napoli for 90 million euros ($99 million) in the most expensive transfer in Italian football history. Great things were also expected of Juventus in Europe, but it opened up its campaign with a disappointing 0-0 draw at home to Sevilla on Wednesday. "I think Juventus has the same ambitions as last year and two years ago. No more, no less," Allegri said after the match. "It doesn't mean that because we had a great transfer window we are now obliged to win the Champions League, because winning the Champions League is not easy. It seems that Juventus is the only favorite for the Champions League when it's been 20 years since Juventus won the Champions League, so we need to keep our feet on the ground." ?4?0??40;BC>50=B MANCHESTER: Boos reverberated around a farfrom-full Etihad Stadium as City's players lined up for the Champions League anthem before their game against Borussia Moenchengladbach. It was the same old story on Wednesday, with only 30,270 spectators inside the 55,000seater Etihad for a game City won 4-0 with some irresistible attacking football. "They must forget what happened in the past," Guardiola said. "The stadium was not completely full so the only thing we can do is play good so the people at home say, 'Wow, next time I will be there.' We have to be so proud to play in this competition.” Alderweireld's header in the 45th minute but couldn't make the most of lots of possession in the second half. Bayer Leverkusen failed to hold onto a 2-0 lead in the group's other game, letting CSKA Moscow come from behind and rescue a point in a 2-2 draw. Elsewhere, Zinedine Zidane's coaching skills BTaVX^ made the difference, as his 0VdTa^ decision to bring in Morata and James Rodriguez paid off. Rodriguez provided the assist, curling a perfect ball for Morata's header. Sporting had the match at the Santiago Bernabeu Stadium largely under control and was rewarded when Brazilian midfielder Bruno Cesar gave scored with a shot from inside the area in the 48th minute. Ronaldo equalized from an 89th minute free kick. Borussia Dortmund enjoyed a stroll in park at Polish champion Legia Warsaw, scoring with six dif- .LZLVIDFH0XPEDLLQZDUPXSWRGD\ ?C8Q =4F34;78 will be a tricky test for New as they are unlikely to IgettZealand much batting practice on a pacer friendly Feroz Shah Kotla track when they face Mumbai in their only warm-up match of the tour, starting here on Friday. Going by the nature of the pitch on eve of the three-day game, senior player Ross Taylor said he was not expecting the ball to turn much at Kotla, but was aware it won't be the case in the three-Test series, starting in Kanpur on September 22. "Well, it is part and parcel of the way Test cricket is being played. It is no different when you come to New Zealand. We leave a little more grass on the wicket. I guess that is what home advantage is all about. We are expecting the wickets to turn over here. We are not expecting the wickets to be like this one here at Kotla. We are expecting it turn for the Test matches," Taylor said referring to Kotla wicket, which is a fresh one with a bit of grass on it. However, he stopped short of saying that it was a deliberate ploy by the home team to not =TfITP[P]S_[PhTabSdaX]VP_aPRcXRTbTbbX^]X]=Tf3T[WX^]CWdabSPh have New Zealand play on a turning track. "Not really. It is what we expected to see here. Last two tours, we did not even have a warm up game. So nice to have one this time. Even the matches we played here in Delhi during World T20 had more grass than other venues. A warm up game is a warm up game. It is a chance to get out and play in Indian conditions, obviously it is a lot warmer than back home. So it is nice to get out and stretch your legs. We are expecting a tough match against Mumbai," ?C8 µ3VReZ_X:_UZRReY`^VZdUZWWZTf]e¶ =4F34;78) BT]X^a=TfITP[P]S QPcb\P]A^bbCPh[^a^] CWdabSPhbPXSWXbcTP\fX[[WPeT c^_a^SdRTb^\TcWX]Vb_TRXP[X] cWTCTbcbTaXTbc^QTPc8]SXPX] 8]SXPU^acWTUXabccX\T 0bZTSfWTcWTafX]]X]VcWTbTaXTb WPeTQTR^\Tc^dVWTaU^aeXbXcX]V cTP\bX]aTRT]ccX\TbCPh[^abPXS XcfPbSXUUXRd[cc^_X]_^X]cP aTPb^]U^acWT_aTePX[X]VcaT]S 8S^]cZ]^fXUcWTaTXb^]T _PacXRd[PaaTPb^]8Uh^daTUTaaX]V c^8]SXPcWThPaTYdbcPeTahV^^S cTP\P]SXcXbWPaSc^QTPccWT\ PcW^\T8]cTa\b^U^eTabTPb eXRc^ahU^adbfTWPeT]^cf^]P [^c^UbTaXTbfTWPeTf^]CTbcb ^eTabTPbQdcbTaXTbWPeTQTT] WPaSc^R^\TQh1dccWPcXbcWT RWP[[T]VT^UCTbcRaXRZTc7^_T fT_[PhV^^SRaXRZTcWTaTWT bPXSCWTQXVVTbcRWP[[T]VTU^a CPh[^aP]S^cWTaQPcb\T]fX[[QT c^cPRZ[TcWT`dP[Xch8]SXP] b_X]]Tab0bZTSPQ^dcWXb_[P]b c^cPRZ[TcWTb_X]]TabCPh[^abPXS bcXRZX]Vc^WXbbcaT]VcWbfX[[QT cWTZThP]S^]T^UcWT\XbcWT bfTT_bW^c ?C8 added the batsman, whose only Test century in India came back in 2012. Such has been the focus on spin for New Zealand that their spinners — Ish Sodhi, Mitchell Santner and Mark Craig — had a long session on Thursday while the batsmen created rough spots on practice pitches to get used to the sharp turn. Taylor confirmed that all in the 15-man squad will get time in the middle. For Ranji Trophy champions Mumbai, playing against a Test team will be an ideal start to its domestic campaign with the matches now being played on neutral venues. The absence of Akhil Herwadkar, Shreyas Iyer, Shardul Thakur and Dhawal Kulkarni, who are with the India A team in Australia, gives Mumbai the chance to test their bench strength. Rohit Sharma, who was part of the Duleep Trophy final, will also be playing the match. Captain Aditya Tare said his team will make it tough for New Zealand. "The wicket looks nice. It should be a good game," said Tare. ferent players in a 6-0 rout. Riyad Mahrez scored twice as Leicester opened its maiden Champions League campaign with a comfortable 3-0 victory at Belgian champion Club Brugge. Sixteen years after its last European game, the English Premier League champion was unfazed by the occasion and got off to a strong start, with Marc Albrighton scoring after just five minutes. Mahrez then curled a free kick home and scored his second goal from the penalty spot. The victory gave Leicester the lead in its group after FC Porto and Copenhagen drew 1-1. Lyon top Group H with 3-0 win over Dinamo Zagreb after Juventus was held to a disappointing 0-0 draw by Europa League winner Sevilla. Playing with a depleted side, Lyon relied on its homegrown players and the class of teenager Maxwel Cornet to open its Champions League campaign in style with a 3-0 defeat of Dinamo Zagreb. Lyon quickly opened the scoring courtesy of Corentin Tolisso's goal. Jordan Ferri, who honed his skills at Lyon's renowned academy with Tolisso, made it 2-0 four minutes into the second half from Cornet's assist. The 19-year-old Cornet then scored the third. 1228c^X]eXcTP[[ U^a\TaRP_cPX]bU^a $cWCTbc\PcRW ?C8Q =4F34;78 he BCCI has decided to invite all the former India captains to celebrate the T occasion of country's '500th Test match' that will be played against New Zealand in Kanpur from September 22. A specially minted silver coin with 500th Test embossed on it is being prepared for the toss. Senior BCCI official and UPCA supremo Rajeev Shukla said that a host of events are being organised by the BCCI to make the event memorable. "The BCCI wants to felicitate all the former captains during the Test match. Green Park is one of the first four Test venues in India along with Chepauk, Wankhede and Eden Gardens. It will be a fitting tribute to all those former captains, who could be present on the occasion. The BCCI is making all arrangements," Shukla told PTI. The likes of Nari Contractor, Chandu Borde, Dilip Vengsarkar, Kapil Dev, Ravi Shastri, Sunil Gavaskar, Sourav Ganguly, Sachin Tendulkar, Virender Sehwag, Krishnamachari Srikkanth are expected to grace the occasion. Chief coach Anil Kumble will also be present. Rahul Dravid is also expected to comeback from his India A tour assignment. C`Y^^UbcgY\\TUSYTU9^T>JcUbYUcVQdU*7Q]RXYb ?C8Q =4F34;78 ut-of-favour India opener Gautam Gambhir feels spinO ners will decide the fate of the upcoming three-match Test series between India and New Zealand, starting in Kanpur on September 22. Warning the home team against taking New Zealand lightly, Gambhir said both India and New Zealand have fielded good spinners in their squad and they are expected play key role in the series. "New Zealand has always been a very gritty kind of a side. They have always been underdogs, no one rates them very highly but they have always done well in ever y conditions," Gambhir said. "They have got a good squad. They have got three spinners (in Mitchell Santner, Ish Sodhi and Mark Craig) and spinners of whichever sides bowl well it will eventually decide the series," Gambhir said on the sidelines of the launch of a talent hunt programme, Indian Junior Players League (IJPL), of which he is the brand ambassador. Gambhir scored 320 runs at an average of 80 per innings in the recently-concluded Duleep Trophy to lead India Blue to the title with consummate ease. But despite his exploits with the bat, the selectors once again ignored him when they picked up the 15member squad for the upcoming series against New Zealand. Asked Gambhir about the recent snub, the aggressive lefthanded batsman curtly said: "I don't play for selection honestly. Ultimately my job is to score runs and that is what I focus on. "You should just go out there and look to control things which you can control, rest is selectors job. Whatever the selectors decide it is their opinion. My job is to go out there and help my team in winning." Gambhir reiterated that he is a "traditionalist" and is not in favour of any tinkering with Test cricket. EP[[Thb_^acbRd[cdaT % '(+5$'81_)5,'$< _6(37(0%(5 0]TfU^aTXV]b_^ac?XRZ[TQP[[bTcU^a[Pd]RWX]3TWaPSd] By Anupma Khanna & Nitika Bhardwaj ttarakhand is all set to launch the popular game of Pickleball, with a State Pickleball Association to be formalized soon. A blend of badminton and tennis, Pickleball has a history as interesting as its name. As informed by All India Pickleball Federation (AIPA), "The game got its star t back in 1965, in Bainbridge Island, just a short ferry ride away from Seattle, WA When Congressmen Joel Pritchard, William Bell and Barney McCallum came home from a game of golf one day to find their kids bored and restless, they set out to create a game that would engage them through the lazy days of summer. They wanted to create a game that would be challenging, but still accessible. They handed the kids ping-pong paddles and a wiffle ball, and lowered the net on their badminton court. In the coming days both kids and adults alike fell in love with the game." While some say that the name "Pickleball" was derived from that of the Pritchard's family dog, Pickles, other sources state that the name actually came from the term "pickle boat", referring to the last boat to return with its catch. A memoir by Joan Pritchard, Joel Pritchard's wife recounts that the name came "after I said it reminded me of the Pickle Boat in crew where oarsmen were chosen from the leftovers of U other boats. Somehow the idea the name came from our dog Pickles was attached to the naming of the game, but Pickles wasn't on the scene for two more years. The dog was named for the game." The bir thplace of Pickleball in India is Mumbai. It is pertinent to note that once done, Uttarakhand will By Team valley vivacity ll sports enthusiasts and sports officials from the state have lauded the government's decision to honor Manish Rawat, a small town boy from Chamoli, Uttarakhand. Manish Rawat has secured 13th position in Rio Olympic-2016 in the category of 20 km race walk and thus has been promoted. This decision has given some hopes to players, coaches and state sports associations as the condition of sports in the state is not up to mark. Analysing the situation of sports in Uttarakhand from the perspective of officials we tell you what is wrong exactly and what can be done to improve it.According to Virendra Singh Rawat, founder of Dehradun Football Academy, government does not take interest in this sector. He tells that most of the associations exist only on papers. They have no records, no achievements and still the government is providing them with funds. A become the ninth state in the country to be affiliated with AIPA, the existing eight members being Maharashtra, Rajasthan, Jharkhand,Bihar, Har yana, Pondicherr y, Mumbai and Madhya Pradesh. With a table- tennis like bat, badminton like court and lawn- tennis like playing style, pickle ball is a fun mix of the Invented by U.S Congressman, Joel Pritchard in 1965, Pickleball is a fun and easy racquet sport that combines badminton, tennis and table tennis three traditional racquet ball games. Two, three or four players use solid paddles made of wood or composite materials to hit a perforated polymer ball, similar to a wiffle ball, over a net. While the world practice is to have three categories- sub- junior, junior and Senior, India follows only the latter two, as the game is FWPcPX[bb_^acbSTeT[^_\T]cX]DccPaPZWP]S. reflecting upon the situation he said, "Condition is very poor. No system is being followed. The fake associations are taking money from governments and do not organise any tourney. Players are informed at 11th hour about tourneys and championships which is not acceptable." He further points out that no jobs and fraud sports authorities are hindering its development. Bijendra Rana, Secretary of the Uttarakhand Baseball Association rather sees problem in families and mindsets of people over here. He points out that children these days are burdened with syllabus, studies, entrance exams and getting good scores. If not studies other things such as gadgets and video games involve them which give them no out- put or life skills. The rest of children who want to take up sports do not get support from their families and parents. Girls especially have a tough time fighting and they finally give up against societal norms. He further adds that good facilities, infrastructure and jobs can increase the development rate. Mandeep Grewal, Secretary General of Uttarakhand Basketball Association blames it on the politics going on in this field. He says that a lot of politics is involved in Olympic association medal tally. Further he criticised the government and ministers to form a logical and full proof policy. He while talking to The Pioneer appreciated the honouring of Manish Rawat and expects the same for all the budding and existing players. He hopes no other player goes through the struggle Manish Rawat has gone through to reach here. Grewal too agrees with the opinions of the above two officials and says that no jobs, no proper training and facilities is the root problem. Prem Kumar, Secretary of Paralympics Association of Uttarakhand pointed out to the discrimination that is prevalent from long. He not only talks of Paralympics and other sports but other games in comparison to new and modern games. Like Kabbadi doesn't stand a chance in front of football. "Audiences will anytime prefer to watch a football match over Kabaddi or Kho-Kho etc." Coming to Paralympics and stating the discrimination he mentioned that, Rio Olympics was telecasted by almost all sports channels and people watched it with much interest. But how many people know that Rio Paralympics are on and how many channels are telecasting it or are publishing its news? With a long pause he said, "You see that's the difference I'm talking about." While all the above secretaries from different associations pointed out problems and ridiculed the government of its policies, P.C Verma, Secretary of Cricket Association of Uttarakhand appreciated the development happening. He pointed out to the international level sports infrastructure in the state and said, "I don't find any problem anywhere. We're doing very fine and development of sports is increasing at an excellent speed. We have world class ATeXTfP]SRaTfX]cTaeXTf^U\^eXTB^deT]Xa By Nitika Bhardwaj ouvenir, directed by Vaibhav Bisht is a 40 minutes short horror film with a message. This film is a regional film and was showcased in the recently concluded 2nd Dehradun International Film Festival 2016 and we interacted with its team too. Vaibhav who also plays the character of Armaan in the film has kept the medium of the film in Hindi. Answering as to why he went for Hindi and not Garhwali as language he said, "a movie whether short or long is made for audience. We don't have Garhwali audience in our region unlike that of Bhojpuri, Tamil, Telugu or Bengali. The youth there speak these languages and understand it and follow it. Whereas our people here do not speak Garhwali and neither see Garhwali films. So when the people only don't support any piece of work in their language how and why will people make films in those languages. Until and unless the film appeals the mass it is of no use. Thus I make my films in Hindi only." "The most important aspect of regional films is that they lack mass appeal. It is only made for a specific number of people. These days no new filmmaker would want to limit himself and confine to only regional audience. Rather he will want to increase his or her horizons and be globally known," said Archit Saini, Creative Director of the film. Archit Saini is a choreographer also and has worked in the film industry for a long time. Sharing about his experience of working in regional still to find a place among little children in the country. "The ball has small holes in it and is served with an underhand stroke. It requires average athletes' skill to play the game. Compared to tennis that requires high power and badminton that has indoor requirements, Pickleball is an all season game that can be played both S films he said, "It was difficult. As a creative director I use to get everything I required for setting up things while in Mumbai. But here I had to arrange and wait for things myself. Lack of facilities, resources, things and people posed a problem. But you have to know how to work with even less resources. I have tried my best to make the most of what I had. He further added that it is time now that Uttarakhand should have good acting institutes and theatre schools. "Not only talents here will get a platform but people over here will get exposure and will open to other scopes in the film industry. A film is not a one man show. It isn't easy to make. We require many people to be a part of it. The schools and institutions will not only make actors but technicians, cameraman, light man, directors, choreographers and what not." "The best part of our film is that everything is local. All our cast and crew belong from Dehradun. All the locations are of Dehradun," shared Abhishek Kapoor who plays Vikram in the film. He told that he likes Dehradun a lot and plans to work here only. "Why not work and promote our own industry and why to work anywhere else when you are getting opportunities in your own hometown. I won't go hunting and struggling for work in Mumbai. We have a lot of work here in our region and a lot of things are unexplored here. I love being in Doon and I plan to work here only until and unless something big comes my way." The same team won an award in last year's film festival for their film 'cross' which was based on Chinese infiltration. "People have done revolutionar y changes through movies. Language isn't a barrier according to me if your concept, story, direction and all the other things are solid. The city should have institutes so that a lot more filmmakers and technicians are made which contribute a lot to the regional cinema. Also government intervention is must to make avenues and employment in this sector," he said. Souvenir is the story of a house located in Kasol, Himachal Pradesh. The people living nearby regard it as haunted and captivated by a spirit which kills people. Owner of the house Armaan played by Vaibhav Bisht lives in Delhi and sends his girlfriend Natasha played by Vidushi to live in that haunted house. She too experiences paranormal activities in the house but continues her stay irrespective of it. She calls up Armaan to come to the house ASAP. Before Armaan reaches the house that black form captivates her in the house and tries to kill her. Natasha all restless asks the reason as to why is it following her. To which the form says that he's taking revenge of what she did with Vikram played by Abhishek Kapoor. Going into flashback, we see that Vikram and Natasha were in relationship and Vikram use to love Natasha like psychos. He killed himself. The black form is Armaan. He further tells her that Vikram was his only best friend and she has invited havoc on her by being the reason of Vikram's death. At the end while Armaan seeks Natasha to kill her throughout the house two men enter the house. They are electricians and came to fix the antenna which receives high radiation. One electrician tells the other that due to this high radiation people experience unusual things here. Also the high radiation has made people mentally disturbed and killed some. There is nothing wrong with the house and fixes it. Eerie atmosphere and tuneful music was well crafted but poorly placed. The sequences between Natasha and the spirit succeed in moderately terrifying the viewers. After the first half, the pace slackens in the second half of the film. The flashback, which is supposed to be the soul of a horror, starts off on a very slow note and ends too early. The scenes were too dark to make out what was happening. The climax doesn't measure up to the expectations. The end is uncertain and the viewers had no idea as to on what note did the movie end. The end seems confusing, as after the radiation is corrected, Armaan with a dagger in his hand moves towards Natasha to kill her. This particular aspect seems a bit far stretched. A more appropriate ending sequence should've been thought of. The music and background score was easy on the ears. A song sequence showing Armaan and Natasha's romance was not required though. Dialogues did not go along with the mood of the film and neither did their acting. Another director from Chandigarh, Daman Sidhu whose film Jaavitri was also showcased during the festival, liked the film Souvenir. She praised the efforts put in by the team and expects to see more good films in near future. "Though the execution was not up to mark but the message was really good at the end. They linked all the paranormal activities to science which is very new. We need more fresh minds and ideas like these so that diversity in our industry continues." In an era when women are more attracted and adamant in pursuing acting she took up direction. Being a mother of two she shared her experience of directing the film. "I was flipping into two roles. On the sets I used to have camera on one side and my kid on the other. Yes it is difficult to be a director with a family to look after but even my crew is my family. They have cooperated a lot and that's how this film happened." "Also I believe that direction and acting is all a matter of choice. I always wanted to direct and thus when I thought it is the right time to direct a film I did it," she concluded. <RXFDQQRZZULWHWRXVDWYDOOH\YLYDFLW\#JPDLOFRP outdoor and indoor," informed Amit Kumar, who is likely to the secretary of the State Pickleball Association. On how did this unique game find its way to Uttarakhand, Kumar said, "I am an avid sportsman and I came to know about this game from my acquaintances in the sports field. I found it quite interesting and new and applied for the state association in March this year. Thebody with 9 members will launchthe sport in the State with a training camp for coaches in Dehradun as soon as it gets registered. We are hoping this to happen this September. The vision is to have trained coaches introduce Pickleball in schools and rural areas of Uttarakhand. The AIPA has hosted three national championshipsso far, and the fourth tournament is slated for November this year in Jaipur. The aspiration of Pickleball players of India is to compete at the international level, a feat for which AIPA needs to get Pickleballregistered under the sports ministr y and should be played in a minimum of 10 Indian states. Pioneers of Pickleball in Uttarakhand are eyeing the national championship in the pink city."We shall scout for players in training camps that we hope to be able to organize soon .The game is easy to learn and we shall get technical trainers and coaches from other states to train forthe national championship,"stated Kumar. infrastructure and sports colleges in Dehradun and Haldwani and our players are achieving heights. They are getting good opportunities and with 2018 national games lining up we will give a good message to nation." He mentioned that though the state is new there is still a lot of room for improvement. "It is a gradual process and gradually we are building good players here." "It is time that the government should come into action now and get involved with this. The sports quota which was 4% and was removed should be implied again in all sectors. The players are not getting employment and thus this is one of the biggest reasons why youngsters do not want to take up sports in our state," said V.S. Rawat. Bijendra rana, opined that, "Uttarakhand has no dearth of players but there is a dearth of coaches, faculties and institutions here to properly enrich them and make them world class players." 5 ( & , 3 ( Sweet and Sour Paneer (Cottage Cheese) INGREDIENTS For the sauce: Tomato ketchup Soy sauce Sugar White Vinegar Water OTHER INGREDIENTS Cottage cheese Onion Chopped ginger &garlic Corn flour Hot garlic sauce Salt White pepper Oil - 6 tbsp - 2 tbsp - 2 tsp - 2 tbsp - 1 cup - 300 g, cut in cube - thinly sliced - 1 tbsp - 1.5 tbsp - 1tsp -to taste - 1 pinch - 1 tbsp VEGETABLES Onion cut into cubes Capsicum cut into cubes Tomato cut into cubes Pineapple cut into cubes -1 -1 -1 - 1 tea cup METHOD Marinate cottage cheese with corn flour, salt, white pepper and water. In a pan, deep fry cottage cheese cubes for 3-4 minutes, till they turn light brown. Remove and set aside. Add oil in separate wokthen add chopped ginger and garlic, onion, capsicum, tomato and pineapple and mix well. Sauté on medium heat till the vegetables are light brown. After mixing it well, add a small amount of water and put tomato ketchup,hot garlic sauce,vinegar, white pepper and salt in it. Add the sauce to the pan. Bring to a boil and cook till it thickens slightly. Stir to coat the cottage cheese and capsicum in all the sauce and allow it to simmer gently. Recipe by Yogesh Nawani of First Gear Cafe