Dehradun - The Pioneer

Transcription

Dehradun - The Pioneer
7`]]`hfd`_+
0DXU4QY\i@Y_^UUb
@A:?:@?)
8=3803>4BF4;;C>A08B4
?>:10;>278BC0=0CD=
51,1R5HJQ877(1*5(*'1R8$'2''1
VQSUR__[S_]TQY\i`Y_^UUb
H@C=5"#
78;;0AHCAD<?E8ACD0;;H
C8438==4F?>;;B
4bcPQ[XbWTS '%#
?dQ[XbWTS5a^\
34;78;D2:=>F 17>?0;
17D10=4BF0A A0=278A08?DA
270=3860A7347A03D=
DA@CE"&
BD?4ABC0ABC>
C74A4B2D4
347A03D=5A830HB4?C4<14A
k
%! %*?064B %C!
;PcT2Xch E^[ 8bbdT !$%
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
m
@??:185745µC
>5HDD5<E7E
69<=39
!#F9F139DI
fffSPX[h_X^]TTaR^\
?VhehZdeZ_FA¶d
XR^V`WeYc`_Vd
0ZWX[TbWX]Ud[[
R^\\P]S*d]R[T
BWXe_P[`dXcbPb
<X]XbcTa_^bc
^U_Pach_aTbXST]c
?8>=44A=4FBB4AE824Q
=4F34;78
CF>68A;B60=6A0?43
8=0<0=E870A
!013D2C438=380=B8=
;81H05A443)BDB7<0
08b_aTPSX]VXcbfX]Vbc^
cP_]Tf^__^acd]XcXTb
T
<08=C08=?4024B2
C4;;B:0A=0C0:0C=
=Tf3T[WX) CWTBd_aT\T2^dac
^]CWdabSPhb[P\\TScWTCP\X[
=PSdP]S:Pa]PcPZP
6^eTa]\T]cbU^acWTXaUPX[daTc^
bc^__T^_[TUa^\cPZX]Vc^cWT
PVXcPcX^]PUcTaXcb^aSTa^]cWT
2PdeTahaXeTafPcTabWPaX]VP]S
bPXSXcW^_TSQ^cWBcPcTbfX[[
\PX]cPX]_TPRTP]SaTb_TRcU^a
[Pf01T]RW^U9dbcXRT3X_PZ
<XbaPP]S9dbcXRTDD;P[XcbPXS
bWdcS^f]bP]SPVXcPcX^]bR^d[S
]^cQTP[[^fTS_dabdP]cc^cWT
P_TgR^dac^aSTab
=Tf3T[WX) Cf^VXa[b &P]S '
hTPab^[SfTaTP[[TVTS[h
VP]VaP_TSQhUXeTh^dcWfWX[T
cWThfTaTbXccX]V^]PQT]RWX]P
_PaZfXcWcWTXa\P[TUaXT]SbX]
>dcTa3T[WXb0\P]EXWPaX]cWT
fTTW^dab^UCWdabSPh
=Tf3T[WX) Cf^8]SXP]cTPRWTab
fW^fTaTPQSdRcTSX];XQhP^eTa
PhTPaPV^WPeTQTT]aT[TPbTS
4gcTa]P[0UUPXab<X]XbcTaBdbW\P
BfPaPYbPXS^]CWdabSPh°8P\
WP__hc^X]U^a\cWPcC6^_P[P
ZaXbW]PP]S21P[PaP\:XbWP]
fW^fTaTRP_cXeTX];XQhPbX]RT
9d[h!(! $WPeTQTT]
aTbRdTS±cWT<X]XbcTacfTTcTS
he national Capital on
T
Thursday continued to reel
under vector-borne diseases
outbreak with dengue claiming
nine more lives at All India
Institute of Medical Sciences
(AIIMS) and one succumbing
to complications triggered by
chikungunya at the Sir Ganga
Ram Hospital. With the reports
of more fatalities from vector
borne diseases, death toll from
dengue rose to 18 and number
of patients died of chikunguyna climbed to 12 even as
number of affected people
crossed 2,800.
JD Madan, 75, from South
Delhi died of chikungunya
complications at Sir Ganga
B?[TPSTaBWXe_P[HPSPePaaXeTbPc2W^fSWdah2WPaP]BX]VW0Xa_^acX];dRZ]^f^]CWdabSPh
?C8 Ram Hospital on Thursday
morning. He was the fifth
Mulayam Singh Yadav at his res- Delhi, but Akhilesh chose to
In another development, chikungunya patient to have
idence — 5 Vikramaditya Marg remain in Lucknow.
two senior Ministers in the lost life at the hospital in the last
— and from there he drove to
It is expected that Akhilesh Akhilesh Government, Balram four days.
5 Kalidas Marg — the official and Mulayam might have dis- Yadav and Awdhesh Prasad,
“JD Madan, a resident of
residence of the Chief Minister. cussed the ‘family feud’ over have refused to take charge of Kalkaji, was admitted on
Mulayam, who is caught ‘family dinner’ on Thursday new portfolios. They were August 12 night with combetween his son and brother, night. The two share the same given departments which were plaints of fever and chills along
stepped in to defuse the crisis residence in Lucknow.
previously headed by Shivpal. with swelling and rashes on
and reached Lucknow a day
Sources said it was
The crisis was precipitated body. He was also a patient of
earlier than his scheduled Mulayam who persuaded after Akhilesh sacked Ministers chronic myeloid monocytic
arrival on Friday. Sources in the Shivpal to meet Akhilesh Yadav Gayatri Prasad Prajapati and leukemia. He had acute febrile
party say that Mulayam had to break the ice between chacha Raj Kishore Singh on Monday illness and was tested positive
summoned both Shivpal Singh and bhatija. “The meeting and then removed Chief for chikungunya by rapid PCR
Yadav and Akhilesh to New between them was short — just Secretary Deepak Singhal the test, and died at 6.45 am of
Delhi on Wednesday. Shivpal, for 13 minutes to be precise,” a following day.
chikungunya sepsis with septic
who was in Etawah did reach source said.
shock and cardio-pulmonary
=PcX^]P[RPaaXTac^PSS$PXaRaPUcc^Xcb
U[TTcV^X]U^a²cTaaXc^aXP[Tg_P]bX^]
0;;>=1>0A30="!
³?A4BD<433403)805
=Tf3T[WX) CWT!(_T^_[T^]
Q^PaScWT0="!_[P]TcWPcfT]c
\XbbX]V^eTacWT1Ph^U1T]VP[
^]9d[h!!WPeTQTT]°_aTbd\TS
STPS±P]ScWTXaUP\X[XTb
X]U^a\TS8]SPX]0Xa5^aRT
^UUXRXP[bbPXS^]CWdabSPh
4<1A04A340;) 218
4G0<8=8=6<8=A4@D4BC
=Tf3T[WX) CWT218^]CWdabSPh
bPXSXcfPbTgP\X]X]VcWT
3TUT]RT<X]XbcahaT`dTbcc^
_a^QTP[[TVPcX^]b^UZXRZQPRZbX]
cWT_daRWPbT^UcWaTT4\QaPTa
PXaRaPUcX]P!'\X[[X^]STP[
SdaX]VD?0ad[TX]!'
A5AdXZR_e
\Z]]Vc<RccR
bfZedaRcej=D
<>78C:0=370A8Q 90<<D
ne of the founding members of Peoples Democratic
Party (PDP) and sitting
Member of Parliament from
Srinagar Parliamentary constituency, Tariq
Hameed Karra,
often labelled as
‘giant killer’ ever
since he defeated National
Conference
patriarch Dr
Farooq Abdullah in 2014 Lok
Sabha polls, Thursday dealt a
body blow to the Mehbooba
Mufti-led alliance Government
in the State by announcing his
resignation from the primary
membership of the party and
the Parliament.
“I am resigning from the
membership of Parliament and
the primary membership of the
PDP against the brutal policies
of the BJP at the Centre and
State Governments complete
sell-out and surrender before
them,” he told reporters here.
Detailed report on P6
O
344?0::D<0A970Q
=4F34;78
yeing the higher class rail
E
passengers, national carrier Air India (AI) has decided
to add over 50 aircraft to its
fleet during the next year. The
AI plans to start leasing aircraft
every month from next year
January onward.
Chairman-cum-Managing
5VReYe`]]Wc`^
UV_XfVcZdVde`")
TYZ\f_Xf_jRe`"#
BC055A4?>AC4AQ =4F34;78
he crisis in the Samajwadi
Party chief Mulayam Singh
Yadav’s political pariwar took
an interesting turn on
Thursday night when his
brother Shivpal Singh Yadav
resigned both from the Cabinet
Minister and State party president posts.
Shivpal submitted his resignation from both the posts
after a brief meeting with Chief
Minister Akhilesh Yadav.
The development shows that
Akhilesh has taken full command of the Government and is
not ready to be seen as being
around by his chachas anymore.
Shivpal resigned reportedly after Akhilesh refused to
return his plum portfolios
despite Mulayam’s advice.
Earlier, Akhilesh Yadav
and Shivpal held a one-on-one
meeting here on Thursday
evening.
The meeting lasted for just
15 minutes after which Shivpal
drove to his residence, a senior
leader told The Pioneer.
Both Akhilesh and Shivpal
are in the centre of the raging
feud. Their meeting is expected to achieve the breakthrough
that could be formalised by
Mulayam during the next couple of days.
Earlier, Shivpal held an
hour-long meeting with
20?BD;4
'HQJXHUDFHVDJDLQVW
FKLNXQJXQ\DFODLPV
Director (CMD) Ashwani
Lohani, who completed one
year at the helm recently, said
on Thursday that after registering operational profit zone
for the first time in two
decades, the Air India will go
in for 'territorial expansion'.
Lohani told The Pioneer
that new aircraft like A320,
Dreamliners, and ATRs will be
added on lease almost every
month beginning January 2017.
The national carrier has decided to go for leasing of the aircraft for financial viability.
For the domestic market,
the airline will also get 10
more ATR-72 by the end of
March 2017. By mid-2018, the
total numbers of ATRs will be
43. AI Express, which
currently has 17 Boeing 737s,
will get 18 more similar
Boeings.
Lohani said that in its 'territorial expansion' mode, the AI
will focus on Tier-II and Tier
III cities with an innovative network titled "Garland Route"
where even private carrier are
not present.
Garland Route for instance
will connect Guwahati to Delhi
via Kolkatta, Raipur, Bhopal,
Indore, Jaipur and vice versa, he
said, adding the AI believes that
smaller but significant cities
like Surat, Chandigarh, Indore,
Nashik, Jaipur, Bhopal,
Jabalpur, Nagpur, Vijyawada
and others will become businesses hubs.
crucial for their hunting, resting as well
as for breeding in the Arctic region, a
study has found.
According to scientists, the Arctic
is warming at nearly double the global
rate as a result of climate change fuelled
by mankind's burning of fossil fuels, a
process that emits heat-trapping greenhouse gases.
The rising temperatures have resulted in ice melting earlier in spring and
re-freezing later in the autumn.
Satellite data revealed that the total
number of ice-covered days across the
19 regions declined at a rate of seven to
19-days per decade from 1979 to 2014,
the researchers said.
"Polar bears' dependence on sea ice
means that climate warming poses the
single-most important threat to their
persistence," said Harry Stern from the
Polar Science Centre at University of
Washington.
The bears, which have become
emblematic of the ravages of global
warming, spend most of their time on
sheets of frozen ocean water, which melt
and recede in warmer months, and then
re-form in the winter.
When the ice melts, the animals
come ashore and survive on stored fat
Till Tuesday, at least nine
deaths due to dengue were
reported this year in the national Capital, though the South
Delhi Municipal Corporation
(SDMC) which compiles the
report on vector-borne diseases has maintained the death
toll at four.
AIIMS is getting several
suspected dengue patients
everyday in its fever clinics,
though less number are showing confirmed cases compared
to chikungunya for which 1,440
blood samples have tested positive till September 13.
At least 1,158 cases of
dengue have been reported in
the national Capital with nearly 390 of them being recorded
in the first 10 days of
September, the month in which
the vector-borne disease begins
to peak.
?C8Q =4F34;78
he proposal for the Union
T
Budget’s overhaul, including merging the Railway
4gcTa]P[0UUPXab<X]XbcTaBdbW\PBfPaPYaTRTXeTb?aX\T<X]XbcTa^U=T_P[?dbW_P:P\P[3PWP[?aPRWP]SP^]WXbPaaXeP[Pc868
0Xa_^acC"X]=Tf3T[WX^]CWdabSPh
?C8
:LWKWKH$UFWLFZDUPLQJ
DWQHDUO\GRXEOHWKH
JOREDOUDWHDVDUHVXOWRI
FOLPDWHFKDQJH3RODU
%HDUVDUHLQFUHDVLQJO\
ORVLQJOLIHVXVWDLQLQJVHD
LFHFUXFLDOIRUWKHLU
KXQWLQJUHVWLQJDVZHOO
DVIRUEUHHGLQJD
VWXG\KDVIRXQG
olar bears, whose global population
P
is estimated at nearly 25,000, are
increasingly losing life-sustaining sea ice
arrest,” said a statement issued
by Ganga Ram Hospital.
AIIMS had confirmed one
suspected case on Wednesday.
The victim, an old man from
Muzaffarnagar, had died earlier
this month of multi-organ failure triggered by chikungunya.
In a report released on
Thursday on vector-borne disease cases at AIIMS, the doctors said, “Nine dengue patients
have died from September 1 till
date.” A top AIIMS official
had on Wednesday confirmed
five deaths, which were earlier
suspected to have taken place
due to dengue.
“A total of 96 patients were
admitted to AIIMS, out of
which 56 have been discharged.
Among the patients, 70 per
cent belonged to Uttar Pradesh,
10 per cent to Bihar and rest to
Delhi,” the report said.
2PQX]Tcc^cPZTd_
1dSVTcaTeP\_*
PSeP]RTFX]cTa
BTbbX^]c^PXS
6BCa^[[^dc
5HGXFLQJVHDLFHOHDYHV
3RODU%HDUVRXWLQFROG
80=B Q =4FH>A:
0\P]RPaaXTbPQ^hc^PR[X]XRTb_TRXP[[hbTcd_c^RPcTac^cW^bTbdUUTaX]VUa^\
UTeTa^]T^UcWT\PX]bh\_c^\b^UbTeTaP[\^b`dXc^Q^a]TSXbTPbTbPcAP\
<P]^WPa;^WXP7^b_XcP[X]=Tf3T[WX^]CWdabSPh
0?
until it re-freezes, a period that for some
has become longer and longer.
With longer iceless periods, polar
bears have to swim further and further
to find solid ground, the study noted.
The bears need sea ice for hunting as they cannot outswim seals, their
preferred prey. They get around these
by waiting near holes in the ice and
ambushing the seals as they come up
for air.
Budget with it and pre-poning
the date of its presentation to
January-end, will be taken up
by the Cabinet next week,
while the Budget Session may
be advanced by a month to
January 24 to get the supporting legislations for the GST rollout approved early.
Early presentation of the
Budget will ensure that all legislative work is completed before
the beginning of the new fiscal,
from April, and funds allocated
to various Ministries start flowing in from the first quarter.
While early convening of
the Budget Session may become
a norm in the years to come, the
Winter Session of Parliament is
likely to be convened on
November 11 this year.
:EcRZUdageVUfTReZ`_R]
Z_deZefeVZ_5VYcRUf_
?=BQ 347A03D=
cting on a tip-off on tax evasion, teams of Income Tax
Department conducted raids on
Thursday on a private educational institute — Baluni Classes, a
premier institute in Dehradun
that is engaged in teaching engineering and medical aspirants. IT
officials also raided the premises
of the same institute at Roorkee.
The information of the IT officials conducting raids on one
private educational institute of the
city left the owners of other such
Dehradun-based educational
institutes panicky.
It is learnt that the administration deployed policemen after
the I-T officials sought them for
security. They sealed the institute,
allowing no one to get in as long
as the raids were on. However,
they remained tight-lipped regarding the details of the raids.
The teams questioned the
institute’s officials, it is learnt. It is
also learnt that the raids were part
of the initiatives taken by the IT
department on the basis of the
A
8C^UUXRXP[bP[b^aPXSTScWT
_aT\XbTb^UcWTbP\T
X]bcXcdcTPcA^^aZTT
complainants received to stop
Income Tax evasion by the private
institutes.
The IT officials reached the
Nehru Colony –based institute at
8.30 am on Thursday. Students
were in the classes when IT officials arrived. They sealed the
office and sought account-related
documents from the officials concerned. Officials reviewed the
documents for many hours
while sitting in the institute. It is
learnt that IT officials seized
finance-related documents from
the institute.
The Finance Ministry is
overhauling the Budget-making exercise which may see
scrapping of the current practice of presenting a separate
budget for the Railways as well
as shifting to multi-year outcome-based budgeting,
sources said.
Till now the Budget
Session was convened in the
third or fourth week of
February, and the Union
Budget presented on last day of
the month. This led to the legislative approvals taking place
in two phases spread between
February and May.
dccPaPZWP]S!
347A03D=k5A830H kB4?C4<14A %! %
8`geeVRTYVcddecZ\VT`_eZ_fVd
?=BQ 347A03D=
ith talks failing to make
any headway, the strike of
W
the lecturer and lecturer Teachers
(LTs) of Government schools of
State continued on Thursday.
However it is learnt that the
teachers could take an important
decision on their strike after
meeting Chief Minister Harish
Rawat on Friday.
The Lecturer and LTs of the
Government schools of State
Government under the banner
of their organisation, Rajkeeya
Shikshak Sangh (RSS) are on
strike from Monday. The
efforts of the state government
to break the strike have failed
to yield any result. A delegation
of teachers was again invited for
talks by the government on
Thursday night. This meeting
too proved a failure. The general secretary of the organization Sohan Singh Majila said
that strike of the teachers would
continue.
Meanwhile the President of
the organisation Ram Singh
Chauhan and Divisional secretary of Garhwal Shiv Singh Negi
who were sitting on an indefinite hunger strike, were lifted by
the police on late Wednesday
night when their condition
deteriorated. In their place
Sunder Kunwar and Dr Kannu
Joshi sat on the hunger strike.
The teachers continued
their protests at the offices of
Block and District Education
Officers in different parts of the
CWTcTPRWTabR^]cX]dTScWTXa_a^cTbcbPccWT
^UUXRTb^U1[^RZP]S3XbcaXRc4SdRPcX^]>UUXRTabX]
SXUUTaT]c_Pacb^UcWTBcPcTCWTbcaXZT^UPQ^dc
!$cTPRWTabWPbPSeTabT[hPUUTRcTSbcdSXTbX]
!"6^eTa]\T]cWXVWbRW^^[b
P]SX]cTabR^[[TVTb^UBcPcT
State. The strike of about
25,000 teachers has adversely
affected studies in 2,300
Government high schools and
inters colleges of State.
On
Thursday,
the
Government accepted one of
the demands of striking teachers when it ordered appointment of selected candidates of
BRP and CRP examination in
the vacant posts. One of leaders of RSS, K K Dimri however said that only partial demand
of the organization is accepted
by the government. He said
that the teachers are now determined to continue their agitation till the GO for all their
demands is released.
The striking teachers are
demanding three days earned
leave, increase in grade pays,
assured career progression,
regular annual transfers, a
transparent transfer act, payment of better travel allowance
and immediate appointment of
selected candidates of BRP and
CRP examinations.
The President of newly
constituted Uttarakhand
Raksha Morcha, V K Bahuguna
has appealed the teachers to
take back their strike in the
interests of students. In a statement he said that the morcha
fully supports all the legitimate
and genuine demands of teachers. Bahuguna called upon the
state chief minister to immediately intervene in this matter.
2<X]PdVdaPcTbFXUXbTaeXRTbU^a=PX]XcP[ 7`c^Vc22A
T`_gV_Vc
?=BQ 347A03D=
Chief
Minister Harish Rawat
Uttarakhand
formally inaugurated Wifi
services for Nainital through
video conferencing held at
Bijapur Guest House on
Thursday. He fur ther
announced that such facility
would be commissioned in
Mussoorie to be followed by
R ajbhawan and Chief
Minister’s residence. As per
the scheme, the users will be
given first 20 minutes free and
thereafter, they will pay as per
the rate.
Congratulating the people of Nainital and those visiting the lake city as tourists,
CM stated that Wifi is a need
of the present time. State
Government is constantly
making efforts to extend the
services to as many areas as
possible, he said.
State government has set
target to provide Wifi services
in all the 13 district headquarters, major shrines and
tourist spots, CM said,
adding that the budget
would be provided for the
purpose.
Talking to The Pioneer,
secretary Deepak Gairola said
they had identified 84 points
across all the 13 districts of
the state where such service
would be installed.
?RfeZjR]W`c^d
_VhaRcej
?=BQ 347A03D=
ormer State convener of Aam
F
Adami Party (AAP) Anoop
Nautiyal, who resigned from
the party along with large number of his supporters, has
announced formation of a new
political forum, Hamara
Uttarakhand jan Manch (HUM)
on Thursday.
Addressing newsmen,
Nautiyal said that central leadership of AAP disappointed the
people of the State as it failed to
react on any issue raised by the
State’s workers. He said that the
decision of the AAP not to contest assembly elections shocked
the party workers who were
enthused by the success of
‘Uttarakhand Bachao Yatra’.
Nautiyal further said that the
party in the state was ruined by
15 member Prabhari Mandal of
AAP in which the leaders of
Delhi held sway. He said that it
appears that AAP is not interested to confront Congress party
for now so it overlooked the misdeeds and corruption of ruling
congress in Uttarakhand. The
former state convener of AAP
said that new forum ‘ HUM’ is
launched to fight corruption in
Uttarakhand. He said that there
is no immediate plan to launch
a political party but added that
the forum could support some
candidates in the ensuing assembly elections. Former State treasurer of AAP Ranvir Chaudhary
said that the large number of
AAP workers in different parts
of state would join HUM in
coming days. He claimed that a
group of selfish leaders is calling
shots in AAP and these leaders
would eventually throw Arvind
Kejriwal out of the party.
Nautiyal has been appointed as patron of HUM while
Ranvir Choudhary would be its
state convener. AAP leaders Kamal Devradi, Onkar Bhatia,
Sameer Mundepi, Abdul Rehman, Bhaskar Chug, Ganesh
Kala, Manoj Choudhary and
large number of party workers
also resigned from the party and
joined the new forum.
BcPcTa^PSfPhbPS\X]
fPa]bPRcX^]PVPX]bc
P]hbcaXZTf^aZQ^hR^cc
?=BQ 347A03D=
he administration of
Uttarakhand roadways has
T
warned that strict disciplinary
action would be initiated
against any strike and work
boycott. The Uttaranchal
Roadways Karamchari Union
(URKU) has given a work boycott call for three days commencing from Friday.
The URKU has a major
presence among the drivers
and conductors of roadways and
the three day strike call is sure
to affect the operation of buses
of state transport career. The
MD of Uttarakhand Transport
Corporation, Brijesh Kumar
Sant told The Pioneer that a
notice is issued to the association for taking back its work
boycott call. He said that appropriate and harsh action would
be taken against those participating in the work boycott call.
The divisional Secretary
of the URKU, K P Singh said
that talks with the authorities
proved inconclusive and members of the association are
determined about the work
boycott. “We have informed the
management about our plans
of work boycott from
September 16 to 19. Our organisation has more than 3500
members and most of them are
drivers and conductors and all
of them would not work on
these three days,’’ he said.
The URKU is agitated over
the fact that the MD of roadways
has categorized the contractual
workers of the roadways as
workers of the outsource agency.
It is significant as the cabinet sub
committee had recently recommended that all contractual
workers working for more than
five years would be regularized.
There are more than 2000 contractual/ outsource workers in
the roadways most of which are
drivers and conductors.
The state roadways have a
fleet of about 1250 buses and
more than 1.40 passengers use
these buses daily.
3Ydi@Qdb_\E^Ydd_
RUUhdU^TUTd_
dXbUU]_bUSYdYUc
?=BQ 347A03D=
ity Patrol Unit (CPU)
would be extended to three
C
more cities — Kashipur,
Rudrapur and Roorkee — in
the State to control traffic. The
unit is presently working in
three cities — Dehradun,
Haridwar and Haldwani.
Speaking of the extension
of the unit to new cities across
the State, DGP MA Ganapathy
said on Thursday that it would
go a long way in easing traffic
congestion. Besides, he said
that the police officers should
enhance their skills to cope
with the changing pattern of
crimes with the criminals
becoming tech-savvy. He further said that a training institute for police officers will
come up in Dehradun soon to
enhance their skills to deal with
cyber- related cases.
While addressing a police
seminar in Haldwani,
Ganapathy stressed on qualitative improvement of the
investigations.
Kumaon DIG Ajay Ratula
and Nainital SSP Sweety
Aggarwal were also present.
DGP said that those to be
deployed in Kashipur,
Rudrapur and Roorkee are
being trained in Dehradun.
“They would be sent soon as
the training is nearing completion,” he said, adding that
the funds recently released by
the state government for the
police department would help
them go for some infrastructural overhaul.
He further said that in
view of upcoming Assembly
election, list of the police officers who have been working at
a place for three years, is being
prepared. “They would be
transferred once list is prepared,” the state’s top cop said.
The senior cop while
addressing the seminar
expressed concern over illegal
mining going on unabated in
some parts of the state. They
said they must be more alert to
stamp out the menace. What is
more, vigilance department
officers would soon submit a
report on the policemen facilitating illegal mining activities.
Based on the report, action
would be taken against the
errant cops.
<RdYZafccVgV_fV
`WWZTVcYV]UW`c
RTTVaeZ_XScZSV
?=BQ 347A03D=
vigilance team has arrested Kashipur assistant
A
land consolidation officer
Jaiveer Singh Chauhan on
Thursday on the charge of
accepting a bribe of C15,000
from a complainant. The
accused had allegedly sought
the bribe from the complainant against mutation
regarding a land.
Earlier, the complainant
registered a complaint in
Vigilance Haldwani sector.
He stated in his written complaint that the matter related
to a plot of land (3.471
hectares) remaining in his
grandmother’s name at Takiya
in Kashipur.
As per the complaint, her
grandmother had made a will,
giving the land to her four
grandsons in 2001. Registry of
the land executed in 2001, his
grandmother died in June
2016. The complainant said
he had approached the assistant land consolidation officer Chauhan to have mutation
of the land done with all necessary documents in July this
year.
However,
Chauhan
allegedly demanded Rs 15,
000 to have the mutation
done. The complainant said
he had received the same
treatment whenever he
approached the officer. With
things remaining the same,
the complainant decided to
throw the bait of bribe to have
him exposed.
Accordingly, he agreed to
pay the bribe. The date and
place were fixed. Meanwhile,
he approached Haldwani sector vigilance and registered a
compliant over the same.
Subsequently, Chauhan was
caught red-handed while taking the bribe at his office in
Kashipur by the vigilance
team on Thursday.
A case under appropriate
sections of Prevention of
Corruption Act, 1988 was
registered against the accused
in Dehradun sector vigilance.
Ashok Kumar, director (vigilance), announced reward
for the team members led by
vigilance Haldwani sector for
cracking the case.
ADGP Kumar said that in
order to check corruption in
the state, a toll free number –
1800-180-6666 has been set
up and it is available for the
people. People can also register complaint on What’s App
number- 9456592300 if any
government officials demand
bribe against the works to be
done, he added.
CaPX]TT^UUXRTabP[[_aPXbTU^a
_^[XRT\P]^UcWT\^]cWPfPaS
?=BQ 347A03D=
he trainee police officers
from Assam, Manipur,
T
Meghalaya and Arunachal
Pradesh who are now in
Uttarakhand under Bharat
Darshan Programme are all
praise for the award ‘policeman
of the month’ being given to the
police personnel in Garhwal
Range in recognition of their
works, taking the daunting challenges head-on. A trainee
Hemanta Saikia said that such
awards motivate the police personnel to give their best. The
trainees also appreciated CCTV
cameras being installed in many
places across Dehradun, helping
police to crack the crimes.
Saikia further said that the
concept of community policing
had caught his imagination. “I
feel that community policing can
make policing more effective.
Uttarakhand is a peaceful state
unlike Assam. But I think that
CaPX]TT_^[XRT^UUXRTabUa^\ePaX^db8]SXP]BcPcTbPccWT?7@X]3TWaPSd]
introduction of community
policing in Assam would help the
northeastern state combat the
crimes better,” he said. He said
that they had an interactive session with DGP MA Ganapathy
on Wednesday at Police
Headquarters during which various issues of making police
more effective cropped up.
Runa Neog, a lady trainee,
also praised the policeman of the
month award, saying that it
boosted the morale of the policeman, inspiring them to do more
for the people. .
IG (training) PVK Prasad
who interacted with the trainees
said that twenty eight police officers, including seven women
police officers, of the rank of
deputy superintendent of police
?X^]TTa_W^c^
from Assam, Manipur,
Meghalaya and Arunachal
Pradesh, are now touring the
state under Bharat Darshan
Programme. Out of 28, six
trainees are having engineering
back ground, two are from medical background and 20 are post
graduates, he said.
Trainees visited IMA campus on Thursday morning. They
would visit intelligence headquarters and police control
rooms in Dehradun, Mussoorie,
Rishikesh and Haridwar.
Pavan Kumar Sharma,
deputy assistant director (police
science), who has been accompanying the trainees, said that
they are receiving warm welcome from police headquarters
they are visiting.
$OWKRXJKHYHU\SRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHO\IRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULW\RIRUELQGLQJLQDQ\ZD\RQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQ\UHVSRQVLELOLW\IRUDQ\
GDPDJHRUORVVWRDQ\SHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQ\DFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO\5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULI\DQGVHHNDSSURSULDWHDGYLFHWRVDWLVI\WKHPVHOYHVDERXWWKHYHUDFLW\RIDQ\NLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQ\FRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQ\HPSOR\HHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQ\NLQGRIFODLPPDGHE\WKHDGYHUWLVHUVRIWKHSURGXFWVVHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQ\NLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
3ULQWHGDQGSXEOLVKHGE\$MLW6LQKDIRUDQGRQEHKDOIRI&0<.3ULQWHFK/WG))5DMSXU5RDG'HKUDGXQ0RE7HOHID[DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG6KHG1R&3DWHO1DJDU&R2SHUDWLYH,QGXVWULDO$UHD'HKUDGXQ8WWDUDNKDQG(GLWRU&KDQGDQ0LWUD$,5685&+$5*(RI
5H(DVW&DOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL$KPHGDEDG6RXWK%DQJDORUH&KHQQDL&HQWUDO.KDMXUDKR'HOKL 7HOHSKRQHV)D[/XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJ&HQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
dccPaPZWP]S"
347A03D=k5A830H kB4?C4<14A %! %
5V_XfVTRdVdTc`dd)!!^Rc\Z_5``_
']TfRPbTb
aT_^acTS^]
CWdabSPhP[^]T
?=B Q 347A03D=
he number of dengue
affected people in the
T
State Capital jumped over
800 with the district health
department reporting 18
more cases on Thursday. The
number of dengue cases in
Dehradun district jumped to
809 on the day.
The Assistant director
Communicable diseases, Dr
Pankaj Kumar Singh said that
the 911 people in the State have
been found positive for the disease so far. He informed that 59
and 30 cases of the disease have
been reported so far from
Haridwar and Nainital districts.
A health department report
informs that 25 dengue patients
are admitted in the isolation
ward of dengue in the associated hospital of Government
Doon Medical College
(GDMC). In the Government
hospital Roorkee in Haridwar
district, 10 dengue patients are
undergoing treatment.
With the patient of
Dengue continue to swell the
private hospitals and labs are
reaping a windfall. These labs
are charging an amount of
C1,800-2,000 for one rapid test
5^daadaP[WPPcbc^
R^\Td_X]BcPcT
?=B Q 347A03D=
hief Minister Harish
Rawat’s media in-charge
C
Surendra Kumar said on
Thursday that four rural haats
— one each in Pithoragarh,
Derhadun, Bhimtaal and
Kashipur — will come up in
the State. These haats will be
developed by SIIDCUL, he
further revealed.
Reacting sharply to the
State BJP demanding a white
paper on the disaster 2013,
Kumar said that the scamtainted saffron leaders raising
hue and cry over the disaster
made no sense.
“They are themselves
involved in disaster scams.
The same band of leaders are
now crying wolf. Instead of
demanding white paper, the
party should introspect. They
have now taken the scamtainted leaders in their warm
embrace. They seem to have
forgotten that they served
memorandum
to
the
President, demanding actions
against them. They named
them kings of scams,” Kumar
said, pointing fingers at the
former Congress leaders who
switched to BJP without naming them.
He further said that the
state government feels no
need to issue a white paper on
the disaster 2013. “The
important fact is that around
12 lakh pilgrims have so far
visited the char dhams. These
figures are enough to make
clear the pains the state government has taken to revamp
the disaster-ravaged places.
The huge footfalls are possible because we have made
roads better and are able to
provide the required facilities
to the pilgrims,” the close
aide to the CM claimed.
Speaking volume of the
works the Chief Minister
Harish Rawat has done for
the state, he said that sure of
defeat at the next hustings, the
BJP leaders are concocting
cock and bull stories.
Relying to the allegation
made by the BJP national
spokesperson saying that one
lakh fake voters have sneaked
their way into the electoral
list, Kumar said it is sans any
foundation.
“The election commission organises campaign to
add new voters and delete
fake voters online. Instead of
going for such baseless
allegation to the media, the
BJP leaders should approach
the election commission
and lodge complaint,” Kumar
said.
( _T^_[TX]cWTBcPcT
WPeTQTT]U^d]S_^bXcXeT
U^acWTSXbTPbTb^UPa
0Q^dc$(P]S"
RPbTb^UcWTSXbTPbT
WPeTQTT]aT_^acTS
b^UPaUa^\7PaXSfPaP]S
=PX]XcP[SXbcaXRcb
of dengue. The dengue scare
among people has given these
doctors and labs a chance to
make a hole in the pockets of
6>EC20?B34=6D4C4BC?A824B
Taking cognisance of the open loot of the private labs in name
of dengue test, the Government fixed the rates of rapid and ELIZA
tests on Thursday. The Municipal Commissioner, of Dehradun
Municipal Corporation (DMC) Nitin Bhadoria said that a meeting of representatives of Indian Medical Association (IMA), Chief
Medical Superintendents (CMS) and Chief Medical Officer (CMO)
was convened in DMC on Thursday in which it was decided that
the labs should not charge more than C1,000 for rapid test and
C800 for ELISA test. He said that the district administration of
Dehradun has constituted two flying squads headed by officers
of SDM rank officer to keep an eye on private labs.
the common people.
The
Medical
Superintendent (MS) of the
associated hospital of GDMC,
Dr KK Tamta informed that one
kit of rapid test comes with a
price tag of C1,900 and ten tests
can be done with this kit. “The
private labs are charging ten
times of the cost from the
patients which is most unfortunate,’’ he said. On Thursday
the Mayor of Dehradun Vinod
Chamoli convened a meeting of
the owners of private labs and
district health department.
A`]]aR_V]e`Y`]UDeReVV]VTe`cR]^RY`edRgZ_@Te
?=B Q 347A03D=
o enthuse the voters, particT
ularly the young ones, into
exercising their franchise for
the upcoming Assembly election,
the Election Commission would
go for State electoral mahotsav2016 in October, said Chief
Electoral Officer Radha Raturi.
She convened a meeting with the
officials in the secretariat on
Thursday to review the preparation being made for the election.
She said that the youngsters who have completed 18
years will be included into
electoral list with this special
campaign. The three-daylong State electoral mahotsav
will be organised in
CWTR^\\XbbX^]f^d[SP[b^^aVP]XbT
T[TRcX^]bcP[[bP[^]VfXcWU^^SR^dacbP]S
WP]S[^^\TgWXQXcX^]bc^bT]bXcXbT_T^_[T
Dehradun and each district
would participate.
To gather people in large
number, EC will organise
painting and debate competitions in the schools and the
colleges across the State. The
winners will be felicitated during the mahotsav.
As per the awareness programme schedule, the commission would appoint ambassadors in colleges and univer-
sities so as to encourage them
into gathering their friends in
the awareness campaign.
Besides, to sensitise the
media, the commission would
organise workshops and
debates for the journalists.
Moreover, the commission
would organise election stalls
along with food courts and
handloom exhibitions. The
commission would make use of
social media and community
5>T`_gV_Vd^VVeRYVRU`WAcVkgZdZe
?=B Q 347A03D=
n view of President Pranab
Mukherjee’s scheduled
IUttarakhand
visit from
September 27 to September 30,
Dehradun DM Ravinath Raman
chaired a meeting with the district officers on Thursday during
which he instructed the officials
to complete arrangements related to the same. President
Mukherjee is proposed visit
Kedarnath, Rajbhawan and Harki-Pauri, Haridwar during the
time he would be in the state.
All the department officers
were directed to complete their
assigned works by September
20. No agencies or departments will be allowed to dig
roads in Dehradun city,
Rishikesh and Haridwar
between September 25 and
September 30. Action will be
taken against the errant officers,
state government officials said.
National Highway, Public
Works Department, MDDA,
Municipal Corporation officers
were directed to submit reports
regarding the visit to DM office
and protocol department.
Dehradun DM stressed on
works like repair of roads,
installing speed breakers and
sign boards being completed in
time. Protocol officer was directed to write to BSNL officials with
the direction to make arrangements of computer, fax, hotline
and others at Jolly Grant Airport,
GTC, Helipad, Raj Bhawan and
Aashiyana.
The power officers were
directed to repair all electricity poles from Jolly Grant to
Ashiyana, Dehradun. No wires
should be found hanging from
the electricity poles at the
above places. Damaged electricity pole should be replaced
with new one within stipulated time frame.
radio for the purpose.
E arlier, the Election
Commission had organised
such mahotsavs at the central
level. This is the first time
such gatherings are being
organised at State level. The
initiative was taken by CEO
Raturi, commission sources
said.
The meeting was attended
by additional secretary higher
education Ranjit Sinha, addition chief electoral officer SA
Murugeshan, additional secretary Ranjana Kumari, additional secretar y Manoj
Chandran, joint director industry Kaushalya Bandhu and special executive officer Mastu
Das among others.
34>17>><8380AH
BD=8;:D<0A
(QLJPDWLF¶*XUX·
person who has earned the sobriquet 'Guru', boasts that
the most powerful man of the State acts at his bidding and
A
once he turns his face away from him the boss would lose power.
Given his uncanny power over the man who runs the show,
the Guru managed to be appointed as vice-president of a board
with no norm being followed. When the department officials
dare ask him about his field of expertise he snubs them, saying that he is no less than the king maker. When asked where
he stays, he brags that he is staying in Bijapur guest house.
Unhappy with being provided with 160 liters of fuel per month,
the Guru asked the district administration to have the departmental vehicle he has been availing surrendered and to provide him with C40,000 per month as per the Government norms.
Now, he is out to have an IAS close to him appointed as a secretary in the department he is literally running courtesy his
being the king maker. The corridors of the Babudom are now
abuzz with stories of the enigmatic figure who is casting his
charm everywhere.
,PSRUWDQFHRIORRNLQJ\RXQJ
wake of the BJP top brass deciding to impose bar on
Iinnthethetheleaders
crossing 75 years from holding important posts
party as well as the Governments it leads, a State party
leader has recently gone abroad to have hair transplantation
to cover his bald head. The objective is clear. He is keen on looking energetic to fox the leadership in not axing his name from
the nomination list for the upcoming Assembly election. To
impress the leadership that he is still looking youthful, he has
circulated his photos after his bald head was duly covered with
transplanted hair. However, a question crops up. Would the saffron brass choose to implement its newly introduced age- norm
for the crucial Assembly election barely a few months away? In
case it is serious on the matter the state party's campaign is
likely to lose steam. For, the leader who has the mettle in him
to prove a match for immensely resourceful Harish Rawat would
be nowhere in the battle as he has well crossed past the age bar.
If the party high command proves lenient the leader with newmade hair stands a chance to receive dividends for the pains
he has taken to look young.
3\QccUcY^^Ug4__^
=UTYSQ\3_\\UWURUWY^
9Z_UZW`ce_ZXYe
T`_T]fUVd
3Te^cTTbX\\TabTXS^[^U;^aS6P]TbWPX]C^]baXeTaPcCP_ZTbWfPacT\_[T3TWaPSd]^]CWdabSPh
?aPbWP]c1PS^]Xk?X^]TTa
Dehradun: The Canara Bank,
Dehradun circle marked the
conclusion of Hindi fortnight by
organising a Hindi Diwas programme. The bank’s regional
head AR Agrawal and
Uttarakhand Sanskrit Vishwavidhyalaya Vice Chancellor professor Piyosh Kant Deekshit and
Dinesh Chandra Ramola, the
head of Hindi and Bhasha
Vigyan department of the university were among those present
on the occasion.
Agrawal spoke of the
progress made in Hindi in the
banks functioning while also
informing about the works
being conducted by the bank in
Hindi. He exhorted all employees to try and use the Hindi language as much as possible in the
official works. Deekshit spoke of
the historical aspect of Hindi
appreciating its aspects of simplicity and accessibility compared to other languages. PNS
?=B Q 347A03D=
fter the chaos witnessed a
A
day earlier, things settled
down on Thursday at the
Government Doon Medical
College. The first batch of
MBBS student of the newly
setup college had their first
class on the day. The Principal
of the college, Dr Pradip
Bharati Gupta took a
session with the students in
which he explained curriculum of their studies. He also
elaborated on qualities of a
good doctor. An introductory session was held in which
the faculty members were
introduced with the students.
Later talking to The
Pioneer, Dr Gupta said that college has made all necessary
preparation for the smooth
functioning of academic and
other activities. He informed
that students are taught subjects of Anatomy, Physiology
and Biochemistry in I year
MBBS course. “We have four
senior faculty members each
for Anatomy and Physiology
while three teachers are there
for Biochemistry. The library of
the college has more than 3000
books and 20 medical journals.
The cadavers necessary for
anatomy classes are also available,’’ Dr Gupta said.
The students have taken
occupation in their respective
rooms. Many parents were visible in the hostels, arduously
arranging things for their
wards. Some of the electrical
and masonry works were still
going on the hostel building but
the basic necessities like beds,
fans, water, electricity were
arranged by the harried college
authorities.
On Wednesday some of the
parents had objected to lack of
facilities in the hostel rooms
after which the Uttar Pradesh
Nirman Nigam Limited and
college administration swung
into action. “Things have
changed for better in less than
24 hours. The college authorities should have shown this
swiftness earlier,’’ said one of a
parents looking relieved. The
college has hired a local vendor
to supply the breakfast, lunch
and dinner for the students till
the process of mess tender is
complete. The earlier tender
process for mess was cancelled
as only one party showed interest in the work. A new tender
is released now.
EZ^SVc^RWZRReeRT\dW`cVde <P]TPcTa[T^_PaSbc^QTaTWPQX[XcPcTSPcfX[S[XUTcaP]bXcX]2WXSXhP_da
XfRcUZ_CR[R[ZEZXVcCVdVcgV
?=B Q 347A03D=
?=BQ 70A83F0A
ncidents of criminal elements beating
forest guards in Rajaji Tiger Reserve
appear to have continued with another
such case being reported. Timber mafia
lifted a forest guard and dumped him in
the forest area after beating him black
and blue on Wednesday night.
The guard deputed at Senthli beat of
Beriwada range of Rajaji Tiger Reserve,
was left half dead. He was later rushed
to a hospital by the forest officials.
Meanwhile, two of the accused
Shaukeen and Shahzad were arrested.
The assault might have been made to
teach forest guard Arjun Singh a “lesson”
as he had registered a case against
Shaukeen earlier, said department officials. Iliyas Dangi gang was behind the
attack, say sources.
Police said that over two dozen
timber mafias had reached the Senthli
police check post on late Wednesday
night. They also broke into the forest
office to lift Arjun Singh, the lone forest guard on duty. He was later taken to
a sugarcane field. The miscreants
thrashed him with batons and sticks and
while he fell unconscious he was dumped
in the forest.
I
;Pbc\^]cWc^^PU^aTbc
VdPaS_^bcTSX]1TaXfPSP
aP]VTfPbPccPRZTSfWT]
WTfPb^]_Pca^[[X]VSdch
Around 3 am, when Arjun gained
consciousness, he managed to reach
Tehra and recounted to the officials
what happened to him. The forest officers admitted Arjun to the district hospital where he is undergoing treatment.
Meanwhile, a case has been registered
against 12 unidentified timber mafias.
Notably, the southern boundary of
Rajaji Tiger Reserve has remained vulnerable with the gangs led by the timber mafias indulging in illegal activities
for the past several years with impunity. It is not the first time that the forest
guards have been assaulted by mafia.
E arlier also in Dhaulkhand and
Beriwada forest ranges, cases of timber
mafia attacking forest guards were
reported. Last month too, a forest guard
posted in Beriwada range was attacked
when he was on patrolling duty.
eopards that have been tagged
as man-eaters are now kept at
L
the department’s wildlife transit
and rehabilitation centre in
Chidiyapur, Haridwar forest division. These six leopards were captured by the forest department.
They have been confined to
cramped conditions here for
about five years in one case,
instead of being handed over to
zoos in accordance with the
Central Zoo Rules.
Citing anomalies in various
tasks of the centre, the inspection
report of the centre authorised by
the Animal Welfare Board of
India, recommended that the
Chidiyapur centre should be
handed over to the Wildlife
Institute of India without delay in
addition to other measures recommended for improving the
centre’s condition.
On April 15 this year the
AWBI had authorised its member NG Jayasimha and co-opted
member Gauri Maulekhi to conduct an inspection of the
Chidiyapur centre to check and
assess the status of housing,
upkeep and maintenance while
checking any incidences of cruelty, violation of Central and
State animal protection laws in
respect of the unauthorised wild
animal facility run at Chidiyapur
in Haridwar. The inspection
report submitted to AWBI on
September 14 presents a dismal
state of affairs with leopards
under protracted torture of confinement in violation of the laws,
improper documentation,
absence of trained and qualified
staff and varied other irregularities. The report observed at the
same facility, that a monkey sterilization centre was also run
from time to time. There were no
monkeys there on the day of the
inspection, but documents
obtained under RTI Act reveal
lapses on the part of the authorities on which a detailed report
may be submitted later this week,
stated Jayasimha.
The report points out that
since no officials or documents
were available at the centre on the
date of the visit, documents pertaining to the housing, upkeep
and treatment of the inmates of
the entre were obtained under the
RTI Act for this report. Key
observations state that leopards
0[[[T^_PaSbS^]^c
WPeTPRRTbbc^^_T]
T]R[^dbdaTbPbcWTaTPaT
^][hcf^bdRWT]R[^bdaTb
P]SbXg[T^_PaSb]^]T^U
cWT\R^\_PcXQ[T
fXcWTPRW^cWTa
once captured, are kept at the centre permanently with six leopards
at the centre presently.
Maximum time elapsed since
capture — 62 months — was that
of the male leopard tagged a
‘man-eater’ and captured from
Garhwal forest division on May
15, 2011. Similarly, 55 months
had elapsed since the capture of
a male leopard declared ‘maneater’ in December the same year
from Nanda Devi national park.
Twenty seven, 26, 16 months and
1 month have elapsed since the
capture of the other leopards in
the centre. “All leopards do not
have access to open enclousures
as there are only two such enclosures and six leopards, none of
them compatible with each other.
The reason of capture of all
these six leopards is stated to
have been their declaration as
man-eating leopards. Rather than
transferring these leopards to the
zoo in accordance with the
Central Zoo Rules, they are kept
in inadequate and poor housing
conditions at the centre.
Leopards were obser ved
crammed in small rooms due to
inadequacy of enclosures.
Improper record keeping
with suspicion of some post
mortem reports having been
fraudulently made raises serious
concerns about the mortality of
animals accorded highest protection under the Wildlife
Protection Act, while also alluding to foul play by the persons/officers in charge of the centre,” states the report, while also
adding that the post mortem
reports were not as per the standard operating procedure for
leopard mortality as prescribed by
the National Tiger Conservation
Authority. Stating that the leopards observed were under stress,
the report stated the centre was
confining animals in contravention of sections of the Prevention
of Cruelty to Animals Act, 1960.
“Creating false post mortem
reports and absence of any documents regarding release of the
leopards requires investigation to
establish if any offence under the
Indian Penal Code has been
committed,” the report states.
It recommends that operation of the centre be immediately handed over to the Wildlife
Institute of India for proper rehabilitation of the leopards.
Leopards that cannot be rehabilitated should be housed in cages
as recommended by CZA. The
centre must seek recognition
from CZA and Supreme Court
and adhere to the regulations for
such recognition. The centre
must not take in any more leopards till sufficient staff and enclosures have been created,” states
the report while also stressing on
the need for appointment of a full
time director and full time veterinary officer for the animals in
the centre.
]PcX^]#
347A03D=k5A830H kB4?C4<14A %! %
?`hW]jUZcVTeWc`^4YR_UZXRcYe`DYRc[RY
?=BQ B0B=060A<>70;8
handigarh Airport got conC
nected to the world on
Thursday with the innauguration of the maiden international flight to Sharjah (UAE),
heralding a new phase for the
air passengers of the region.
Describing the maiden
direct international flight from
Mohali International Airport as
a red letter day, Punjab Chief
Minister Parkash Singh Badal
said that it was a step further
towards emerging the State as
‘hub of air connectivity’ thereby
benefiting the Punjabi diaspora
settled across the globe.
Talking to reporters on the
sidelines of the inaugural of
first international flight from
the airport to Sharjah, he said
that it was a matter of great
pride and satisfaction for the
Punjabis that Punjab was the
first in the northern region to
have two international airports. He said that this international Airport at Mohali,
second in the State after
Amritsar, was result of persistent efforts made by the State
Government.
He said that the commencing of international flights
from this airport would give
much needed boost to the
economy of the State by connecting it with the rest of world.
Badal said that this airport
would act as a catalyst to boost
Industrialisation in the State
besides showcasing Punjab as
the most preferred investment
destination to woo the leading
entrepreneurs across the world
to make huge investments in
the State. He said International
air connectivity from Mohali
was all the more important
because it would connect the
entire Northern region comprising Punjab, Haryana,
Himachal Pradesh, Jammu &
Kashmir, Uttrakhand and even
the Western part of Uttar
Pradesh with the other parts of
the world.
He said that in the absence
of this international airport
daily a large number of passengers from the Northern
States were left with no other
option but to travel Delhi for
boarding the international
flights, which not only caused
undue harassment to them but
also resulted in huge wastage of
time, money and energy.
Punjab Deputy Chief
Minister Sukhbir Singh Badal
termed this as a historic occasion, adding that this initiative
would go a long way to propel
and IT and tourism sector in
the State.
Sukhbir said he was leading a special delegation of
prospective Industrialists from
the State to Sharjah to explore
more investment avenues so as
to bring major investment in
different sectors in Punjab.
He said the Airport would
be instrumental in giving major
push to the hosiery, woolen,
garments and cycle industry in
Ludhiana. He also hoped that
with the commissioning of
International flights from
Mohali Airport, the local farmers of the State would be enormously benefitted especially
from the country like Dubai,
which had a tremendous
export potential of agro and
food items.
+DU\DQD*RYW
FDQFHOVOHDYHRI
GRFWRUVRWKHU
PHGLFDOVWDII
Chandigarh:
Har yana
Government on Thursday
ordered cancellation of leave of
all doctors, dentists, paramedical staff and other officials of
the Health Department, till
further orders, so as to control
the spread of dengue and
chikungunya.
Health Minister Anil Vij on
Thursday said that the incidence
of dengue and chikungunya is
increasing in the districts of the
State adjacent to Delhi.
In Delhi, chikungunya and
dengue are spreading like an epidemic, therefore, he cautioned
the people in the State to take
preventive measures before
commuting between Delhi and
the State. Vij also directed the
senior officers of the Department
including Additional Chief
Secretary, PK Mahapatra to take
appropriate measures to check
the spread of chikungunya and
dengue.
?=B
&HQWUHVHHNVIHHGEDFNRI&0 8QbiQ^Qd_\Qe^SX\_W_V_b
cgQb^ZQiQ^dYSU\URbQdY_^
.KDWWDUIURP6WDWHOHDGHUV
?=BQ 270=3860A7
ollowing the worst violence
in five decades of Haryana’s
F
existence earlier this year under
the rule of BJP led Haryana
Government, the Central party
leadership on Thursday sought
feedback of Manohar Lal
Khattar’s Government from
various State leaders.
With BJP-led State
Government completing
around two years in Haryana,
Shiv Prakash, national joint
general secretary (organisation), reviewed the performance of the Government in a
series of meeting held here.
The series of meetings were
held with State MLAs, Cabinet
Ministers, State MPs and BJP
core group, where the senior
BJP leader sought the feedback
of the performance of first BJP
HZeY3;A]VUDeReV8`gVc_^V_e
T`^a]VeZ_XRc`f_Ueh`jVRcd
Z_9RcjR_RDYZgAcR\RdY
_ReZ`_R][`Z_eXV_VcR]
dVTcVeRcj`cXR_ZdReZ`_
cVgZVhVUeYVaVcW`c^R_TV`W
eYV8`gVc_^V_eZ_RdVcZVd`W
^VVeZ_XYV]UYVcV
Government in the State and
also enquired about party’s
image among people of various
communities after February’s
violent Jat agitation.
BJP’s incharge of Haryana
affairs Anil Jain and Chief
Minister Manohar Lal also
attended the meetings.
During various meetings
which concluded late Thursday
evening, Shiv Prakash also
enquired about the status of
various central and State
Government’s schemes.
A senior party leader said
that Shiv Prakash has asked the
State leaders to strengthen the
organisation at grassroot level
and to rebuild public faith in
the Government. He has asked
the MLAs to meet people on
regular basis to redress their
grievances.
Shiv Prakash has also asked
the MLAs to celebrate Prime
Minister Narendra Modi’s
birthday on September 17 as
‘sewa divas’ and hold events of
social ser vice in their
constituencies.
BJP
led
Har yana
Government will complete its
two years tenure in October
this year. The 62-year-old
Manohar Lal Khattar had taken
oath as the first Chief Minister
of the BJP Government in the
State on October 26 in 2014.
Ac`TfcV^V_edjdeV^e`
X``_]Z_VZ_9RcjR_R
?=BQ 270=3860A7
he crops of farmers in
Haryana would be proT
cured online through e-procurement from October 1 and
its payment would be made
direct to the farmers’ bank
accounts.
Haryana Minister of State
for Food, Civil Supplies and
Consumer Affairs, Karan Dev
Kamboj on Thursday said that
initially, all arhatiyas would be
connected with Government’s
server. Thereafter, the farmers
would be connected through
the arhatiyas.
Kamboj, who was talking
to the mediapersons said that
this year, farmers would be
given option to sell their produce through arhatiyas. The
farmers would have to give
their consent whether they
want to take money from
arhatiyas or direct into their
bank accounts, said he.
For the success of this system, all the arhatiyas would
have to computerise their working so that data of all farmers
could be accessed easily. Also,
the arhatiyas would have to
upload data such as name of
farmer, address, aadhaar number and other necessary information including mobile phone
number on the server.
The Government would
start paddy procurement from
October 1 so that farmers may
not face any problem in selling
their produce, he added.
Chandigarh: Planning to celebrate the golden jubilee year of
the State in a big way, the
Haryana Government will
launch a logo for Swarna Jayanti
(golden jubilee) celebrations on
September 17 in Gurgaon.
Besides, a magnificent
Swarna Jayanti Rath Yatra has
been planned to be taken out as
a pre-cursor to Haryana Swarna
Jayanti celebrations from
November 1, 2016 to October
31, 2017. The Rath Yatra will
comprise five tableaus depicting
art, culture, heritage, history,
progress and development of
the State. The Rath Yatra would
pass through all districts and villages or towns falling between
one district headquarter to
other district headquarter.
A meeting of executive committee of Swarna Jayanti
Celebrations Authority was held
under Chief Secretary DS Dhesi
on Thursday to discuss plans for
the year long celebrations.
Apart from depicting various aspects of life and people of
Haryana, about 100 to 200
artistes would also be engaged to
perform on the tableaus and create a festive environment from
wherever this Yatra passes. The
Rath Yatra will also showcase a
cultural programme at the district headquarters in the evening.
It was informed that the
State Government intends to
showcase history, economic
prowess and achievements of
the state over the last five
decades since Haryana became
an independent state of India.
With a view to organise the
grand opening ceremony of
Haryana Swaran Jayanti
Celebrations on November 1 at
Tau Devi Lal Stadium, Gurgaon,
³CWT6^ecf^d[SbcPac
_PSSh_a^RdaT\T]cUa^\
>Rc^QTa b^cWPcUPa\Tab
\Ph]^cUPRTP]h_a^Q[T\
X]bT[[X]VcWTXa_a^SdRT´
E`jY`daZeR]e`
YV]a^R\VgZdZee`
U`Te`cTYZ]Uda]Rj
Kamboj said that eProcurement would not only
ensure transparency in the system, but would also put a
check on theft of market fee.
After development of this system, the arhatiyas would be
able to start e-Trading in the
entire country.
Under this system, they
would be able to purchase
crops from any part of the
country and sell the same
online in other parts of the
country, he said.
The Minister said that the
control of online procurement
would be at state headquarters
and all district headquarters
would be linked to it. The Anaj
Mandis of districts would work
under the supervision of
District Food and Supplies
Controller.
<´=0386<?G>1BCAD2C8>=
4>fcXVUe`cRZdVVT`Z^aRTeZddfV
4]cXaTBPcZ^bXP
T]eXa^]\T]c
d]STacWaTPc
1890H<8B7A0Q 0=6D;
eading environment protection organisations,
L
Citizen Action Forum (CAF)
and Foundation Ecological
Security, have urged Chief
Minister Naveen Patnaik to
raise the issue of environmental impact due to depleted
water flow in the Mahanadi in
the wake of construction of
barrages on the inter-State
river by the Chhattisgarh
Government at the tripartite
meeting in New Delhi on
September 17.
“Depletion of water flow in
river Mahanadi will have a serious impact on the whole
ecosystem of the Satkosia
Gorge sanctuary, the Satkosia
Tiger Reserve, the Mahanadi
Elephant Reserve and the
Gharial Research and
Conservation Unit (GRACU),”
the two organisations have said
in a memorandum to the Chief
Minister.
Besides, the Mahanadi
estuarine ecosystem and the
Mahanadi
delta,
the
Bhittarkanika mangrove forest
with high species diversity and
the Gahirmatha rookery of
Olive Ridley turtles would also
be affected, they said.
Submitting the memorandum, team leader FES Swapna
Sarangi and RP Patnaik and
Bijay Mishra of the CAF
demanded withholding or cancellation of all the environment
clearances to all the projects’
construction
by
the
Chhattisgarh Government on
the Mahanadi and direction to
stop the works until an environment impact assessment
relating to the Satkosia Gorge
sanctuary and the Mahanadi
estuarine ecosystem is done.
Notably, the Mahanadi
flows in the heart of the rare
ecosystem of the country—
the Satkosia Gorge sanctuary.
The river extends life support
to the sanctuary.
Satkosia is the longest and
deepest running water system
of the world and the meeting
point of two bio-geographic
regions of the country -- the
Deccan Peninsula and the
Eastern Ghats -- contributing
immensely to biodiversity.
The Satkosia Gorge sanctuary consists of the Satkosia
Tiger Reserve, the Mahanadi
Elephant Reserve and the
Gharial Research and
Conservation Unit (GRACU).
The Satkosia Tiger Reserve
comprises two adjoining sanctuaries of central Odisha
named as Satkosia Gorge
Sanctuar y and Baisipalli
Sanctuary.
Dubai: Children in Dubai who
are frightened of hospitals and
doctors will soon be able to take
their ‘sick’ toys ‘for treatment’ to
help them reduce their own anxiety, a media report said on
Thursday.
Toys that require surgery
will be taken to a special operating room in a toy hospital,
where children can watch the
procedure being carried out.
It is believed that giving children a positive experience in
hospitals will help reduce their
anxiety if they need medical
treatment later on, according to
experts from the Mohammed
bin Rashid University of
Medicine and Health Sciences,
Khaleej Times reported.
The university will use a
simulation centre, where children will meet with health workers, who will ‘assess’ and ‘treat’
the toys.
it has been proposed to hire an
event management agency to
creatively conceptualise the
opening ceremony and include
various cultural and historical
elements of Haryana and showcase the contribution of Haryana
to the progress of the country.
Also, a project management unit or knowledge partner would be engaged for
smooth functioning of all activities like cultural programmes,
sports tournaments, prabhat
feris and speech competitions.
The State Government has
also planned to bring together
renowned actors, business icons,
state leaders, sportspersons, exserviceman and freedom fighters belonging to Haryana on one
platform during the mega event
to be inaugurated by Prime
Minister Narendra Modi on
November 1 in Gurgaon. ?=B
EP[c^WPST\P]Sb_aXeX[TVT
\^cX^]PVPX]bc2^]V
<;0b^eTaaT\PaZb
:ULWHVOHWWHUWR
6SHDNHU
?=BQ 270=3860A7
day after he was alleged to
have passed a casteist
A
remark against Congress MLA
Tarlochan Singh Soond inside
the Punjab Vidhan Sabha, the
Shiromani Akali Dal MLA
Virsa Singh Valtoha on
Thursday written a letter to the
Assembly Speaker Charanjit
Singh Atwal demanding privilege motion against Congress
MLAs, including Soond, for
their “shameful acts”.
“Congress MLA Soond and
other Congress MLAs used
defamatory language against
me and concocted a false story
blaming me of using foul and
objectionable casteist remarks
in a bid to cover up his own
sins. By committing such a
sin, the Congress MLAs have
breached my special privilege in
the House,” said Valtoha.
He said that despite of feeling sorry for his shameful act,
Soond created a false story of
caseist remarks in the media to
cover up his sin and Congress
MLAs also supported him in
this cover up act.
Valtoha said that he is an
amritdhari Sikh, who lives his
life as per teaching of Sikh
Gurus and respect all religions
and castes. He cannot even
think of using any caseist
remarks against any community, he said.
“During the ongoing session, shoe hurling at ruling
party chairs by Congress MLA
Soondh has lowered the dignity of the House. All MLAs are
deeply hurt and saddened by
this shameful act of the
Congress MLA,” he added.
Valtoha said that Congress
MLAs had made a mockery of
the rich traditions of the Vidhan
Sabha, and asked them to
explain why they had resorted
to drinking sessions of Scotch
and Whisky, eating Chicken
and Meat in the august House.
“There are also reports that
some Congress MLAs sharing
vulgar video clips between
themselves which needed to be
investigated…All these incidents prove that the Congress
party is deeply frustrated by its
inability to rise to the expectations of the people,” he added.
Condemning this act of
Congress MLAs, Valtoha said
that the Speaker, who also
remained the Deputy Speaker
of the Lok Sabha, is known for
his dignity, fairness and transparency, but the Congress
MLAs even lowered the dignity of the Chair of the Speaker
by throwing books and paper
rolls on the chair and using
derogatory language against
the Speaker.
Commenting on the
remarks made by Capt
Amarinder Singh about him,
Valtoha asked the state
Congress chief to get congress
MLAs treated by doctors who
made merry by drinking Scotch
whisky besides resorting to
jokes and singing sessions in the
temple
of
democracy.
&RQJUHVV0/$6RRQGDQGRWKHU&RQJUHVV0/$V
XVHGGHIDPDWRU\ODQJXDJHDJDLQVWPHDQG
FRQFRFWHGDIDOVHVWRU\EODPLQJPHRIXVLQJIRXO
DQGREMHFWLRQDEOHFDVWHLVWUHPDUNVLQDELGWRFRYHU
XSKLVRZQVLQV%\FRPPLWWLQJVXFKDVLQWKH
&RQJUHVV0/$VKDYHEUHDFKHGP\VSHFLDO
SULYLOHJHLQWKH+RXVH
3P]PVTcbC(;1PWaPX]PXS
?=BQ 17D10=4BF0A
ana Majhi, who had carried his wife’s body on his
D
shoulders for around 12 km
after being allegedly denied an
ambulance at the Kalahandi
District
Headquarters
Hospital (DHH), on Thursday
received C9-lakh assistance
donated by Bahrain Prime
Minister Prince Khalifa bin
Salman Al Khalifa.
Majhi received the cheque
at the Kingdom of Bahrain
Embassy in New Delhi.
“I will deposit the amount
in the accounts of my three
daughters and will spend it for
their study,” said Majhi.
Moved by an article on
Dana Majhi in the Akhbar Al
Khaleej of Bahrain, the
Khalifa had announced the
donation.
Notably, Dana’s wife
Amang died at the Kalahandi
DHH at Bhawanipatna due to
³FX[[ST_^bXccWT
P\^d]cX]QP]Z
PRR^d]cb^U\h
"SPdVWcTab´
tuberculosis on August 23.
Dana reportedly sought help
from the hospital staff to
carry the body to his village,
60 km away from the DHH.
But after the hospital staff
reportedly denied an ambulance, Dana walked with the
corpse on his shoulders along
with his 12-year-old daughter
on August 23 night till people
spotted him in the early
morning on August 24.
Meanwhile, different organisations and people have
donated money to Dana while
the KISS offered free education to his daughters.
BP\QP[_dac^_bX]d]STafTXVWc]TfQ^a]X]>SXbWP
Q B0=944E:D<0A?CA>
disha’s development story
carries little weight when the
O
latest 2016 data reveal that one
in every five newborn in the State
is underweight, and Sambalpur
district tops with more than two
babies born underweight in
every five newborns. The worrying fact is that a high of
around eight districts have
underweight newborns higher
than the State average.
According to the data available for the period April-August
2016 with the State Health
Department, a high of 41 per
cent of newborns in Sambalpur
are underweight vis-a-vis the
State average of 20 per cent.
Nabarangpur follows with
around 32 per cent underweight
newborn. Kandhamal with 31
per cent underweight newborn
is lurking closely behind
Nabarangpur. Moreover,
Kalahandi with around 28 per
cent underweight newborn
babies and Malkangiri with over
27 per cent underweight babies
form the league of top-5 districts
with most underweight newborns (babies who were weighed
at birth).
The data further reveal that
while 25 per cent babies born in
?TYcXQXQccUS_^T
XYWXUcdY^VQ^d]_bdQ\YdibQdU
?=BQ =4F34;78
sample registration system
report for 2014 released by the
Registrar General and Census
Commissioner of India (SRS).
The infant mortality rate
(IMR is the number of deaths
of infants under one year per
1,000 live births. It is the goto figure to measure a State’s
health scenario. For Odisha,
the rate is 49.
The death rate of girls
stands at 53 in villages and the
figure for cities is 34. Villages
are witnessing more deaths
than cities because of high
malnutrition rate and poor
access to health services.
The report reveals that
Madhya Pradesh has the highest infant mortality rate in the
country. According to the
report, Assam also stands second in infant deaths along
with Odisha, followed by Uttar
Pradesh at the third position,
Rajasthan at fourth and
Chhattisgarh at the fifth spot.
Deogarh are underweight,
Balangir with over 24 per cent
underweight newborns follows
closely.
Though Sambalpur district
tops the underweight chart,
Nabarangpur tops with stillbirth cases. Sambalpur has
recorded around 443 stillbirth
cases during the period AprilAugust 2016. Ganjam district
with around 367 stillbirths comes
closest second to Nabarangpur.
Mayurbhanj and Koraput follow
them to make the top-5 districts
with high stillbirth cases. Then
Balangir follows the top-5 in
stillbirth cases, reveal the data.
Stillbirth is the birth of a
baby who is born without any
signs of life at or after 24 weeks
of pregnancy. A baby may have
died during late pregnancy
(called intrauterine death) or,
more unusually, may have died
during labour or birth (called
intra-partum death).
According to the Unicef,
pre-eclampsia and heavy bleeding during late pregnancy or during labour constitute a significant
factor in Odisha behind stillbirths. Other factors like malaria and bacterial infections (espe-
cially Eischeria coli) also play a
major role in high stillbirth
cases in the State. It is generally
observed that the districts with
poor sanitation and nutrition
condition record high incidences
of stillbirths and underweight
babies.
With such a state of affairs
in childbirth, Odisha in the
indicator of infant mortality rate
(IMR) has failed to make any
progress during the last decade
(2005-2014) as it stuck at 34th
rank (among 36 States and
Union Territories) in 2014, the
same it had in 2005.
disha stands second in
infant mortality rate in
O
the country, says the latest
]PcX^]$
347A03D=k5A830H kB4?C4<14A %! %
:_UZRdfXXVdedAR\hRjd
e`daVVUfa#' ""ecZR]
?=BQ =4F34;78
pset with the slow pace of
progress in the 26/11
U
Mumbai trial going on in
Pakistan, Foreign Secretary
S Jaishankar has written to his
Pakistani counterpart Aizaz
Ahmad Choudhry giving suggestions on how to conclude
the trial at the earliest.
The letter was sent around
a time when Pakistan’s Federal
Investigating Agency (FIA)
dropped charges against
Lashkar-e-Tayyeba terrorist
Sufiyan Zafar for lack of evidence in this case.
The letter by Foreign
Secretary, sent on September 6,
was delivered to Chaudhry on
September 9 by the Indian
High Commissioner in
Islamabad Gautam Bambawale.
However, India is yet to get a
response on this letter.
While the Government
didn’t elaborate on the suggestions, sources indicated it could
be sending a Judicial
Commission to India to exam-
C744=C8A40CC02:F0B?;0==435A><
?0:8BC0=F0B?4A?4CA0C431H
?0:8BC0=8=0C8>=0;B0;;C744E834=24
0A48=?0:8BC0=1DC4867CH40AB70E4
?0BB430=3CA80;8B70??4=8=60C0
B=08;³B?024F40A4?A4?0A43C>
>554ABD664BC8>=B>=7>F8C20=143>=4
C7A>D67C74?A>?4A;460;270==4;B
EXZPbBfPa^^_<40
b_^ZTb_Tab^]
ine evidences that Pakistan
has been asking New Delhi to
handover. These include GPS,
satellite-cell phones and
weapons etc used by terrorists.
Pak wants India to hand
over these material evidences to
it along with recovery memos.
It claims that in the absence of
these it still does not have
much in hand to move ahead
in the case.
Underlining that the trial in
Pakistan has not progressed
expeditiously, although it will be
eight years soon since the attack,
Ministry of External Affairs
spokesperson Vikas Swarup
said the Foreign Secretary’s step
was prompted by the delay in
bringing to book the persons in
Pakistan responsible for the
Mumbai terror attack. “As you
know, the entire attack was
planned from Pakistan, was
perpetrated by Pakistani nationals, all the evidence are in
Pakistan, but eight years have
passed and trial is happening at
a snail’s pace,” he said.
According to Swarup, if
Pakistan is serious about bringing to justice the perpetrators
of the attack, it must act on the
suggestions as India’s focus is to
check terrorism and the
Government wants to bring the
Mumbai case trial to expeditious conclusion. “We are prepared to offer suggestions on
how it can be done through the
proper legal channels,” he said.
Sufayan Zafar was accused
of financing C14,800 crore for
the attack and providing
C3.98 crore to co-accused
Shahid Jameel Riaz prior to the
attack. Zafar was hiding after
being declared proclaimed
offender in the Mumbai case.
He was arrested early last month
from his hideout in KhyberPakhtunkhwa province.
A resident of Gujranwala
district of Punjab, approximately
80 km from Lahore, Zafar was
among 21 absconding suspects
wanted in this high-profile case.
Six suspects —Abdul Wajid,
Mazhar Iqbal, Hammad Amin
Sadiq, Shahid Jameel Riaz, Jamil
Ahmed and Younus Anjum—
have been lodged in the Adiyala
Jail, Rawalpindi, since 2009 for
abetment to murder, attempted
murder, planning and executing
the Mumbai attacks.
8]SXPAdbbXPQ^]SfPa\STb_XcTDBbP]RcX^]b
E8=44C0?0=34HQ =4F34;78
aving worked firmly
together over the years in
H
the defence and security areas,
India and Russia are now moving forward to increase their
trade and commerce relationship in a big way.
Ahead of President
Vladimir Putin’s visit to India
this October for the Annual
Summit level talks, the two
sides are working to ramp up
the
ties
with
new
collaborations.
Defence and security still
remain prime collaborating
areas, sources said but pointed
out that the two sides are moving fast on new dimensions that
include aerospace, ship building, port development, diamonds, pharmaceutical, railways, inland waterways, shipbuilding, manufacturing, mining, agriculture and food processing. Apart from these, there
are talks for partnership
between Indian States like
Maharashtra, Andhra Pradesh
and Rajasthan with regions in
Russia.
Sources conceded that
economy and trade have
shrunk between the two sides
3Tb_XcTbP]RcX^]bQhDB^]AdbbXP8]SXP´b
aT[PcX^]bWX_fXcW<^bR^fWPbaT\PX]TS
a^QdbcP]S\d[cXSX\T]bX^]P[8]SXPb
bTRdaXchaT[PcX^]bWX_fXcWAdbbXPWPbQTT]
b^d]X`dTcWPccWTaTXbPbPhX]VcWPcXUcWTaT
XbPbTRdaXchbXcdPcX^]X]8]SXPcWTUXabcRP[[
\PSTfX[[RTacPX][hQTc^AdbbXPCWT
±fPa\cW²X]aT[PcX^]QTcfTT]E[PSX\Xa?dcX]
P]S=PaT]SaP<^SXbW^d[SbTTcWTcf^
bXSTbbcT__X]Vd_X]cTaPRcX^]bX]b_TRXUXR
PaTPbU^aR^[[PQ^aPcX^]bP_PacUa^\cWT
caPSXcX^]P[\X[XcPahcTRW]^[^VhT]TaVhP]S
RXeX[]dR[TPaR^^_TaPcX^]
which they are trying to get
back on track.
The “warmth” in relation
between Putin and Modi
should see the two sides stepping up interactions in specific areas for collaborations apart
from the traditional military
technology, energy, and civil
nuclear cooperation.
Interestingly, despite sanctions by the United States on
Russia, India’s relationship with
Moscow has remained robust
and multi dimensional. India's
security relationship with
Russia has been so unique that
there is a saying that if there is
a security situation in India, the
first call made will certainly be
to Russia.
Russia too has backed
India in all odds and evens. The
military and civil nuclear
partnership remains robust
and Russia has helped
India immensely in capacity
building in this sector. From
submarines to helicopters,
Sukhois to sophisticated
weapons-there is collaboration
in all areas.
There is also talk of India
procuring Fifth Generation
Fighter Aircrafts from Russia
for which some initial investment seems to have been made
by India. Through FGFA, New
8=B7>AC
C74;4CC4AF0B
B4=C>=B4?C%6>C
34;8E4A43C>?0:
5>A486=B42A4C0AH
>=B4?C(0=3
A4?;H8B0F08C43
Delhi is looking at getting
some cutting edge technology
and “something ahead of
curve” for its defence sector.
Some progress is expected to be
made during Putin’s visit next
month on the FGFA.
India is also particularly
happy with the Kamov 226 deal
with Russia. Out of the 200
helicopters that India is buying,
60 will be in fly away
conditions with the rest 140 to
be jointly made in India.
India is happy that this first
major defence project under
Make in India will help
strengthen its own military
aviation sector.
However, the Indian side is
making efforts to encourage
more Russian participation
through Make in India and
have joint ventures with Indian
private companies.
Though there seems to be
a bit of reluctance on the
Russian side to get involved
with private entities in India as
in this niche area they prefer
government to Government
dealings, the Indian side is
trying its best to convince their
Russian partners, sources said
adding Putin’s involvement
may help in this regard.
>55824AB>=?>;;3DCH
C>64C7>=>A0A8D<
=Tf3T[WX) 0RZ]^f[TSVX]VcWT
a^[T_[PhTSQh2T]caP[P]SBcPcT
_^[XRTU^aRTbX]R^]SdRc^U_^[[b
cWT4[TRcX^]2^\\XbbX^]^]
CWdabSPhP]]^d]RTScWPcP]
W^]^aPaXd\fX[[QT_PXSc^cWT
_Tab^]]T[ST_[^hTS^]T[TRcX^]
Sdch
34?>B8CC !2A8=5>DA
F44:B)B2C>?0ABE=0C7
=Tf3T[WX) CWTBd_aT\T2^dac
^]CWdabSPhSXaTRcTS?Pabe]PcW
1dX[SfT[[?ec;cSc^ST_^bXcC !
Ra^aTfXcWX]U^dafTTZbPb
X]cTaTbcQTPaX]VbW^accTa\
ST_^bXcU^aST[PhX]VX]VXeX]V
_^bbTbbX^]^UU[Pcbc^
W^\TQdhTabX]Xcb6WPiXPQPS
_a^YTRc0QT]RW^U9dbcXRTb
3X_PZ<XbaPP]S2=PVP__P]
PbZTScWTR^d]bT[U^a&W^\T
QdhTabfW^WPSP__a^PRWTScWT
=PcX^]P[2^]bd\Ta3Xb_dcTb
ATSaTbbP[2^\\XbbX^]
=23A2c^bTTZX]bcadRcX^]b^]
fWTcWTacWThf^d[SPVaTTc^cWT
_a^_^bTSSTPS[X]T^U3TRT\QTa
! &VXeT]QhcWTSTeT[^_TaP]S
cWT`dP]cXUXTS\^]cW[haT]c
?aX\T<X]XbcTa=PaT]SaP<^SXbWPZTbWP]SbfXcW5X]P]RT<X]XbcTa^U<PdaXcXdb?aPeX]S9dV]PdcWPcP\TTcX]VX]=Tf3T[WX
^]CWdabSPh
?C8
B2[Tcb:TaP[PaP_T\daSTaPRRdbTS
^UUVP[[^fbX][PRZ^UTeXST]RT
01A070<C7><0BQ
=4F34;78
ive years after the rape-cummurder of a 23-year-old
F
woman travelling in a local
train in Kerala shocked the
conscience of entire State, the
Supreme Court on Thursday let
the accused off the gallows after
it found evidence insufficient to
nail him for the girl’s death.
Though acquitting him of
the serious charge of murder, a
three-judge bench that heard
the appeal filed by the accused
Govindaswamy retained him in
jail for his entire life for the
charge of raping the woman in
an injured state as she lay
wounded beside the railway
track after she fell off the moving train.
The bench of Justices
Ranjan Gogoi, PC Pant and UU
Lalit came to the conclusion
that the rape was the most brutal and grotesque act and
deserved maximum punishment. It said, “Having regard to
the fact that the said offence
(rape) was committed on the
deceased who had already suffered extreme injuries on her
218aTVXbcTabRPbT #*aVcd`__V]`W2?$#RZcTcRWeµacVdf^VUUVRU¶
PVPX]bcd]Z]^f] 805aT[TPbTb]Tfb
However, search for the dent. It is with a feeling of and went missing soon after.
“No fewer than 201 search
plane in the Bay of Bengal will profound sadness that the
IAF officials said Court of Inquiry has recom- and rescue sorties, using all
PbbPX[P]cb^UbRaXQT PUcTa^]TP]SWP[U continue,
here on Thursday. As regards mended that your son/daugh- suitable aircraft at our
reason for informing ter be presumed to have been disposal were undertaken.
APYST^AP]YP]
\^]cWb^UX]RXST]c the
relatives, they said it was done fatally injured,” read the letter Approximately 2,17,800 square
?=BQ =4F34;78
?8>=44A=4FBB4AE824Q
=4F34;78
he CBI on Thursday registered a case against
T
early one and half months
unknown persons in the mur- Nafter an AN-32 transport
der of scribe Rajdeo Ranjan in plane went missing, the Indian
Siwan. “The CBI has registered
a case under Section 302, 120B, 34 of IPC and Section 27 of
Arms Act against unknown
assailants relating to alleged
murder of senior journalist
Rajdeo Ranjan on the request
of Bihar Government and further notification from
Government of India,” a CBI
spokesperson said.
CBI has taken over the
investigation of the said case
which was earlier registered
vide FIR No 362/2016 on May
13, 2016 at Police Station,
Siwan town, Bihar on a complaint from the wife of
deceased.
The move comes four
months after the Bihar
Government recommended a
CBI probe into the murder of
Ranjan, bureau chief of Hindi
daily Hindustan. A team of
agency sleuths will leave shortly for Siwan, the sources said.
The sources said name of
former RJD MP Shahabuddin
who has been released recently on bail was under the scanner of Bihar Police which was
probing the case till recently.
Meanwhile, a fact finding
team of the Press Council of
India (PCI) has found out that
Ranjan may have been killed by
“political mafia” because of his
critical reporting. The PCI
accepted the report of the factfinding committee last week.
Another fact-finding
report which the PCI accepted
was regarding the murder of
Jharkhand journalist Akhilesh
Pratap Singh. The report suggested that he may have been
killed over demand of money
by a Naxalite group.
Air Force (IAF) has informed
relatives of Service personnel on
board the ill-fated aircraft that
they are “presumed dead.”
There were 29 personnel in
the aircraft when it went missing shortly after take off from
Chennai for Port Blair on July 22.
to enable the next of kin to
enable them to initiate process
for insurance and other
administrative formalities.
“The Court of Inquiry,
upon very careful scrutiny of
the circumstantial evidence
available and in light of
extensive search and rescue
operations carried out, has
concluded that it is unlikely
that the missing personnel on
board the ill-fated aircraft
would have survived the acci-
from IAF to the families of
those in the aircraft.
The letter came annexed
with a certificate of presumption of death. There was a
woman officer among the missing personnel.
Officials said 17 ships of
the Navy and Coast Guard
including a submarine and 23
aircraft were engaged in the
search mission since the plane
which took off from Tambaram
airbase near Chennai on July 22
nautical miles (Sq Nm) have
been covered multiple times
by these aircraft,” the letter stated. “International emergency
response
teams
and
satellites from USA also did not
help in getting any
concrete information about
the missing aircraft,” it added.
The plane is believed to
have plunged into the sea
from a height of 23,000 feet
about 280 nautical miles off
Chennai.
&%,ILOHVJUDIWFDVH
$ViacVddhRjac`[VTed
DJDLQVWH[0'RI8%, SVdZUVdFA¶de`SV
]Rf_TYVUd``_+8RU\RcZ
?=BQ =4F34;78
he CBI has registered a corruption case against the forT
mer Chairman-cum-Managing
Director of United Bank of India
(UBI) Archana Bhargava and
two private companies.
During searches conducted on Thursday, the
CBI recovered cash,
jeweller y
and
investment details
to the tune of over
C10 crore which are
allegedly in her and
family members’
name, a CBI
spokesperson said
here. “It was alleged that the
then public servant while posted as ED of Canara Bank in the
year 2011 and as CMD of UBI
in the year 2013 had abused her
official position and obtained
certain amounts for herself or
for a New Delhi based private
firm (owned by her husband
and her son), from the companies to whom various credit facilities were granted by the
banks, where she had worked,”
the spokesperson said.
The official said searches
conducted at the residential
premises of accused persons in
Delhi, Noida, Mumbai, Kolkata
and Howrah led to the recovery
of jewellery worth C2.85 crore
and C10.50 lakh cash from the
bank lockers in her name and
family members.
In
addition
deposits of C5.42 crore
in her name and family members, C2.26 crore
in her bank accounts;
documents of two
properties including a
three-storey bungalow
at Noida and a flat at
Vasant Kunj, New Delhi besides
two properties in the name of
her family members in Delhi
and Mumbai, the official added.
The CBI has booked her
under section 120-B (criminal
conspiracy) of IPC and relevant
sections of the Prevention of
Corruption Act against then
CMD, a private firm based at
New Delhi and another private
firm based at Kolkata and
other unknown persons.
New Delhi: Road Minister Nitin
Gadkari on Thursday said that
three expressway projects-DelhiAmritsar-Katra, Delhi-Jaipur
and Vadodara-Mumbai-worth
C1,32,000 crore will be launched
soon. Besides a C1,500-crore
expressway project between
Kanpur and Lucknow in UP will
also be launched soon.
“We will soon start three
important expressway projects
that would reduce travel time
significantly between DelhiKatra, Delhi-Jaipur and
Vadodara-Mumbai. These
would entail a total project cost
of C1,32,000 crore,” Gadkari
said. He hoped that the travel
distance to these destinations
will reduce significantly once
the projects are operationalised.
As per the plan, Amritsar
could be reached via Delhi in
three hours after completion of
the C60,000-crore AmritsarDelhi expressway, which will
reduce travel duration by over
two hours. Also on the anvil is
a project connecting Jalandhar
to Ajmer that will bring down
the travel time to five hours.
Meetings in this regard are
scheduled with CMs of J&K,
Punjab, Haryana, Delhi and
Rajasthan.
“Detailed project report is
being prepared for an eight-lane
access controlled expressway
between Kanpur and Lucknow.
The estimated cost of the project would be around C1,500
crore. Kanpur to Lucknow distance can be travelled in 35-40
minutes,” Gadkari said adding
that it will be an elevated road.
The Minister said massive
road network would be laid in
UP and the Government has
planned at least C2 lakh crore
projects of which work on
about C70,000 crore projects is
underway. He on Wednesday
laid the foundation stones of 12
major NH projects worth
C10,596.19 crore at Ropar,
Samrala and Jalandhar in the
poll bound Punjab. Chandigarh
will also be connected by 4-lane
roads with all major cities such
as Amritsar, Jalandhar and
Ludhiana.
PNS
body, we are
of the view
that not only
the offence
under Section
376 IPC (rape)
was committed by the
accused, the
same was so
committed in
a most brutal
and grotesque
manner which
would justify the imposition of
life sentence as awarded by the
trial court and confirmed by the
Kerala HC.”
But the apex court set aside
the concurrent death sentence
awarded to Govindaswamy by
the trial court and High Courts
after raising doubts whether the
fatal injury caused to the victim was due to pushing her off
the train by the accused by way
of pushing or was a result of her
own action to jump off the
train.
Justice Gogoi, writing the
judgment for the bench said,
“The fact that the deceased survived for a couple of days after
the incident and eventually
died in hospital would clearly
militate against any intention of
the accused to cause death by
the act of keeping the deceased
in a supine position.”
The incident occurred on
February 1, 2011 while the victim was travelling in the ladies
compartment of a local train
from Ernakulam to Shoranur,
the place where she stayed.
The accused entered the
ladies compartment spotting
the victim alone and tried to
molest her following which
she fell off the train. The
accused too jumped out and
later raped her. She succumbed
to her injuries at the hospital
five days later.
EXYPh<P[[hPfW^XbPc
_aTbT]cX];^]S^]
\PSTcWTbdQ\XbbX^]
cWa^dVWWXbR^d]bT[
QTU^aTcWT2WXTU
<Tca^_^[XcP]
<PVXbcaPcTX]PRPbT
[^SVTSU^aP[[TVTS[h
TePSX]Vbd\\^]bX]
R^]]TRcX^]fXcWP54A0eX^[PcX^]\PccTa
CWTR^d]bT[bdQ\XccTScWTR^_h^UP]T\PX[
bT]cQh<P[[hPbcPcX]VcWPcWXb_Pbb_^ac
fPbbdb_T]STS^]0_aX[!"! %fXcW^dc
VXeX]VWX\P]h^__^acd]Xch^UQTX]VWTPaS
he Government has dismissed Vijay Mallya’s claim
T
that he is unable to return
India in the absence of a passport as it remains suspended
by Indian authorities. Ministry
of External Affairs spokesperson Vikas Swarup said on
Thursday that any citizen can
approach the nearest Indian
Embassy or High Commission
and apply for an Emergency
Certificate to return to the
country.
Swarup underlined that
the Emergency Certificate is
specifically meant to provide a
travel document to an Indian
citizen to return to India in the
absence of regular passport
and this facility is available to
Mallya also if he wishes to
apply for it.
“Our position is very clear.
Any Indian citizen who is outside India and who does not
have a valid travel document
for any reason, only has to
approach the nearest Indian
Embassy or High Commission
and apply for an Emergency
Certificate,” Swarup said.
Mallya, who is at present in
=Tf3T[WX) 0]P]cX6<Va^d_
2^P[XcX^]U^aP6<5aTT8]SXP^]
CWdabSPhP[[TVTScWPccWT
bdQR^\\XccTTR^]bcXcdcTSQh
cWTR^d]cahbQX^cTRWaTVd[Pc^a
6402c^TgP\X]TcWTQX^bPUTch
SPcP^]6<\dbcPaSSXS]^c
WPeTP]hWTP[cWTg_TacP]ScWaTT
^UXcb\T\QTabWPeTR^]U[XRc^U
X]cTaTbc
B?40:4A;43C40<C>
E8B8C=4FI40;0=3
6^ecYd]Zb<P[[hP´b
R[PX\bPhbP__[hU^a
4\TaVT]Rh2TacXUXRPcT
?=BQ =4F34;78
³6402383=>C70E4
0=H740;C74G?4AC´
London, recently made the
submission through his
counsel
before
the
Chief Metropolitan Magistrate
in a case lodged for allegedly
evading summons in connection with a FERA violation
matter.
The counsel submitted the
copy of an email sent by
Mallya, stating that his passport was suspended on April
23, 2016 without giving him
any opportunity of being
heard.
EnforcementDirectorate
(ED), however, told the court
that Mallya is already evading
proceedings in several other
cases and sought time to reply
to the plea moved by him on
Thursday. On July 9, the court
had cancelled the exemption
from personal appearance
granted to him and had directed him to appear before it.
In his application moved
through senior advocate
Ramesh Gupta, Mallya
requested the court that some
time be given so that his
appearance can be secured.
The court has now put up the
matter for further hearing on
October 4.
=Tf3T[WX) 0_Pa[XP\T]cPah
ST[TVPcX^][TSQh;^ZBPQWP
B_TPZTaBd\XcaP<PWPYP]fX[[
eXbXc=TfITP[P]SUa^\
BT_cT\QTa &c^!!3daX]VXcb
eXbXccWTST[TVPcX^]fX[[RP[[^]
cWTB_TPZTa^U=TfITP[P]Sb
_Pa[XP\T]c3PeXS2PacTaP]S
fX[[W^[S\TTcX]VbfXcW
\T\QTab^UcWT=TfITP[P]S
8]SXP?Pa[XP\T]cPah5aXT]SbWX_
6a^d_PcFT[[X]Vc^]CWT
ST[TVPcX^]fX[[P[b^\TTccWT
8]SXP]R^\\d]Xch\T\QTabPc
P]TeT]cW^bcTSQh=TfITP[P]S
8]SXP]2T]caP[0bb^RXPcX^]
=I820X]0dRZ[P]S
=6C=>C824C><>45
D?>=F0BC43D<?8=6
=Tf3T[WX) CWT=6C^]
CWdabSPhXbbdTS]^cXRTbc^
4]eXa^]\T]c<X]XbcahP]SD?
6^eTa]\T]cPVPX]bcaP\_P]c
Sd\_X]V^UfPbcTP]S
T]Ra^PRW\T]cb^]0acWP[P;PZT
[^RPcTSR[^bTc^7X]S^]AXeTaX]
cWTBcPcTCWXbR^\TbX]cWT
fPZT^UP_[TPP[[TVX]VcWPc
Sd\_X]V^Ub^[XSfPbcTP]S
QX^\TSXRP[fPbcTX]0acWP[P;PZT
P]SX]SdbcaXP[TUU[dT]cb
SXbRWPaVTSUa^\<^WP]<TPZX]
;cSfPbRPdbX]VVa^d]SfPcTa
R^]cP\X]PcX^]
=4GC;8BC>5B<0AC
28C84BC>2><4B>>=
=Tf3T[WX) CWT2T]caTfX[[
P]]^d]RTcWT]TgcbTc^U!&
RXcXTbU^aUX]P]RX]Vd]STacWT
<^SX6^eTa]\T]cU[PVbWX_
B\Pac2Xch<XbbX^]]TgcfTTZ
D]X^]DaQP]3TeT[^_\T]c
<X]XbcTa<ET]ZPXPW=PXSdbPXS
fWX[TPSSaTbbX]VcWT !cW8]S^
DB4R^]^\XRBd\\XcWTaT^]
CWdabSPh
19?c^STSXRPcT
]PcX^]P[R^d]RX[
\TTcX]Vc^Xcb
XST^[^VdT
?=BQ =4F34;78
JP will dedicate National
Council meeting in
B
Kozhikode, to be held on
September 23-25, to its ideologue Deen Dayal Upadhyay
and along with this Prime
Minister Narendra Modi will
launch a year-long exercise in
his memory.
Modi will touch off
Upadhyay’s 100th birth anniversary celebrations on September
25, the day he was born. “The
meeting will be a tribute to
Deen Dayal Upadhyay. PM will
launch the year-long exercise
and events will be held in India
as well as abroad round the
year,” its General Secretary Arun
Singh said.
The part of Swapna Nagari
in Kozhikode where the party’s
2,000 delegates will stay will be
named after Upadhyay as well.
There will also be an exhibition.
“We are going to ensure
that people get to know of the
greatness of his philosophy
and leadership,” Singh said.
Modi is also scheduled to
address a rally in beach town of
Kerala on Sep 24 while party
president Amit Shah will
address the delegates the next
day when the PM will also give
his concluding address.
]PcX^]%
347A03D=k5A830H kB4?C4<14A %! %
20DE4AH2>=D=3AD<
DVTVddZ`_Zded^R\V 4]bdaT_a^cTRcX^]c^:P]]PSXVPb):´cPZP2<c^9PhP
YRjE?SR_UYe`URj K
:4BCDAE0BD:8Q 14=60;DAD
:D<0A274;;0??0=Q
274==08
amil chauvinists and secesT
sionists had a field day in
Tamil Nadu on Thursday with
a brazen display of anti-India
slogans and an office of the
Indian Oil Corporation in
Chennai coming under attack
under the guise of antiKarnataka protests for Cauvery
waters. The day’s highlight was
an attempt of self-immolation
by an activist belonging to the
Naam Tamilar Party led by
Seeman Sebastian, a Tamil
leader seeking secession of
Tamil Nadu from India. The
activist who tried self-immolation during the demonstration
organised by the outfit was rescued by policemen and admitted to the general hospital.
Major political parties in
the State, barring the
AIADMK, have declared their
support to Friday’s bandh call
given by Cauver y Delta
Farmers to protest against the
intransigent attitude of
Karnataka Government in
releasing Cauvery waters.
People who have planned their
trip to Tamil Nadu on Friday
could face difficulties to reach
their destinations from railway
stations and airports as autos
and share autos are expected to
stay off the roads.
All private schools in the
State will remain closed on
Friday as school managements
have declared a holiday.
AM Vikramaraja, president, Federation of Traders’
Associations of Tamil Nadu,
said that all 21 lakh shops and
business establishments would
remain closed on Friday. The 11
lakh trucks employed to transport essential commodities too
would remain off the roads, said
Vikramaraja. The Tea Shop
Owners Association said all
tea shops across the State would
down the shutters on Friday.
Secessionists made hay with
the 24X7 Tamil news channels
vying with one another in telecasting anti-Karnataka and antiCentre speeches made by them.
With fringe outfits like May 17
Movement and Dravida
Kazhagam, which are known
only as frontal organisations of
the LTTE, too announcing their
support to the general strike,
there is fear among the police
that the strike could turn violent.
Security and Intelligence
agencies were baffled by the
burning of effigies of Prime
Minister Narendra Modi and
Congress president Sonia
Gandhi by the protesters. The
speeches delivered by Seeman
and his associates after staging
the demonstration were antiIndia in nature substantiating the
fears expressed by intelligence
agencies whether the secessionists were hijacking the agitation.
Thursday’s attack on Indian
Oil Corporation office at
Teynampet and the tone of
speeches delivered by MDMK
leader Vaiko lambasting the
Centre for the delay in constituting the Cauvery Management
Board are seen as attempts by
some organisations to beef up
the anti-India feelings in Tamil
Nadu. “The union government
is cheating Tamils in the
Cauvery issue,” alleged Vaiko..
N Kalyanasundaram,
chronicler of Tamil Nadu’s political history, said the agitation in
Tamil Nadu would fizzle out
soon. “How do you expect
Karnatala to release Cauvery
water when there is no water
with them? Let the Tamil Nadu
farmers go to Karnataka and see
for themselves the real state of
affairs in the reservoirs. The agitations and bundhs are all unreasonable,” said Kalyanasundaram.
SL Bhyrappa, noted historian and author based in
Bangalore pointed out that the
demand by Tamil Nadu for
Cauvery water is unreasonable
at this juncture. “The south west
monsoon, the main source of
water for Cauvery has been
weak in 2016. It is almost over
this year. But Tamil Nadu
stands to gain by the North East
Monsoon which is expected to
hit the Tamil Nadu coast by
October. Hence it is unreasonable for Tamil Nadu to demand
for the non-existent water from
Karnataka,” said Bhyrappa.
?^[XRTSTcPX]:P]]PSPPRcXeXbcbX]
PQdbPbcWThfTaTcahX]Vc^T]cTa
cWTAPX[fPhBcPcX^]c^bc^_caPX]b
SdaX]VcWTXa_a^cTbc^eTa2PdeTah
fPcTaXbbdTX]1T]VP[dad^]
CWdabSPh
?C8
arnataka Chief Minister
Siddaramaiah sought protection to Kannadigas and their
properties living in Tamil Nadu
over the State bandh call given
by many Tamil organisations
on Friday. In a letter written to
Tamil Nadu Chief Minister J
Jayalalithaa on Thursday
Siddaramaiah requested her
to ensure protection of lives
and properties of Kannada
speaking people.
He said “I am deeply concerned that certain organisations have called for a bandh in
Tamil Nadu tomorrow. You
would agree that any escalation
of animosity between the two
States would be to the collective
detriment of both the States.”
“I would request you to
kindly take all steps to ensure
that during the so-called bandh
on 16.09.2016, no untoward
incident takes place and the
lives and properties of Kannada
speaking people in Tamil Nadu
are protected,” the release said.
Siddaramaiah also requested her to issue an advisory to
the media to report “responsibly” the incidents relating to the
Cauvery agitation as was done
by his Government.
The bandh has been called
by farmers’ and traders’ bodies
on Friday to protest against the
“violence” targeting Tamils in
Karnataka and seek a longterm solution to the water
sharing issue. It is supported by
DMK, MDMK, PMK, CPI(M),
CPI and other Tamil outfits .
Siddaramaiah said while
the issue of Cauvery water
sharing was being adjudicated
by the courts and looked into
by the Cauvery Supervisory
Committee, no benefit can be
accrued by anyone through
bandhs and agitations.
“We have issued an advisory to the media to report
responsibly the incidents relating to the Cauvery agitation. I
would request you to kindly do
the same.
“I have instructed my
Additional Chief Secretary,
Home and Director General of
Police to be in touch with
your authorities. I would
request you to kindly advice
your officers to be in touch
with their counterparts in
Karnataka,” he said.
Voicing concern over incidents of violence against
Kannada speaking people,
?^[XRTbcP]SVdPaSc^_aTeT]c
_a^:Pa]PcPZPPRcXeXbcbUa^\
T]cTaX]VPcaPX]bcPcX^]c^bc^_
caPX]bX]P_a^cTbcPVPX]bccWT
ad[X]V^Uc^_R^dac^]2PdeTah
aXeTaSXb_dcTX]1T]VP[dad^]
CWdabSPh
0?
Siddaramaiah had on Monday
written a similar letter to
Jayalalithaa asking her to
ensure their safety and protection while assuring her that
interests of Tamils in the state
would also be safeguarded.
It was a mayhem in
Bengaluru on Monday with
dozens of buses and lorries
with Tamil Nadu number plate
being set on fire as mobs let
out their fury over reports of
some incidents of attack on
Kannadigas and their properties in Tamil Nadu. It flared up
soon after the apex court gave
its amended order, directing
Karnataka to release 12,000
cusecs of water daily to Tamil
Nadu till September 20.
Siddaramaiah also assured
Jayalalithaa that Karnataka was
committed to protect the lives
:^[[hf^^Sc^QTPacWT
Qad]c]^CP\X[UX[\b
c^QTbW^f]X]:´cPZP
:4BCDAE0BD:8Q 14=60;DAD
T city Bengaluru and entire
Karnataka is a major market for
ITamil
film industry, popularly
:Pa]PcPZPC=6^ecbSaPfB2
U[PZU^aUPX[daTc^R^]ca^[\^Q
?8>=44A=4FBB4AE824Q =4F
34;78
he Karnataka and Tamil
T
Nadu
Governments
received flak from the Supreme
Court on Thursday for failing
to control the mob frenzy and
destruction to public property
caused by agitators protesting
against the apex court’s order
asking Karnataka to supply
Cauvery water to Tamil Nadu
as an interim arrangement for
the rain-deficit months.
Blaming both State
Governments for the violence
and subsequent damage, the
Bench of Justices Dipak Misra
and UU Lalit said, “People
cannot take law into their own
hands. Hence it is the obligation
on part of both the States to pre-
vent such actions…We are
compelled and constrained to
say that it’s the duty of the State
to see no agitation or destruction or damage to property
takes place.”
The Bench was hearing a
PIL filed by a Chennai-based
social activist P Sivakumar who
argued that what happened in
Karnataka was a clear violation
of apex court’s decision in 2009
where it was the responsibility
of the State Government to prepare a report on the damage
caused to public property and
submit the same to High Court
or Supreme Court. The petition
sought to fix responsibility on
the erring state authorities and
assess damage among other
remedial measures.
The Bench posted the peti-
tion for hearing along with the
main dispute on Cauvery water
sharing coming up on
September 20. At the same
time, the Court was critical of
violent agitation being used as
a means by general public to
protest against a Court order.
It said, “The fundamental
purpose is that there should not
be any kind of agitation when
it relates to an order passed by
this court. Any aggrieved party
is under an obligation to take
recourse to legal remedies for
mitigation of grievance.” The
Court had on September 5
directed Karnataka to release
15,000 cusecs of water per day
to TN but following violent
protests in Karnataka, SC
revised its order and fixed
12,000 cusecs.
and properties of all residents
of Karnataka regardless of their
religion or language”
“I had pointed out to you in
my previous letter of 12.09.2016
that incidents of violence against
Kannada speaking people in
Tamil Nadu would incite passions threatening peace in our
state. Unfortunately, violence
erupted on (Sept) 12th despite
all the precautions taken by us,”
he said. The Karnataka CM said,
however, the situation was
brought under control within
hours and a large number of
cases had been booked against
rioters and strict action taken to
ensure violence did not spread.
“I have also issued strict
instructions to the law and
order machinery to ensure that
such incidents are not repeated,” he added.
known as Kollywood, and the
Cauvery tension between two
neighbours has dented the tinselworld and its market here.
According to sources in the
Karnataka Film Chamber of
Commerce, no new Tamil Films
will be released on this Friday and
in entire Karnataka screening of
Tamil films have been stopped.
A senior official in the
chamber said “Bengaluru is the
only city in Indian where films
from 8 languages are released.
Apart from Kannada, English,
Hindi, Tamil, Telugu,
Malayalam, Konkani, Marathi
films are released in Bengaluru
on every Friday. Karnataka is a
major market for all south
Indian films and also to Tamil
films”. “The tension has affected the release of Tamil Films on
this Friday and hope the issue
will be sorted out soon”, the
source added.
Tamil Films like Sumanth
Radhakrsihanan’s Sadhuram 2,
Trisha’s horror-comedy Nayagi
will not be released this week
in Karnataka. Last week, M
Sasikumar’s Kidaari was
removed from the theatres and
release of Vikram’s Iru Mugan
was also delayed.
Whenever there is a tension between two States, obviously the film industry in both
the States is hurt affecting its
huge market. Many stars have
tweeted for peace and want this
tension to end.
Kannada star Sudeep
tweeted “#RequestPeace.
What’s being damaged is the
peace of ‘our’ State. Yes Justice
needs to be done N I’m sure
there WIL B ways to get there.
Peace pls,” .
“Pls Spread Peace.. Im sure
the concerned will surely do the
best to get justice,tat our State
deserves…,” he added.
“I also hope that at no cost
should this issue jeopardise the
relationship between the people of these two States, who
have coexisted as neighbours. I
hope we are able to overcome
this crisis soon,” Tamil actor
Simbu had said in a statement.
“Let’s seek justice… But not
with such inhuman violence.
It’s painful to see children terrified. PEACE pleassss,” tweeted actor Prakash Raj.
The film industry is interdependent and most of the big
banner Tamil films are simultaneously released in Tamil
Nadu and Karnataka.
Rajanikanth or Kamala Hassan
all of them are equally popular here. These stars have no
borders and should play the
messengers of peace.
The State-wide bandh over
the Cauvery issue on September
9 forced many Tamil Films to
be withdrawn from the theatre
across the State.
³6XP]cZX[[Ta´CPaX`7P\TTS:PaaP D`f^jRcRaV^fcUVc+D4gVcUZTedY`T\d<VcR]R
7TPacQaTPZX]VbPhbeXRcX\³b
aTbXV]bUa^\?Pa[XP\T]c?3? I
\^\*6^ecc^UX[TaTeXTf_[TP
EA90H0A09Q :>278
<>78C:0=370A8Q 90<<D
ne of the founding members of Peoples Democratic
O
Party (PDP) and sitting
Member of Parliament from
Srinagar Parliamentary constituency, Tariq Hameed Karra,
often labelled as ‘giant killer’
ever since he defeated National
Conference patriarch Dr
Farooq Abdullah in the 2014
Lok Sabha polls, dealt a body
blow to Mehbooba Mufti-led
alliance Govt in the State on
Thursday by announcing his
resignation from the primary
membership of the party and
Parliament.
Feeling suffocated and outraged over the manner in which
the PDP-BJP alliance Govt was
handling the ground situation
in the aftermath of killing of
Hizbul Mujahideen commander Burhan Wani, the former
State Finance Minister, also
considered Mufti Mohd
Sayeed’s blue eyed boy, told the
media in Srinagar, “I am resigning from Parliament and the
primary membership of the
PDP against the brutal policies
of BJP at Centre and State
Governments complete sellout and surrender before them.”
Karra had earlier raised
banner of revolt against the
decision of top brass of the
party to form an alliance Govt
with the BJP in the State. Soon
he had to eat a humble pie as
he himself accompanied party’s
senior MP Muzaffar Hussain
Baig along with Mehbooba
Mufti to stake claim for the formation of PDP-led alliance
Govt in the State.
Addressing a Press conference in Srinagar, Karra said,
“Locking sufi shrines and
mosques on Eid was a defining
moment for me to take the final
call.” Appealing to all other
MPs, MLAs and MLCs to
resign, he said, “I leave it to their
conscience to decide whether
they would like to side with
helpless people or let the bloodshed be perpetuated by the
RSS-backed BJP and facilitated
by the PDP”.
Reading out a lengthy
statement, Karra said, “For the
last more than a year, people are
asking him questions to which
he has no answer. They are asking about the human rights, selfrule, return of power projects,
resuming talks between India
and Pakistan, and the fate of
political slogans. What happened to the party’s slogan of
Grenade se na goli se, baat
banaygi boli se? What happened to the philosophy of battle of ideas, which has turned
into battle against ideas today?”
He said his party was
protesting the closure of
mosques on Fridays and now it
is doing the same and in fact
going beyond. He said various
mosques and shrines were literally locked by the Government
to prevent people from praying
on Eid. He said his party was
against the pellets but when it
assume power it started using
more lethal ammunition on
people. “My head would go
down in shame on all these
questions as I have no explanation to offer to these just queries.”
Asked why he proposed
Mehbooba’s name as party
leader that eventually led her to
become the CM, Karra said he
had no choices, “I only preferred
a lesser evil.”
Another senior Parliamentarian and former Dy CM
Muzaffar Husaain Baig had
also suggested Mehbooba to
resign within next six months
if she failed to implement the
‘Agenda of Alliance’ agreed
upon by the PDP-BJP.
Reacting to Karra’s resignation, PDP general secretary
Nizamuddin Bhat said, “It is
unfortunate that he has
resigned. He should have discussed the crisis with the party.”
The National Conference
on Thursday said the resignation of Karra reflected the
gravity of situation in Kashmir
and scale of “disaffection” for
PDP’s “complete sell-out”.
“Tariq Karra’s resignation
reflected the gravity of the situation in Kashmir and also the
enormity and scale of disaffection — both against PDP and
within PDP — for its complete
sell-out,” said NC spokesperson
Junaid Mattu in a statement.
“The NC has not asked for
the dismissal of this State Government, nor have we asked
Mehbooba Mufti to resign.
These calls are coming from the
topmost leaders in her own
party and it is for her own conscience to decide what she would
like to do. What lessons she
draws from Karra’s resignation is
a matter of her own conscience
and morality,” said Mattu.
In Jammu, historian Prof
Hari Om told The Pioneer,
Karra’s resignation, which was
expected, has left the BJP with
no other option but to either
implement the divisive and
pro-Pakistan agenda agreed
upon in PDP-BJP agenda of
alliance or come out of the
Government.
t was with shock and disbelief that Kerala on Thursday
received the news of the
Supreme Court’s verdict that
set aside the death sentence
awarded to the convict,
Govindachamy, by the trial
court and ratified by the High
Court in the sensational case
pertaining to the brutal rape
and murder of 23-year-old
Soumya in February, 2011.
“The verdict is heartbreaking,” said Sumathy, mother of Soumya, through sobs and
tears. Stating that such a verdict
came from the apex court only
because the lawyers engaged by
the State Government handling the case were not good at
arguments, Sumathy said, “We
did not get justice. I will continue my struggle for justice.”
According to the three-judge
Supreme Court Bench which set
aside the death sentence, the
Prosecution had not been able to
produce sufficient evidence to
prove the charge of murder
against Govindachamy, a handicapped Tamil Nadu native, and
he deserved the benefit of doubt.
The State Government said it
would file a review petition in the
apex court.
The apex court said in the
21-page judgement that it was
not interfering with the imprisonment, awarded by the trial
court — and confirmed by the
High
Court
—
to
Govindachamy, who had challenged the death sentence
through an appeal, for rape,
theft, trespassing and other
proven charges.
Govindachamy
was
accused of brutally raping
Soumya, hailing from Shoranur
in Palakkad district, in a deserted ladies compartment of the
Ernakulam-Shoranur
aside the death sentence. “The
verdict would have been different if lawyer A Suresan
(who was Special Prosecutor in
the case in the trial court) had
argued the case in the Supreme
Court,” she added.
A political war broke out
in the State on Thursday over
the apex court verdict with the
Congress accusing the
CPI(M)-led LDF Government
of failing to handle the case
properly. The CPI(M) and the
Government denied the charge
pointing out that it was the
tions were held at several places
in the State by the Yuva Morcha
and the Youth Congress in
protest against the verdict.
Effigies of Chief Minister
Pinarayi were burned by the
protestors in many places.
Dr Sherly Vasu, who had
overseen the postmortem of
Soumya’s body, insisted that
she was pushed out of the train
by Govindachamy himself.
According to BA Aloor, counsel for the accused, Soumya
had been denied justice.
“Soumya would have got jus-
C746>E4A=<4=CF>D;358;40
A4E84F?;408=C740?4G2>DAC
0=34=BDA4C7474;?>54558284=C
;0FH4AB5>A64CC8=69DBC8245>A
C74E82C8<´B50<8;H
Passenger train and murdering
her by pushing her out of the
slow-running train on the night
of February 1, 2011 at a place
just a few kilomentres away
from her native village.
Soumya was admitted to
the Government Medical
College Hospital, Thrissur in a
critical condition. She died on
February 6. The Fast Track
Court-1 in Thrissur awarded
death
sentence
to
Govindachamy, who was
arrested on February 2, on
November 11, 2011 for murder
and the High Court upheld that
verdict on December 7, 2013.
Amidst arguments in the
case on September 8, the
Supreme Court had observed
that the Prosecution did not
have evidences to establish that
Govindachamy himself had
murdered Soumya by pushing
her out of the running train.
Chief Minister Pinarayi
Vijayan said on Thursday that
the Government would file a
review plea in the apex court
and ensure the help of efficient
lawyers for getting justice for
the victim’s family while State
Congress president VM
Sudheeran said the verdict
had literally shocked Kerala.
State BJP chief Kummanam
Rajasekharan also termed the
verdict as unfortunate.
Soumya’s mother said it
was the Prosecution lawyers’
inefficiency and not the
absence of evidences that had
prompted the court to set
° 2<?8=0A0H8E890H0=
previous UDF Government
which had constituted the
team of government’s lawyers
for case in the Supreme Court.
Former Chief Minister
Oommen Chandy, during
whose tenure the lawyers’ team
for handling the case in the apex
court was constituted, accused
the present Government of
committing grave mistakes by
not ensuring discussions
between that team and lawyer
Suresan before the case came up
in the Supreme Court.
Law Minister AK Balan
rejected the charge saying that
Suresan had not provided help
despite the legal team’s requests.
At the same time, demonstra-
BcPcT2^]V_aTbXST]c
E<BdSWTTaP]bPXScWT
eTaSXRcWPS[XcTaP[[h
bW^RZTS:TaP[P
BcPcT19?RWXTU
:d\\P]P\
APYPbTZWPaP]P[b^
cTa\TScWTeTaSXRc
Pbd]U^acd]PcT
tice if the police had investigated the case properly and
honestly and collected actual
evidences.
]PcX^]&
347A03D=k5A830H kB4?C4<14A %! %
8f[3;ASR_\d`_ScR_U ?^[XcXRXbPcX^]^U_^[XRT
QTWX]S[PfP]S^aSTa
>`UZafS]ZTZdVdYZdRaa _a^Q[T\bX]D?)APY]PcW
=0H0=30E4Q 60=378=060A
n the poll-bound Gujarat
where Patidar and Dalit agitations are continuously simmering, the ruling BJP is
resorting on its biggest brand
— Narendra Modi.
Both Dalit and Patidar agitations are being led by two leaders in their early twenties —
Jignesh Mevani and Hardik
Patel. To counter them, State BJP
leadership is aggressively promoting Prime Minister Narendra Modi’s mobile application.
In order to make BJP Yuva
Morcha’s workers conversant
with the Modi’s mobile app, a
booth has been erected at the
State BJP headquarters ‘Shree
Kamalam’ on the outskirts of
State capital Gandhinagar to
make them acquainted with the
mobile application. Sources in
the BJP said that these trained
workers would meet youngsters
in different educational institutional and encourage them to
connect with Modi.
I
Even Gujarat Chief
Minister Vijay Rupani too promoted the app saying that it
would be a great opportunity
for the people to connect and
greet the Prime Minister
through ‘Narendra Modi App’
on his birthday.
Meanwhile, the Prime
Minister is arriving Gujarat
on Friday late in the evening to
celebrate his 66th birthday in
his home-State and to take
blessings of his mother Hira Ba.
According to official protocol,
Modi is expected to arrive at
Ahmedabad airport at around
11 pm and straight away drive
down to Raj Bhavan in
Gandhinagar where he will
have night stay.
On September 17, Modi
will begin the day by visiting his
younger brother Pankaj’s home
to take blessings of nonagenarian Hira Ba around 8.30 am.
After touching feet of mother,
Modi would return to Raj
Bhavan and will have important meeting with State BJP
functionaries — including
Chief Minister, Ministers and
important office-bearers of the
Gujarat BJP.
After the meeting, he
would travel to Limkheda near
Dahod town in central Gujarat
to inaugurate an irrigation project and address a huge gathering of tribal people. Post
tribal rally, the Prime Minister
would again fly to South
Gujarat town Navsari and
address Samajik Adhikarita
Shibir around 4.50 pm. Post
this function, he would reach
at Surat airport and travel back
to Delhi by an Indian Air
Force aircraft.
Sources in the Gujarat
Administrative Department
(GAD) said that Modi would use
road routes from Ahmedabad to
Gandhinagar on Friday and to
reach at his brother’s place on
Saturday morning. For
Limkheda in Central Gujarat
and Navsari functions, the Prime
Minister would travel by helicopter, said the official source.
Ballia (UP): Union Home
Minister Rajnath Singh on
Thursday held “politicisation”
of the police force responsible
for law and order problems in
Uttar Pradesh.
“Police should not be misused for political purposes. It
is capable of handling big criminals. For development, law
and order is a must. Due to
politicisation of force, law and
order problems rise,” he said.
On the ongoing dispute in
the Samajwadi Party, Rajnath
said, “There is a law and order
problem
in
the
SP
Government, and the dispute is
affecting the common man.”
The Union Minister
claimed, the State Government
should give accounts of the
huge amounts of money it
received from the Centre for
natural calamities.
Exuding confidence on
BJP’s victory in the election
next year, Rajnath said the
party was given “sanyas” in
CWTaTXbP[PfP]S
^aSTa_a^Q[T\X]cWT
B?6^eTa]\T]cP]S
cWTSXb_dcTXbPUUTRcX]V
cWTR^\\^]\P]
2002 by the State’s people, now
after “14 years of exile” it will
return to power.
“It is a matter of pride that
in over two years (at the
Centre) no one could charge
any Minister with corruption,”
he said.
Rajnath was here to attend
a function on death anniversary of former MP Harikewal
Prasad.
PTI
6YWXdgYdXY^C@cVYbcdVQ]Y\iTeUd_ CRZ_WRZ]de`UR^aV_
cU\VYcX^UUTc^_dXY^WU\cU*=QiQ daZcZed`W8R_VdY
UVg`eVVdZ_9jUVcRSRU
C
?=BQ ;D2:=>F
alling the ongoing feud
within the Yadav family as
a well-orchestrated drama to
divert public attention from the
failure of the SP Government,
Bahujan Samaj Party (BSP)
chief Mayawati on Thursday
advised SP chief Mulayam
Singh Yadav to “shun love for
his son” and “to quit politics as
it is the right time to retire”.
“It is better for the people
of UP and best for the State that
Mulayam Singh quits politics.
The fight within the SP’s first
family is due to selfish needs
and nothing else,” she said.
She claimed there are
dozens of people in the Yadav
family who are active in politics and all have their ‘own personal interests’.
“Reports of intra-family
feud keep on emanating from
time to time. But at election
time, it seems to be a well
thought out script to divert
public attention,” she asserted.
In a statement released
after addressing a meeting of
senior leaders at the State BSP
headquarters in Lucknow on
Thursday, Mayawati said that
the SP Government has failed
in all sectors and now by pretending that there was a family dispute, the SP was only trying to deflect attention of the
masses.
“The extraordinary love
for his son by the SP chief is
damaging the State and hence
he should retire from politics,”
she added. “The development
of UP during the SP regime is
merely on papers or through
advertisements by misusing
public funds. Law and order in
the state has worsened while
all development works havecome to a standstill,” she
alleged.
><4A50A>>@Q 7H34A0103
mid tight security arrangements thousands of Idols
A
of Lord Ganesh were
immersed in Hussain Sagar
and 12 other lakes of
Hyderabad as the 11-day long
Ganesh Chaturthy festival
came to an end on Thursday.
Heavy downpour which
brought the city to a grinding
halt from this morning failed to
dampen the spirits of the devout
as massive number of people
turned up to bid the adieu to the
elephant-faced God.
Khairatabad Ganesh,
tallest in the city with a height
of 58 feet was among the first
to be immersed in Hussain
Sagar.
Usually this used to be the
last big idol to be immersed
every year this time organisers
agreed to be first for the convenience of the people. Police
officials wanted the routine to
be changed as last year it was
immersed on the second day
creating massive jam creating
serious problems for the office
bearers.
Arrangements for putting
the 58 feet gigantic idol on a
special open trucks had started around midnight last night
and the procession started
early in the morning despite
heavy rain. Finally it reached
Tank bund around 1 pm and a
huge crane immersed it in the
lake at 1:50 pm.
Meanwhile, the Balapur
Ganesh procession started at
around 11 am and crossed the
historic Mecca Masjid
Charminar complex at around
4 pm.
Now it was moving
towards Moazzam Jahi Market.
Thousands of idols of
other areas have also joined the
procession at different points
including Charminar and
Moazzam Jahi Market.
The never ending line of
the heavy trucks carrying
colourful idols in various sizes
and shapes and the huge gathering of onlookers brought
the normal flow of traffic to a
full stop. The arterial road
from Charminar to the
Hussainsagar lake was barricaded on either aides and
other vehicles were not
allowed.
Hyderabad City Police
Commissioner M Mahinder
Reddy said that the procession
was so far peaceful and no
untoward incident was reported from any where.
3Te^cTTbX\\TabX]V;^aS6P]TbWXS^[bPc6XaVPd\2W^f_PcchX]<d\QPX^]CWdabSPh
?C8
0XPEDLNDUVELGHPRWLRQDO
DGLHXWR/RUG*DQHVK
C=A06C7D=0C70Q <D<108
akhs of Mumbaikars were
in their element on
L
Thursday as they joined most
colourful Ganpati idol immersion processions to bid an
emotional goodbye to the elephant-headed God after the 10day-long festivities, amid loud
but rhythmic drum beats and
chants of “Ganpati bappa
morya, pudhchya varshi lavkar
ya” (Hail Lord Ganesh, do
come back early next year).
With the Island city and its
suburbs having come under
thick security blanket, the
major Sarvajanik Ganesh idols
— including Mumbai’s prestigious Lalbaugcha Raja
Ganapati idoli and “Mumbai
Cha Raja” — made their way
through their from Lalgau in
south central Mumbai and
passed through Sane Guruji
Marg, Byculla west, Nagpada,
Suthar Galli, CP Tank, VP
road, Opera House, before
reaching the Girgaum
Chowpatty in south Mumbai at
around 9 pm.
Both the major Ganpathi
idols, which had left Lalbaug at
around 11.30 am, took more
than nine and a half hours
before they reached the
Arabian Sea waterfront of
Girgaum Chowpatty, where
the immersions of small and
big Ganesh idols had begun
earlier in the afternoon.
Like every year, various
State-Central Government,
civic agencies, Ganpati Mandals
and voluntary organisations
including the city police, BMC,
Navy and Coast Guard, had
made elaborate arrangements to
ensure the smooth conduct of
the immersion proceedings,
which was slated to go on till
the small hours of Tuesday.
In an effort to ensure
against any untoward incident
in the Ganapati immersion
procession routes, the Mumbai
police had set up CCTV cameras at strategic places
As many as 44,000-odd
police personnel, 1o companies
of State Reserve Police (SRP),
two companies of Rapid Action
Force (RAF) personnel and
Indo-Tibetan Border Police
(IRBP) personnel and 100
home guards were deployed
along the procession routes
and at the various immersion
sites. As many as 7,000 BMC
employees were present at various natural and artificial
immersion venues.
Informed sources that as
many as 12,000 huge idols
installed by as many Sarvajanik
Mandals and at least 2,20,000
domestic idols were immersed
at 69 natural and 31 artificial
immersion spots this year
Like every year, there was
a huge turnout of people at various other immersion sites
across the city, including Dadar
Chowpatty, Juhu Chowpatty,
Marve beach, Madh Island,
Powai lake, Madh Island,
Manori
Beach,
Gorai
beach,Mahim beach, Aarey
lake, the Mithi River, its
branches and various artificial
lakes.
The Indian Coast Guard
(ICG) had made elaborate
arrangements as part of its
“Operation Utsav” for’ for pro-
viding seaward security and
safety cover to the people
Mumbai during Ganesh
immersion “We had deployed
on helicopter, on hovercraft, a
fast patrol vessel and interceptor boat for carrying out random patrols during the immersion day. We are being extra
vigilant and provide surveillance against seaward threats
and assisting civil authorities
during Ganpati Visarjan,” ICG
spokesperson Commandant
Sujeet Dwivedi said.
On their part, the Mumbai
police had set up as many 58
control rooms set up at major
waterfronts, including Girgaum
and Dadar chowpatties to keep
a close watch of the proceedings. The BMC had kept in
readiness at least 600 life guards
and 81 motor boats to ensure
against any mishap during the
immersion proceedings.
Maharashtra chief minister
Devendra Fadnavis Fadnavis
carried en eco-friendly Ganpati
idol installed at his official
residence “Varsha”at Malbar
Hills and immersed it in an
artificial lake created near the
Mayor’s bungalow at Shivaji
Park in north-central Mumbai.
Though drowning cases
are a common feature on the
immersion day every year, the
BMC’s disaster control room
late on Thursday night that no
mishaps had been reported
from any part of the city.
Meanwhile, the city traffic
police had closed several major
roads across the city for traffic,
to ensure smooth passage of
Ganpati processions through
their designated routes.
^_X]X^]'
347A03D=k5A830H kB4?C4<14A %! %
gggTQY\i`Y_^UUbS_]
aRaVchZeYaRddZ`_
AR\ZdeR_^fdeR_dhVc
,QGLDGRHVZHOOWRUDLVH3R.%DORFKLVWDQDW81
aX\T<X]XbcTa=PaT]SaP<^SXfPb`dTbcX^]TSQhbRT_cXRbfWT]WTaPXbTS
cWT XbbdT ^U Wd\P] aXVWcb eX^[PcX^]b X] ?PZXbcP]^RRd_XTS :PbW\Xa P]S
1P[^RWXbcP]SdaX]VWXb8]ST_T]ST]RT3Phb_TTRWCWThbPXSXcfPbP]PccT\_c
c^SXeTac_dQ[XRPccT]cX^]Ua^\cWT6^eTa]\T]cb²UPX[daTc^R^]cPX]cWTd]aTbc
X]:PbW\Xa*P\TaTcXcU^acPcU^a?PZXbcP]bR^]bcP]c]TTS[X]V^U8]SXP*P]ScWPc
Xcf^d[SSP\PVT8]SXPbRPbTX]cTa]PcX^]P[[h^]:PbW\Xa8]bW^accWThR[PX\TS
?aX\T<X]XbcTa<^SXfPb_PhX]V[X_bTaeXRTc^cWTRPdbT^U1P[^RWXbcP]P]S?^:
CWXbWPbcda]TS^dcc^QT\Xb_[PRTSRaXcXRXb\CWT6^eTa]\T]c^U8]SXPWPbcPZT]
cWT]TgcbcT_X]fWPcXbPR[TPa[hSTUX]TSbcaPcTVhc^X]e^ZTcWT_[XVWc^UcWT_T^
_[T^UcWTcf^aTVX^]bQhaPXbX]VcWT\PccTaPccWTD=7d\P]AXVWcb2^d]RX[
X]6T]TeP1hcT[[X]VcWT2^d]RX[cWPc?PZXbcP]fPbdbX]VbcPcT_^fTac^bd_
_aTbbcWTPb_XaPcX^]b^U_T^_[TX]1P[^RWXbcP]P]S?^:8]SXPT]e^h0YXc:d\Pa
WPbbW^f]cWT\Xaa^ac^8b[P\PQPS7TQ[d]cTScWTR^]bcP]caTUaPX]Ua^\?PZXbcP]
^eTaP[[TVTSWd\P]aXVWcbeX^[PcX^]bQh8]SXP]bTRdaXchU^aRTbX]9P\\d:PbW\Xa
QhaT\PaZX]V°8cfX[[QTX]cWTUXc]Tbb^UcWX]VbXU?PZXbcP]U^RdbTbXcbT]TaVXTb
^]X\_a^eX]VcWTWd\P]aXVWcbbXcdPcX^]fXcWX]?PZXbcP]P]S?^:±FTRP]aTP
b^]PQ[hQTbdaTcWPccWXbXbYdbccWTQTVX]]X]V8]SXPP__TPabSTcTa\X]TSP]S
aXVWc[hb^c^d_cWTP]cTP]S]P\TP]S
bWP\T?PZXbcP]X]UdcdaT^]cWTbTcfX]
XbbdTbPcTeTah_^bbXQ[TV[^QP[U^ad\
8c Xb ^] UXa\ Va^d]S WTaT bX]RT cWT
_T^_[T^U?^:P]S1P[^RWXbcP]WPeT
^_T][h aTQT[[TS PVPX]bc 8b[P\PQPSb
PdcW^aXcPaXP]Xb\CWTaTXb]^R^\_Pa
Xb^]QTcfTT]cWTSTeT[^_\T]cbX]9:
P]SX]1P[^RWXbcP]P]S?^:9P\\d
:PbW\XaWPbPST\^RaPcXRP[[hT[TRc
TS 6^eTa]\T]c cWa^dVW P UPXa P]S
caP]b_PaT]c_a^RTbbfWXRWWPbQTT]
PRZ]^f[TSVTScWTf^a[S^eTa8cWPb
Pa^Qdbc\TRWP]Xb\c^cPRZ[TVaXTe
P]RTb^UcWT_T^_[TCWTaTXb]^bdRW
bhbcT\_aTeP[T]cX]1P[^RWXbcP]P]S
?^:ATbXST]cb^U?^:aTRT]c[hc^^Z
c^ cWT bcaTTcb c^ _a^cTbc PVPX]bc
aXVVTS T[TRcX^]b fWX[T cW^bT X]
1P[^RWXbcP]WPeT]TeTaQTT]cad[hX]cT
VaPcTSX]cWT?PZXbcP]X\PX]bcaTP\
CWXbbcaPcTVhbW^d[SWPeTQTT]bWP_TSP]SX\_[T\T]cTShTPabPV^CWT_aT
eX^db2^]VaTbb[TSD?06^eTa]\T]cfPbc^^\TTZc^PS^_cbdRWPQ^[SSTeX
PcX^]Ua^\PfT[[ca^SST]_PcWcWPcWPS[TSdb]^fWTaT2^d]cTaX]V?PZXbcP]b
^UUT]bXeT Qh cWa^fX]V Pc Xc cWT Pca^RXcXTb Xc WPb QTT] R^\\XccX]V X] ?^: P]S
1P[^RWXbcP]fPbR^]bXSTaTSaXbZh2^]eT]cX^]P[fXbS^\fPbcWPcXcf^d[SbcaT]VcW
T]?PZXbcP]bRPbTeXbveXb 9:P]ScWPcXcf^d[S\PZT\PccTabf^abTU^a=Tf
3T[WX1dcfWPcf^abTRP]?PZXbcP]S^]^f.BX]RT_PacXcX^]XcWPbcaXTSc^b]PcRW
cWTaTVX^]PfPhcWa^dVWR^]eT]cX^]P[fPabP]SQh^cWTa\TcW^SbbdRWPbX]UX[
caPcX]V8]SXPfXcWbcPcTb_^]b^aTS\X[XcP]cb
8]P[[cWTbTSTRPSTb8]SXP]TeTaaPXbTScWT1P[^RWXbcP]XbbdTfXcW8b[P\PQPS
]^aSXSXcQaX]VXcd_^]X]cTa]PcX^]P[_[PcU^a\b0]ShTc?PZXbcP]WPbaT_TPc
TS[hPRRdbTS=Tf3T[WXfXcW^dc_a^eXSX]VTeXST]RT^U8]SXP]X]e^[eT\T]cX]
cWT1P[^RWd]aTbc8]SXPcWTaTU^aTWPS]^cWX]Vc^[^bTP]STeTahcWX]Vc^VPX]
Qh_X]]X]V?PZXbcP]^]cWT\PccTa=^fXc\dbcUPe^daPQ[hR^]bXSTaaT`dTbcb
U^aPbh[d\Ua^\RaTSXQ[T1P[^RW[TPSTab
?
EYZ_\YVR]eY_`ea`]ZeZTd
'HOKLIDFLQJFULVLVVWRSVFRULQJSHWW\SRLQWV
WTR^\X]Vc^P]T]S^UcWTQ[P\TVP\T^eTacWTWP]S[X]V^UeTRc^aQ^a]T
SXbTPbTb[XZTRWXZd]Vd]hPP]SST]VdTX]3T[WXfX[[W^_TUd[[hbcaTP\[X]TP]S
UPbcU^afPaScWTcaTPc\T]c^U_PcXT]cb0d]XcTSfPa[Pd]RWTSQhcWT3T[WX
6^eTa]\T]cX]R^\_[TcTR^^_TaPcX^]^UcWT2T]caTP]ScWT;XTdcT]P]c6^eTa]^a
;6^U3T[WXfX[[aT[XTeTeXRcX\bP]S^aSX]PahRXcXiT]b^UcWTRP_XcP[P]SPSY^X]
X]VPaTPb^UcWTRXchCW^dVWPbTT\X]V[h[^]VcdV^UfPaQTcfTT]cWT;6P]S
cWT0aeX]S:TYaXfP[6^eTa]\T]cWPbbWXUcTScWTU^RdbUa^\cWTX]RaTPbX]VWTP[cW
\T]PRThTccWTRdaaT]cRWP]VTX]PccXcdSTP\^]VcWTc^__^[XcXRP[Ud]RcX^]Pa
XTbRP]QTaTVPaSTSPbP_^bXcXeTbXV]P[Pc[TPbcU^acWTbPZT^UUXVWcX]VcWTSaTPS
TS\^b`dXc^Tb8cXbV^^ScWPcX]bcTPS^UcWTTPa[XTa_PbbX]VcWTQdRZPdcW^aX
cXTbWPeTQTVd]cPZX]VcWT\dRW]TTSTSPRcX^]8]STTSXcXbcWTRXch³b\d]XRX
_P[R^a_^aPcX^]bcWPc\dbcT]bdaTcWPccWT_aX\PahWTP[cWRPaTUPRX[XcXTbPaT\PST
aTPSX[hPePX[PQ[TU^aX\\TSXPcTcaTPc\T]c^URWXZd]Vd]hPeXadb278:EFXcW
\^aTcWP] STPcWbP]S^eTa _T^_[TaT_^acTS[hbdUUTaX]VUa^\cWTeTR
c^aQ^a]TSXbTPbTcWT\d]XRX_P[R^a_^aPcX^]bP[^]VbXSTcWT3T[WX6^eTa]\T]c
\dbcbTTc^XccWPccWT_a^Q[T\S^Tb
]^cb_aTPSUdacWTa
8cXbSXbWTPacT]X]Vc^[TPa]cWPccWT
3T[WX6^eTa]\T]cad]W^b_XcP[bPaT
]^cT`dX__TSfXcWcWTRaXcXRP[²aTeTabT
caP]bRaX_cX^]_^[h\TaPbTRWPX]aTPR
cX^] AC?2A UPRX[XcXTb U^a cTbcX]V
fWXRWRP]WT[_\TPbdaTcWTeXaP[[^PS
X] bTad\ bP\_[Tb ^U cWT _PcXT]cb
CWdbcWTAC?2ARP]QTdbTSUdacWTa
Pb P c^^[ U^a UPbcTa STcTRcX^] ^U cWT
278:EP]S\^]Xc^aX]VcWTb_aTPS^U
cWTaT_[XRPcX^]^UcWTeXadbX]^cWTaed[
]TaPQ[TcPaVTcb0b278:EXbP\^b
`dXc^caP]b\XccTSP[_WPeXadbRPdbTS
\PX][hQhcWT0TSTb PTVh_cXcWTb_T
RXP[U^VVX]V_a^VaP\\Tba^[[TS^dcQh
cWT \d]XRX_P[ R^a_^aPcX^]b X] TPRW
fPaS^UcWTRXchfX[[QT^UVaTPcWT[_
U^a_aTeT]cX]VcWT\T]PRT0SeXb^aXTb
XbbdTSc^cWTRXchbRW^^[bU^aX]bcadRcX]VRWX[SaT]c^fTPaUd[[b[TTeTb\Ph[TbbT]
cWT]d\QTa^URPbTbP\^]VcWT\PbcWThPaT\^aTed[]TaPQ[Tc^bdRWSXbTPbTb
cWP]cWTT[STab
8cXb]^ccWPccWT278:EcTaa^aWPbR^\Tc^cWTRXchU^acWTUXabccX\T1PbXR
WTP[cWRPaTUPRX[XcXTbX]RXchW^b_XcP[b_PacXRd[Pa[hPccWT_dQ[XRW^b_XcP[bbX]RTcWTh
PaTUaT`dT]cTSQhcWT\^bc]TTShbW^d[SWPeTQTT]P[aTPShd_VaPSTSc^cPRZ
[TcWTbP\TFWhXbcWTaTbdRWR^]cX]dTSP_PcWhc^fPaSbcWT\PX]cT]P]RT^U
cWTRXchP]ScWT_dQ[XRWTP[cWUPRX[XcXTb.FWhS^fTR^\_[PX]P]SPRc^][hfWT]
P]T\TaVT]RhbXcdPcX^]bcaXZTbdb.CWT6^eTa]\T]cbW^d[S]^c]TV[TRc_dQ[XR
W^b_XcP[bX]cWTW^_TcWPc_aXePcT^]TbfX[[S^cWT]TTSUd[<TP]fWX[T_T^_[T
\dbcQT\PST\^aTPfPaTPQ^dccWTbh\_c^\b^UcWTbTSXbTPbTbP]ScWTh\dbc
ST\P]SQTccTaUPRX[XcXTbPc[^RP[WTP[cWRT]caTbfWXRWcWThRP]P__a^PRWX\\T
SXPcT[hCWdbQ^cWPfPaT]TbbP]SPST`dPcTWTP[cWRPaT\dbcR^\Tc^VTcWTaX]
cWTRP_XcP[RXchUXabc
C
3RSXOLVWUHYROWQRWGXH
WRJOREDOLVDWLRQLPSDFW
0;;8BC4A740C7
CWTfT[UPaTbcPcTbX]WTaT]cSTUTRcb\TP]cWPc_T^_[TUTT[RPdVWcd_X]P7^QQTbXP]fPaU^aaTb^daRTb1dccWT
\XSS[TR[PbbTbbW^d[SSXaTRccWTXaXaTc^fPaSb_^[XcXRXP]bP]SRT]caP[QP]ZTab]^cUaTT\PaZTcb^acTRW]^[^Vh
t’s a story we have all
become familiar with, a
facile narrative that we
keep being told explains
everything from the rise of
Donald Trump to Brexit. It goes
something
like
this:
Globalisation, technology and
capitalism have helped the highly educated; the welfare state has
bailed out the poor; but the middle classes have been hammered
and hollowed out. Their old jobs
are gone, replaced by precarious,
lower paid roles, and their living
standards are stagnating, at best,
and in free fall, at worst.
The result has been a rebellion: Millions of blue and white
collar workers are backing populist candidates across the
Western world. The new conventional wisdom is that if the
Centre-Left and Centre-Right
are to have a future, they must
dilute their support for free
trade, tax the rich to “redistribute” the proceeds of globalisation and embrace new forms of
industrial policy.
There’s just a problem: This
explanation is completely wrong.
The supposed facts mentioned are almost all the reverse
of the truth. Capitalism and
globalisation are still working —
for the many, not just the few.
The middle classes in the UK and
America are getting richer again.
Inequality is diminishing. There
are many problems, of course, but
they are primarily down to the
fact that the impact of the Great
Recession ended up dragging
on for years, with the previous
misallocation of resources and
capital wiping out a decade’s
worth of productivity gains.
Three important pieces of
evidence published this week
confirm that we would be mad
to give up on capitalism. The
first was the news that American
workers — including the country’s vast middle class — have
enjoyed their best pay rises
since 1965. Last year’s 5.2 per
cent rise in real median household income is the largest rise
ever recorded. Remarkably, it
was the best ever increase for all
income deciles apart from the
top 20 per cent of earners. The
bottom 10 per cent saw their
income surge by 7.9 per cent; the
top 10 per cent by 2.9 per cent.
Income inequality on the Gini
index has slumped over the last
two years: America is becoming
more equal, not less. The middle class is expanding, and the
poverty rate fell from 14.8 per
cent to 13.5 per cent, its biggest
I
drop since 1968.
The figures still show that
median incomes are lower than
they once were, and had already
reached their present level first
in the late Eighties and then in
the Nineties. However, with the
median household income today
just 2.4 per cent lower than its
1999 peak, it’s now all to play for,
with a return to genuine income
growth finally on the cards. The
reality is that the official data is
probably too pessimistic: the
median American lives in a bigger house and has access to a
myriad of goods and services
that didn’t exist 30 years ago. It
is hard to believe that living
standards have genuinely stagnated for so long, despite higher healthcare costs.
The second piece of the puzzle came from the Resolution
Foundation. In a remarkable
piece of work, Adam Corlett, an
economist, has demonstrated that
it isn’t true that low and middle
incomes in the rich world have
stagnated. His main target is the
‘elephant curve’ theory of globalisation proposed by Christoph
Lakner and Branko Milanovic.
9Q]^_dcSQbUT_V
Q^iXYWXS_]]Q^T
9QSSU`dUTdXU
3U^dbUµcc`USYQ\
`QS[QWUV_bdXU
W__T_VdXUCdQdU
1^TXbQ@bQTUcX3=
°3XQ^TbQRQRe
>QYTe
2>A;4CC70B
2AD=2743C74
=D<14AB0608=
0=35>D=3C74<
F0=C8=674
34<>=BCA0C4B
C70CC74<833;4
2;0BB4B=>C9DBC
C7478674BC>5
40A=4AB70E4
3>=4F4;;8=
<0=HA827
2>D=CA84B
Dubbed “the most powerful
chart of the last decade”, it looks
like an elephant with its trunk
sticking upwards, and is supposed to represent the income
gains made by the world’s population between 1988 and 2008. The
very poor — the bottom of the elephant’s tail — didn’t gain much,
the citizens of the high growth
emerging economies — the elephant’s back — did well, and the
Chinese — the top of its head —
jumped ahead. But the Western
middle class — the lower part of
the trunk – stagnated — while the
global top 1 per cent — the top of
the trunk — did wonderfully.
Geeks love this sort of stuff.
But Corlett has crunched the
numbers again, and found them
wanting. He demonstrates that
in fact the middle classes, not
just the highest of earners, have
done well in many rich countries. All income groups have
progressed dramatically since
the late Eighties in the UK; and
they have also done reasonably
in countries such as France,
Spain and Italy, though their
weaker GDP growth was translated into commensurately lower
B>D=318C4
income growth. There has been
no universal hollowing out. The
UK is more open to trade than
Americam yet our middle class
has done better than America’s.
The answer, Corlett argues, lies
with domestic policy: In countries where incomes have stagnated or declined for some, factors such as housing costs or the
Great Recession are to blame. It
is nonsense to pin everything on
global forces. Politicians should
blame themselves, not the multinational corporations.
The final piece of the jigsaw
came from the Office for
National Statistics. The average
UK worker’s total pay rose 2.3
per cent year on year, a lot higher than inflation of 0.6 per cent,
a decent but not spectacular
national pay rise. There are
always losers as well as winners
from capitalism, globalisation
and technology. Old industries
have collapsed. Some workers
earn less. But while traumatic,
such changes are necessary to
ensure that economies can rejuvenate themselves.
What the Western middle
classes now need are as many
years as possible of unbroken
economic expansion: After the
chaos caused by the financial
crisis, the old relationship
between an increase in the Gross
Domestic Product and a rise in
wages has finally reestablished
itself. This is a hugely encouraging development.
So why the rise of populism? While wages are finally
improving, there has been no
return to boom times. Millions
of younger people are despairing at exploding housing costs,
fuelled by government-created
low supply and rock-bottom
interest rates; older workers are
facing a nightmarish pensions
crisis, also created by ultraloose monetary policy.
Voters feel culturally disconnected; they rightly voted for
Brexit because they realised that
democratic control was being
destroyed by technocratic unaccountability. The welfare state’s
inherent defects mean that people
feel caught up in a Hobbesian war
for resources — school places, hospital beds — of all against all, especially with high levels of immigration. But the middle classes should
direct their ire towards politicians
and central bankers, not free markets or technology.
(Courtesy: Daily Telegraph)
(The writer is deputy director of content and deputy editor
at The Telegraph)
DXU`Qbdi\UQTUbcXY`
]QTUQ]YcdQ[URi
bU]_fY^W1[XY\UcX
IQTQfQcCdQdUSXYUV
2UY^Wd_\TX_gW_Y^W
d_QdU]`\U]Q[Uc
]UQ^_^=ec\Y]Yc
`\QY^SQ\\_ec>__^U
XQcdXUbYWXdd_cQi
dXQd8_gT_UcYd
QVVUSdQ^i_^U/
CQ]QZgQTY@Qbdi=@
°BQ]7_`Q\IQTQf
1Sd_b
°C_XQ1\Y;XQ^
;4CC4ABC>C74438C>A
@_\YdYSQ\WQ]R\U
Sir — This refers to the editorial,
“Samajwadi Party tussle”
(September 15). Tension had been
brewing within the Yadav family
ever since Akhilesh Yadav was
made the Chief Minister of Uttar
Pradesh. There is no doubt that
Samajwadi Party chief Mulayam
Singh Yadav will not leave any stone
unturned to restore peace in the
family, but it is easier said than done.
In a three-cornered fight,
such a development will only act
as an advantage to both the
Bahujan Samaj Party and the BJP.
And even if this ongoing rift is
resolved, now that Shivpal Yadav
has been made the party’s chief in
Uttar Pradesh, there will be direct
conflict between the Chief
Minister and Shivpal Yadav.
Whichever way this situation
turns, Uttar Pradesh will witness
one of the most intense elections
in a high-stake political game.
Bal Govind
Noida
1\\`QbdYUc]Q^
Sir — This refers to the report,
“ADMK inducts record members”
(September 15). Subburaman
Thirunavukkarasar has come to
2ddVceZgV2\YZ]VdYYRd
dfcacZdVUYZdV]UVcd
C
WXbaTUTabc^cWTTSXc^aXP[°BP\PYfPSX?Pachcdbb[T±BT_cT\QTa $CWT
b`dPQQ[TQTcfTT]DccPa?aPSTbW2WXTU<X]XbcTa0ZWX[TbWHPSPeP]SWXb
d]R[TBWXe_P[HPSPeXb]^[^]VTaPbTRaTc>[ScX\Tab[XZTBWXe_P[HPSPe
PaT\XUUTSfXcWcWTfPhcWT²h^d]VP]SaPf³0ZWX[TbWHPSPeWPbQTT]V^e
Ta]X]VCWT\dRWQTaPcTS0ZWX[TbWHPSPefW^WPbQTT]PccWTaTRTXeX]VT]S
^UU[PZU^acWTSTcTaX^aPcX]V[PfP]S^aSTaX]cWTBcPcTP__TPabc^QTX]P
SP\PVTR^]ca^[\^STfXcWPbTaXTb^USTeT[^_\T]cP[X]XcXPcXeTb
0ZWX[TbWHPSPebaT\PaZb^]cPZX]VWXb²^f]STRXbX^]b³P]SWXbVa^dbT
^eTa²^dcbXSTab³WPa\X]VcWT_PachXbP]X]SXRPcX^]cWPcWTXbWTaTc^bcPh7^fTeTa
BWXe_P[HPSPeb_^_d[PaXchX]cWT_PachfXcW[^PSb^UTg_TaXT]RT\TP]bcWPc
cWTd]R[T]T_WTfQPcc[TfX[[]^cSXTb^^]D]S^dQcTS[hBP\PYfPSX?PachRWXTU
<d[PhP\BX]VWHPSPeXbcWTcP[[Tbc[TPSTafW^RP]SaPfe^cTb^]WXb^f]
QdcWXbPVTP]SX[[WTP[cW\Ph_aTeT]cWX\Ua^\PRcXeTRP\_PXV]X]V7T\Ph
WPeTc^cPZTPRP[[b^^]^]fW^bTbcTfPaSbWX_cWT_Pach\dbcUXVWc_^[[b
6P]P_PcWX1WPc
0Z^[P
experiment himself with partyhopping. Perhaps, he must be the
only one to have a unique record
of having been a member of almost
all political parties in Tamil Nadu,
except the communist ones.
SA Sharma
Via web
3_^cUbfUgQdUb
Sir — This refers to the editorial,
“Mayhem over Cauvery”
(September 14). The cultivation of
water-intensive crops such as
hybrids and GM crops, apart from
depletion of groundwater, is resulting in conflicts. Natural farming
helps build humus and the water
retention capacity of soils, hence it
should be the way forward for both
Tamil Nadu and Karnataka.
Lessons need to be drawn
from the fate of Noyyal, a
Cauvery tributary that flows
through Coimbatore, which has
turned ‘dead’ due to toxic
untreated textile industry effluents. The onus lies more on
Tamil Nadu to curtail dependence on its neighbour and usher
in water self-sufficiency, since it
suffers the disadvantage of being
at the receiving end, both literally and metaphorically.
CV Krishna Manoj
Hyderabad
@QcdU^TUQf_ebc
Sir — This refers to the article,
“Kashmir blunder that bleeds us to
this day” (September 13) by A Surya
Prakash. The Nehruvian blunder on
referring the Pakistani invasion on
Jammu & Kashmir to the UN
Security Council on January 1,
1948, against the advice of Sardar
Vallabhbhai Patel, when the Indian
troops were about to throw out the
aggressors in a few days, is so monumental and reprehensible that no
amount of generosity or respect for
our first Prime Minister’s role in the
freedom struggle and independent India’s initial years, can possibly white-wash it.
The author has rightly quoted
the IAF chief, Air Marshal Arup
Raha’s remarks that Nehru’s tragic
thoughtlessness keeps India ‘bleeding to this day’. Alongwith another colossal disaster of Nehru’s
romanticism — Hindi-Chini bhaibhai — that occurred in war with
China in 1962, Nehru will down in
modern Indian history as a Prime
Minister whose errors of judgement
created serious problems for the
nation, some of which remain.
M Ratan
Via email
BT]Shh^daUUTTSQPRZcc^)
[TccTabc^_X^]TTa/V\PX[R^\
"aSThT(
347A03D=k5A830H kB4?C4<14A %! %
@?9>D2>D=C4A@?9>D
BWPWPQdSSX]baT[TPbTUa^\YPX[fPb
bcPVT\P]PVTSCWT1XWPa6^eTa]\T]c
ST[XQTaPcT[hSXS]^c[TccWTcaXP[QTVX]
°19?[TPSTa
BDB78;<>38
%HQHILWVRID
QHZFDOHQGDU
CWTR^]ca^eTabh^eTaBWPWPQdSSX]VTccX]V
QPX[XbPRaTPcX^]^UcWT19?P]ScWT\TSXP
>][hcWTR^dacbRP]STRXSTbdRWcWX]Vb
°A93RWXTU
;0;D?A0B03
EYZ_\Z_X`W]Rde^R_Z_eYV]Z_V
0SeP]RT\T]c^UcWT1dSVTcSPcTfX[[ 'HYHORSPHQWVDFURVVWKHZRUOGUHFHQWDQGLQWKHSDVWGHFDGHVDQGFHQWXULHVKDYHVKRZQWKDWJURZWKDQGSURVSHULW\
T]bdaTR^\_[TcX^]^UP[[[TVXb[PcXeT
FDQQRWFRPHE\SDPSHULQJDVHOHFWIHZDQGKRSLQJWKHHOLWHZLOOWKHQZULWHDODUJHUDQGPRUHLQFOXVLYHQDUUDWLYH
f^aZbQTU^aTcWTbcPac^UUX]P]RXP[hTPa
enough money to pay for education
amata Banerjee has won
]!cWT=306^eTa]\T]cd]STacWTcWT]?aX\T
<X]XbcTa0cP[1XWPaXEPY_PhTTbfXcRWTScWTcX\X]V
^UcWT_aTbT]cPcX^]^UcWT1dSVTcUa^\cWTRdb
c^\Pah$_\c^ P\FWX[TcWXb\^eTfPbbh\
Q^[XRcWTRdaaT]c=30SXb_T]bPcX^]WPb]^fcPZT]
P\PY^abcT_QhST[X]ZX]VcWXbTgTaRXbTUa^\cWTeTb
cXVTb ^U R^[^]XP[ aPY CWT
<^SX6^eTa]\T]cXb[XZT[hc^
PSeP]RTcWT_aTbT]cPcX^]^U
cWT1dSVTcUa^\cWT[PbcSPh
^U5TQadPahc^cWT[PbcfTTZ
^U9P]dPah^acWTUXabcfTTZ
^U5TQadPahCWXbfX[[d][TPbW
WdVTQT]TUXcb
D]STa cWT TgXbcX]V
PaaP]VT\T]cQhcWTcX\TcWT
5X]P]RT 1X[[ P]S cWT \PX]
3T\P]SbP]S0__a^_aXPcX^]
DCC0<6D?C0
1X[[Xb_PbbTSX]?Pa[XP\T]c
P[aTPShUXabcbXgfTTZb^UcWT
UX]P]RXP[hTPa0_aX[c^\XS<PhPaT^eTa7T]RTc^
\TTccWTTbbT]cXP[Tg_T]SXcdaTeXibP[PaXTb^eTaWTPSb
TcRSdaX]VcWXb_TaX^ScWT6^eTa]\T]cXbU^aRTSc^
bTTZPe^cT^]PRR^d]c8UcWT1dSVTcSPcTXb_aT_^]TS
?Pa[XP\T]cfX[[WPeTcf^Ud[[\^]cWbc^_PbbcWT1X[[b
PdcW^aXbX]Vb_T]SX]VU^acWTUd[[hTPa
7^fTeTacWTaTP[QT]TUXcfX[[QTQhcWTfPhP[[
<X]XbcaXTbST_Pac\T]cb fX[[ VTc c^ Z]^f fT[[ X]
PSeP]RTPbc^W^f\dRW\^]ThfX[[QTPePX[PQ[Tc^
cWT\U^ab_T]SX]VCWXbfX[[T]PQ[TcWT\c^_a^_Ta[h
_[P]cWTXabRWT\Tb_a^VaP\\TbcWTXaX\_[T\T]cPcX^]
P]S Tg_T]SXcdaT _PccTa] d][XZT cWT TgcP]c bhbcT\
fWTaTX]cWThTXcWTaT]STSd_Qd]RWX]V\^bc^UcWT
Tg_T]bTbSdaX]V[Pbccf^`dPacTab^abdaaT]STaX]Vd]
dbTSQP[P]RTb^dc^UcWTP[[^RPcTSUd]Sb
CWXbfX[[P[b^cPZTPfPhcWT[TTfPhcWPcXbRdaaT]c[h
QTX]VT]Y^hTSX]STTSTg_[^XcTSQhad[X]VTbcPQ[XbW
\T]cbc^fX]S^fSaTbbPRR^d]cbfXcWcWTb^[TPX\
^UcaX\\X]VUXbRP[STUXRXc^][hc^Pe^XSb[X__PVTbP[QTXc
^]_P_TaUa^\cWTbTccPaVTc
0c_aTbT]ccWTaTeXbX^]X]X]R^\TcPgaPcTbPb
_a^_^bTSX]cWT1dSVTccW^dVWP__[XRPQ[TUa^\SPh
^]T^UcWTUX]P]RXP[hTPaXT0_aX[ WPbc^fPXccX[[cWT
5X]P]RT1X[[Xb_PbbTS3dTc^d]RTacPX]chPbc^fWPc
aPcTfX[[UX]P[[hVTcP__a^eTSQdbX]Tbb\T]P]SX]SX
eXSdP[bPaT]^cPQ[Tc^\PZTP]hSTUX]XcT_a^eXbX^]b
fXcWaTVPaSbc^cWTXacPg[XPQX[Xch<^aT^eTaXcP[b^WP\
_TabcWTXaPQX[Xchc^\P]PVTRPbWU[^fb
FXcWaTVPaSbc^X]SXaTRccPgTbP]haTeXbX^]X]
aPcTbPhX]RaTPbTX]TgRXbTSdchcPZTb²X\\TSXPcT³
TUUTRcXT<PaRW 0bPaTbd[cP]h_a^SdRc[TPeX]VP
UPRc^ahUa^\cWXbSPcTWPbc^_PhWXVWTgRXbTSdch
0]SX]RPbTcWTWXZTXb]^cP__a^eTSQh?Pa[XP\T]c
^aXUXc_PacXP[[ha^[[bXcQPRZXc[TPSbc^WPbb[TbU^a
_a^SdRTabPbcWThWPeTc^bTTZaTUd]SP]SQ[^RZ
PVT^Uf^aZX]VRP_XcP[XUcWTaTUd]SVTcbST[PhTS
0cP]^cWTaTgcaT\TaTeXbX^]X]bTaeXRTcPgcPZTb
_[PRT _a^b_TRcXeT[h PUcTa cWT 5X]P]RT 1X[[ Xb _PbbTS
d][XZTcWTX]R^\TcPgfWTaTRWP]VTbPaTP__[XTSaTc
a^b_TRcXeT[hUa^\0_aX[ 5^aX]bcP]RTcWTX]RaTPbT
\^^cTSX]! %! &1dSVTcc^ $_TaRT]cfPbTUUTR
cXeTUa^\9d]T d_Ua^\ #$_TaRT]c[PbchTPa
CWT 6^eTa]\T]c R^]ca^[b cWT \PgX\d\ aTcPX[
_aXRT^UUTacX[XbTabCWTaTeXbX^]bP]]^d]RTSX]cWT
1dSVTccPZTb_[PRTfXcWX\\TSXPcTTUUTRc8]cWT_Pbc
P]X]RaTPbTX]cWT\PgX\d\aTcPX[_aXRT^UdaTPWPS
c^QTa^[[TSQPRZCWXbd_bTcbcWT1dSVTcPbP[[^RP
cX^] U^a bdQbXSh Xb X]eTabT[h aT[PcTS c^ _aXRT 5^a
X]bcP]RTPWXZT^UC _Tac^]]T\^^cTSX]cWT
((' (((1dSVTcfPbaTeTabTSX][TbbcWP]cf^
fTTZbCWXb[TUccWTcWT]5X]P]RT<X]XbcTaHPbWfP]c
BX]WPVPb_X]VU^aC %Ra^aT
CWTPSeP]RT\T]c^UcWT1dSVTcSPcTfX[[aT\^eT
bdRWP]^\P[XTbQhT]bdaX]VR^\_[TcX^]^UP[[[TVXb[P
cXeTaT`dXaT\T]cbQTU^aTcWTbcPac^UcWTUX]P]RXP[hTPa
0[[cPgaPcTaTeXbX^]bP]S_aXRTbd]STabcPcdc^ahR^]
ca^[fX[[cPZTTUUTRcUa^\0_aX[ CWTe^cT^]PRR^d]c
fX[[QTPcWX]V^UcWT_PbcP]SP[[<X]XbcaXTbfX[[WPeT
c^S^_a^_TaQdSVTcX]VP]S_[P]]X]Vc^b_T]SUa^\
SPh^]TCWTaTfX[[QTVaTPcTaPRR^d]cPQX[XchP]SbR^_T
U^aUdSVX]VWdVT[h\X]X\XbTS
0]^cWTa_a^_^bP[c^aTR[PbbXUhb_T]SX]VPb²aTe
T]dT³^a²RP_XcP[³PbPVPX]bcTgcP]c²_[P]³^a²]^]_[P]
XbP[b^fT[R^\TCWT[PccTaXbPaT[XRbUa^\_[P]]X]V
TaPfWT]STeT[^_\T]cfPbX]cTacfX]TSfXcW_[P]]TS
bRWT\TbCWXb[TSc^P]P]^\P[^dbbXcdPcX^]fWTaT
QhP]hTg_T]bTd]STa]^]_[P]TeT]XUXcXb^URP_X
cP[]PcdaTfPbR^]bXSTaTSPbd]_a^SdRcXeTfWTaTPb
PaTeT]dTTg_T]bTR^d[SQT_TaRTXeTSPb_a^SdRcXeT
YdbcQTRPdbTXcR^\Tbd]STa_[P]RPcTV^ah
CWT_a^_^bTSR[PbbXUXRPcX^]Xb]^c^][hX]bh]RfXcW
cWTR^]cT\_^aPahaTP[XcXTb^USTeT[^_\T]c_a^_T[[TS
QhP\d[cXcdST^Ub^daRTbXc]^[^]VTaaTe^[eTbPa^d]S
_[P]]TSbRWT\TbQdcXcfX[[P[b^cad[haTU[TRccWTa^[T
_[PhTSQhaTb_TRcXeTXcT\CWdbPWXVWTaRP_XcP[Tg_T]
SXcdaTf^d[SR^]]^cTPQ^^bcc^PbbTcRaTPcX^]P]S
WT]RT _a^SdRcXeT RP_PRXch ^U cWT TR^]^\h 0]h
STRaTPbTX]aTeT]dTTg_T]bTbfX[[QTPbXV]^UX\_a^eTS
TUUXRXT]RhX]f^aZX]V
FWX[T cWTbT RWP]VTb PaT P V^^S ^\T] cWT
6^eTa]\T]cbW^d[SP[b^_dcP]T]Sc^P_Ta]XRX^db
_aPRcXRT^USTUTaaX]VRTacPX]Tg_T]bTb\^bc[hbdQbX
SXTb^]UTacX[XbTabU^^SP]SUdT[c^cWTU^[[^fX]VhTPa
5^a^eTacf^STRPSTbbdRRTbbXeTTbcPQ[XbW\T]cb_^bc
_^]TSbdQbXSh_Ph\T]cbX]cT]b^UcW^dbP]Sb^URa^aTb
cWTaTQhRP\^dU[PVX]VcWTcadT_^bXcX^]^UUXbRP[STUXRXc
CWXbRaTPcTbP\Xb[TPSX]VX\PVTPQ^dccWTXaQTX]VUXb
RP[[h_adST]cC^T]bdaTcWPcbdRWSXbRX_[X]TXbbcaXRc
[hT]U^aRTScWT6^eTa]\T]cbW^d[SX\_[T\T]ccWTaTR
^\\T]SPcX^]b ^U cWT 4g_T]SXcdaT <P]PVT\T]c
2^\\XbbX^]d]STaU^a\Ta6^eTa]^a^UATbTaeT1P]Z
^U8]SXP1X\P[9P[P]c^bfXcRW^eTac^PRRadP[QPbTS
PRR^d]cX]V Ua^\ TgcP]c ²RPbWQPbTS PRR^d]cX]V
CWXbfX[[]X_X]cWTQdSP]hcT\_cPcX^]c^STUTa_Ph
\T]cbXU^][hc^\P]X_d[PcTUXbRP[STUXRXc
C^VTcWTafXcWcWT6^^SbP]SBTaeXRTbCPgb[Pc
TSc^QT^_TaPcX^]P[Ua^\0_aX[ ! &cWT_aT_^]T
\T]c^UcWT1dSVTcSPcTW^[SbcWT_a^\XbT^U\PZ
X]VcWT8]SXP]TR^]^\hWTP[cWhP]Sa^QdbcRP_PQ[T
^UcPZX]V^]cWTRWP[[T]VT^US^dQ[TSXVXcVa^fcW
M
8
BD38?170CC0270AHH0
CWTeTahaTRT]c
WP__T]X]VbX]cWT
D:P]ScWTDB
bW^fcWPccWT
f^aZX]VR[Pbb^[S
P]S_^^afPbQPS[h
X\_PRcTSQh
V[^QP[XbPcX^]8cbPf
Y^QbV^P]SfPVTb
Sa^_8]\P]h
PaTPbcWT_T^_[T
P[b^UPRTS
^]b[PdVWcbUa^\
P[XT]XST]cXchP]S
Rd[cdaTCWT4DfPb
]^c^]cWTbP\T
_PVTPbcWTD:
the battle of Singur. She
has actually won her war
of self-vindication. The Supreme
Court verdict has legitimised her
political philosophy.
It had a simple beginning
when Tatas were looking for a suitable piece of land for their Nano
project in 2005. The Communist
Party of India (Marxist)-led Left
regime, which had earlier driven
out most industries and then wanted to refurbish its image, wanted to
help Tata Motors set up a project
in West Bengal. The Tatas were
shown land in Kharagpur and
Singur, and the firm chose the latter. The Government went out of
its way to acquire and hand over the
land to Tatas.
This is not an isolated incident.
Over the years, for so-called development of industry, mining and
infrastructure, the interests of
farming, forestry, environment
and especially ethnic folk and
tribes, have been ignored.
The theme of the economic
impact of British imperialism on
India was raised by British Whig
politician Edmund Burke who, in
1778 began a seven-year impeachment trial against Warren Hastings
and the East India Company on
charges including mismanagement
of the Indian economy.
Contemporary historian Rajat
Kanta Ray argues the economy
established by the British in the
18th century was a form of plunder and a catastrophe for the traditional economy of Mughal India,
depleting food and money stocks
and imposing high taxes that
helped cause the famine of 1770,
which killed a third of the people
of Bengal. In post-independence
India too, dams, mines, steel plants
and nuclear plants were pushed
through unjustly.
Africa had been ravaged and
chopped up and divided by the
colonial powers — Belgium,
France, Germany, Italy, Portugal,
Spain and the United Kingdom. It
was the European squabbling for
African, Asian and West Asia
colonies, and their tremendous
wealth, that was a significant cause
of the first World War. Africa has
historically been vital to the industrialisation of Europe as a source of
natural resources and human
labour. Modern Europe owes its
development to the exploitation of
Africa’s natural resources. Postindependence, the old colonialists
simply resorted to buying off corrupt African leaders and continued
to rape the continent. Few Africans
benefited except the elite.
The African Economic
Outlook 2011 report has found that
African states experienced high
economic growth during the 2000s
due to good macro-economic
management, growth in trade, and
foreign investments in oil-rich
states. However, this growth did not
coincide with poverty elimination, because it was not linked to
activities and economic sectors that
affect the poor.
The costs of hosting the World
Cup in South Africa were sought
to be justified by the economic
growth the event was supposed to
generate. Expenses now are expected to surpass original estimates by
757 per cent. The expected growth
in infrastructure and small local
businesses has not come anywhere
close to offsetting the funds that
were been diverted from long-term
priorities such as healthcare and
education. Fifa and international
corporate sponsors such as
McDonald’s and Coca Cola are the
6QY\UT\UQTUb/6edebU
\UQTUb/DQ[UQSQ\\
8UcWT2^]VaTbbXbbTaX^dbPQ^dcT[TePcX]VAPWd[6P]SWXPbcWT_Pach
_aTbXST]cXc\dbcS^Xc]^f7TS^Tb]^cWPeTcWT[dgdah^UcX\T
s Congress scion Rahul Gandhi
finally going to become the president or is it going to be one more
kite-flying news? While his supporters want him to take over
immediately, the old guard wants
Congress president Sonia Gandhi to
continue. She became the party president in 1998, and her term will
come to an end in December. Many
within the party feel that the mother-son duo has not worked well as
the workers are confused. There will
be added confusion if Priyanka
Vadra enters politics.
Rahul Gandhi’s supporters give
two reasons why he should
take over now. First, the line
of succession has been clear
and it is only a question of
time. He has been waiting in
the wings for the past 12
years since he entered politics
in 2004. He was elevated as the
party vice president in January
2013 and has virtually been
functioning as the chief since
then. Almost all party functionaries report to him directly. Moreover, Congressmen,
who are alarmed at the rapid
decay of the party, want to see
some change.
Second, Sonia Gandhi is
not keeping good health and
may not be able to undertake
the rigorous elections tours and
other strenuous activities as the
party chief. Also, she has been taking a back seat, asking all those who
go to her to meet Rahul Gandhi for
important decisions.
However, there is no doubt that
Sonia Gandhi has a stature and oldtimers still prefer her over Rahul
Gandhi, who is seen as a reluctant
leader. She has proved her mettle in
the past 18 years by steering the party
to power twice. She failed only once,
in 2014. When she took over in 1998,
the party was on a low, with people
leaving the sinking ship. Her entry
checked that erosion.
I
It took her more than six years
to bring the party back on track. She
functioned as the first woman leader
of Opposition in Parliament. Her
efforts brought the party back to
power in 2004. She went round
mobilising non-BJP ‘secular’ parties
on one platform by building the
UPA. She also succeeded in keeping
the party in power for the next 10
years, and ruled the country through
proxy by making Manmohan Singh
the Prime Minister.
However, good times did not last
long as Narendra Modi entered the
scene as a macho Prime Minister and
won the 2014 poll. Neither Sonia
Gandhi nor Rahul Gandhi was a
match for him.
Where she failed was in building
the organisation, which needed a
surgery. Unfortunately, while the
mother-son duo detected the rootcause of the problem, the two did
nothing to improve the situation. As
the Congress began to lose State after
State and came up with just 44 seats
in the 2014 Lok Sabha poll, its lowest ever, the morale of the workers
also reached rock bottom.
Rahul Gandhi’s experiments in
reviving the Youth Congress and
other measures came to naught. On
biggest beneficiaries of the event,
with much of the local South
African population unable to even
attend the matches.
International development can
also cause and accentuate inequality between the richer and the poorer factions of one nation’s society.
For example, when economic
growth boosts development and
industrialisation, it can create a class
divide by creating demand for
more educated people in order to
maintain corporate and industrial
profitability. The popular demand
for education, in turn, drives the
cost of education higher through
the principle of supply and
demand, as people would want to
be part of the new economic elite.
Higher costs for education lead to
a situation where only people with
can receive sufficient education to
qualify for the better-paying jobs
that mass-development brings
about. This restricts poorer people
to lesser-paying jobs and technological development makes some of
these jobs obsolete (for example, by
introducing electronic machines to
take over a job, or creating a series
of machines such as lawn mowers
to make people such as gardeners
unemployed).
The US uses the humanitarian hand-wringing, the dogma of
democracy and capitalism and
neoliberal economics, to camouflage its quest for hegemony. It is
powered by oil, military supremacy and international finance. For
the oil weapon to be effective, the
US needs to control much of it,
everywhere and all the time.
The very recent happenings in
the UK and the US show that the
working class, old and poor, was
badly impacted by globalisation; it
saw jobs go and wages drop. In
many areas, the people also faced
onslaughts from alien identity and
culture. Further, in the EU, for
example, Brussels mostly disregarded indigenous UK public opinion, and was not on the same page.
There was, therefore, a felt need to
restore decision-making and political dignity from the clutches of
remote bureaucracy and politics.
All of this made Brexit happen.
A similar example is brewing
in the US. Protectionism is raising
its ugly head there too. US
Republican presidential nominee
Donald Trump, riding on the
waves of such populist anger, may
even win the race to the White
House, eventually.
The point to note is that,
development must be inclusive in
all respects — particularly in a
multi-cultural and multi-occupational society. There is no justification for giving gains to one section at the cost of the other. Such
moves boomerang.
6KDSLQJDQHGXFDWLRQ
V\VWHPIRUWRPRUURZ
:0;H0=8B70=:0A
the other hand, the fight between the
old guard and the new guard has
ruined the chances of the party.
Rahul Gandhi has contested
three elections successfully, representing Amethi in Parliament. But he
has missed several opportunities to
prove his leadership qualities. He
could have become a Minister in
2004, perhaps even the Prime
Minister in 2009, and could have
taken over the party any time, as he
had (and also has) no challengers.
The result is that people think he
has no leadership quality. He may be
a crowd-puller, but not a vote-catcher, as has been proved in successive elections. Bihar was
an exception but that was
because of the poll tie-up
with the Janata Dal (United).
Many have noticed his lack
of focus, energy and enthusiasm. He is two decades
younger than Modi, but no
match to him. Rahul Gandhi
has now resorted to road
shows and is lunching in
Dalit homes to change his
image. His temple visits have
increased in the past two
years, showing a soft
Hindutva line. The Congress
is now trying to appease both
the communities.
Rahul Gandhi does not
have the luxury of time any longer.
Five States are going to polls next year
and another eight States in 2018,
before the 2019 Lok Sabha poll. He
needs to build a new team, enthuse
the party workers, build contacts
with allies and find more partners to
strengthen the UPA. For this, the first
step is to do well in the ensuing Uttar
Pradesh and Punjab polls. The
roadmap is clear. Rahul Gandhi will
first oversee the organisational shakeup, followed by taking charge of the
party — and thereafter a much needed chintan shivir to look into the reasons for its electoral debacles and the
way forward.
CWT_a^Q[T\fXcW^daTSdRPcX^]_^[XRhXb]^cYdbc^UUd]SX]V
bcP]SPaSbP]S\^aT8c³b^]T^UPbTeTaTXST]cXchRaXbXb
he national policy on
education, since independence, has gone
through various acts of commission and omission.
Indeed, for anything to be
called a ‘policy’, it has to be
formally so stated by an
agency which is charged with
the responsibility of framing
the document. There can be
no policy by default.
This is not the best place
to get into a chronological narrative of the approach of the
Parliament or indeed the
Indian Government towards
an ‘education policy’.
Education is something on
which many people have some
opinion. Therefore, it is not
surprising that so many committees and commissions have
been appointed on this subject.
Further, like in many
domains, in the field of education too, post-independence institutions have had
a huge shadow of the British
legacy. To begin with, we
created a University Grants
Commission (UGC), perhaps for no better reason
than that Britain had such
an entity. Imitation is the
best form of flattery. But it’s
dangerous when it happens
blindly in the domain of
knowledge management.
The result of this kind of
institutional framework is
not only worrisome, but
also pernicious. The distribution of funds for education have got hugely
eschewed. It will be useful to
remind ourselves that education is a concurrent subject. However, the business
of granting recognition for
the so-called ‘maintenance
of standards’ made the UGC
almost the sole arbiter of the
T
fate of higher education.
When this was put on a
base of higher secondary and
secondary education on
which the Centre had much
less say, the fit did not quite
work out. The response was
not clear, though, through
some quirk, the Central
Board of Secondar y
Education finally emerged.
The result is there for all
to see. Examination after
examination, sometimes
mutually exclusive if not
competitive, dominates the
scene. This is besides the
competitive entrance tests
from everything — medicine
to engineering. Parents are
confused, children are bewildered, and employers at a loss
to make sense of all this.
The result is that several employers have begun
installing there own competitive examinations. The
series appears endless. The
truth of the matter is that the
escape route came — as it
always does — for the
resourceful and those who
were networked.
Almost every two of
three so-called influential
families have their wards
studying outside India.
Indeed, this decision had
lent them a huge status in
many ways: From marriage
to employment.
The dream of every
Indian mother continues to
be to get a son-in-law or a
daughter-in-law who is either
placed abroad or is at least an
NRI. From a Government
company to a multinational
firm operating in India, a
clear pattern of recruitment
is discernible.
The effective career path
is to float in at a lateral level
E8=0HB78;60DC0<
with foreign credentials. Well
might one ask: To whom
does this country belong? Is
it just a pasture for those from
outside India?
However, to continue
with the narrative on education, it is not only a problem
of funding, standards, intake,
focus on output and more,
but one of a severe identity
crisis. This is a terrible story
to narrate as few ever seem to
attempt a way through it
with the political and the
social will it requires.
Hopefully, the national
policy on education should
be a canvas to clear much of
this confusion. The truth of
the matter is: Every attempt
to do a national policy on
education has an overlay of
a confusion which is best
stated as framed in the
statement, ‘Eminence is not
omniscience’.
Somebody may be very
distinguished in his field,
but it does not necessarily
make him an expert in education too. In fact, an analysis of the composition of the
search committees of key
functionaries of educational
bodies such as the All India
Council for Technical
Education and others will
show that, those who chaired
these committees were members who had little notion of
the subject matter of the
education domain, or for
that matter, even of the issues.
Casual familiarity with
issues of education cannot
be a substitute for a deep
scholastic insight into the
subject matter. That can
only happen after decades of
concentrated development
of expertise. That day is
still awaited.
\^]Th 347A03D=k5A830H kB4?C4<14A %! %
FTfTaTfPXcX]VU^a0XaRT[
caP]bPRcX^]c^R^]bd\\PcT
FTWPeTbcPcTScWPcfTWPeT
S^]T]TRTbbPahSdTSX[XVT]RT
P]SfTPaTPcPSeP]RTSbcPVTb
^UR[^bdaT^Uc^fTacaP]bPRcX^]
fWXRWfTW^_Tc^R^]R[dSTX]
>Rc^QTa
A2><24>5>A2>=BD<4A
1DB8=4BB6DA344?B8=67
2EJJ
6B?=
3?B@?B1D5C
C4`^ViaVTede`dV]]e`hVcd
Z_@Te2ZcTV]e`UZgVdeZed`h_
=4F 34;78) Telecom operator
Reliance Communications is
looking to close its long-pending
mobile tower sale deal next
month that may bring down its
debt by around C19,000-20,000
crore.
“We were waiting for Aircel
transaction to consummate... We
have stated that we have done
necessary due diligence and we
are at advanced stages of closure
of tower transaction which we
hope to conclude in October,”
said RCom CEO for Consumer
Business Gurdeep Singh during
an investor call on Thursday.
Anil Ambani-led Reliance
Communications on Wednesday
agreed to merge its wireless telecom business with smaller rival
Aircel to create the country’s 4thbiggest mobile phone operator
with an asset base of more than
C65,000 crore.
“The C20,000 crore debt (out
of about C47,000 crore of RCom)
will go away with this deal. Then,
there will be tower proceeds. At
this point of time, it is not possible to give exact valuation of the
tower deal. This is an approximate estimate. Residual debt will
be C9,000 crore with little plusminus,” an RCom official said
CWT C!Ra^aTSTQc^dc^UPQ^dcC#&Ra^aT^UA2^\fX[[V^PfPh
fXcWcWXbSTP[CWT]cWTaTfX[[QTc^fTa_a^RTTSb0ccWXb_^X]c^UcX\TXc
Xb]^c_^bbXQ[Tc^VXeTTgPRceP[dPcX^]^UcWTc^fTaSTP[CWXbXbP]
P__a^gX\PcTTbcX\PcTATbXSdP[STQcfX[[QTC(Ra^aTfXcW[Xcc[T_[db
\X]db²P]A2^\^UUXRXP[bPXSSdaX]VcWTRP[[>]cWT^cWTaWP]S0XaRT[Xb
_[P]]X]Vc^bT[[Xcb!\^QX[Tc^fTabc^[^fTaXcbSTQc[^PSc^C #
Ra^aTUa^\Pa^d]SC 'Ra^aTQTU^aTR[^bdaT^U\TaVTaSTP[fXcWA2^\
during the call.
On the other hand, Aircel is
planning to sell its 2,000 mobile
towers to lower its debt load to
C14,000 crore from around
C18,000 crore before closure of
merger deal with RCom.
“Aircel owns 2,000 towers.
Those 2,000 towers will not be
part of the merged company. As
you know, Aircel has C18,000
crore (debt) on their balancesheet.
At the time of merger, they
would be paying off C4,000 crore
to bring it down to C14,000
crore. That would happen by sale
of their BWA spectrum and
2,000 towers,” an RCom official
said during the call.
At the end of June 30, 2016,
RCom net debt stood at
C42,071.2 crore. The total debt is
estimated to be around C47,000
crore after paying for the spectrum auction.
Both the companies have
agreed to transfer C14,000 crore
each of their bank debt to the
merged entity, which will be
rebranded as a new company.
Besides these, both will transfer their pending payment for
spectrum that they acquired during different auctions.
“The merged entity is going
to have a total of C28,000 crore of
bank debt and combined
deferred spectrum liability of
around C7,000 crore. This will
make a total debt of merged company at around C35,000 crore,” the
RCom official said.
However, another RCom
representative clarified that on the
day of consummating the deal,
the debt in the books will be only
C28,000 crore.
He said spectrum payment
instalment is due in books of the
Department of Telecom and the
merged company will not be raising any debt for paying those
pending instalments.
In the largest consolidation
in the country’s telecom sector,
RCom and Aircel will hold 50 per
cent each in the new company.
The board of the new company
will have equal representation
from the two sides. The merged
entity has plans to invest $1 billion after its incorporation.
“We have received enough
interest from international
investors for the merged entity as
the deal has been announced. We
are looking at $1 billion of investment into the company. It will
raise another billion from bankers
as well if need arises for expansion,” RCom President Punit
Garg said.
The merged company will
have a war chest for future capex
expansion and most of the capex
expansion will be data led, Garg
added.
RCom on Thursday also
announced transfer of its wireless
business undertaking of its subsidiary Reliance Telecom (RTL)
to Aircel and its subsidiaries.
The turnover of wireless
business undertaking of RTL
had a turnover of C10,605 crore,
accounting for 47.96 per cent of
total turnover of RCom at the end
of March 2016.
“Consolidation of the wireless telecom business of the
Company and RTL with AL
(Aircel) and DWL (Dishnet
Wireless-Aircel) provides an
opportunity to the company to
acquire equity interest in AL,”
RCom cited as one of the reasons
for transferring RTL business to
Aircel.
It said the transfer will further help in expanding the business of AL and DWL into growing markets of India, thereby creating greater value for the shareholders of AL and DWL.
The move will also reduce
foreign holding in Aircel. Aircel
is majority owned by Malaysian
firm Maxis Communications.
Saudi Telecom, too, has stake
in it.
?C8
FTbTTcWPc^da@!Va^fcWXbV^X]V
c^QTWXVWTacWP]@ Va^fcW1dcfT
S^bTTaXbZbcWPcf^d[SVTcdb
c^fPaScTaaXc^ah^US^f]fPaS
aTeXbX^]^UVdXSP]RTQTRPdbTcWT
Pc\^b_WTaTSdaX]VcWTR^dabT^U@!
WPbf^abT]TSR^\_PaTSc^fWPcfT
bPfX]cWTQTVX]]X]V^U@!h^dbTT
cWTTgP\_[T^UA1B
8=5>BHB24>E8B70;B8::0
5LVNVFRXOGSURPSWGRZQZDUG
UHYLVLRQRIJXLGDQFH,QIRV\V
=4F34;78: Infosys may slash its
revenue guidance for the second
time this fiscal, stung by “risks” like
challenges in the banking and
financial services sector and cancellation of projects.
However, in the short term,
the Bengaluru-based company
remains confident of a “better” second quarter compared to the
April-June, 2016 period.
“We see that our Q2 growth
is going to be higher than Q1
growth. But we do see risks that
would get us toward territory of
downward revision of guidance
because the atmosphere during the
course of Q2 has worsened compared to what we saw in the beginning of Q2, you see the example
of RBS,” Infosys CEO Vishal Sikka
said at the JP Morgan India
Investor Summit.
Infosys had earlier said it will
ramp-down about 3,000 jobs following Royal Bank of Scotland’s
decision to cancel its project to set
up a separate bank in the UK.
While announcing its first
quarter earnings, Infosys had
slashed its annual sales growth
guidance to 10.8-12.3 per cent in
US dollar terms for 2016-17,
down from the previous forecast
of 11.8-13.8 per cent.
Sikka admitted there were
“some internal execution issues”
that had impacted its performance in the first quarter of this
*67UROORXWDKHOO
RIDFKDOOHQJHVD\V
9LVKDO6LNND
=4F34;78) Describing GST
rollout “a hell of a challenge”,
Infosys CEO Vishal Sikka on
Thursday acknowledged that
there are pockets of weak preparedness, but there is still
time to address them before
the April 2017 deadline.
“There are many pockets
where there is weak preparedness at this moment.
But we have time between
now and then, and the government is extremely keen to
address that (weakness),”
Sikka said when asked about
the preparedness for the
launch.
He on Thursday made a
presentation to Finance
Minister Arun Jaitley and
senior officials of the ministry on GST Network
(GSTN) and the road map
for its operationality, a ministry tweet said.
?C8
fiscal but added that those issues
have been resolved.
“...This was purely because of
internal reasons, because of execution reasons... We have made
changes to the management and
over the course of Q2, we have
arrested the de-growth that we saw
in consulting,” he said.
Infosys, which is expected to
announce its earnings for the
July-September 2016 period in
October, said some elements of its
business tend to flow in towards
the end of the quarter.
“So we will only know more
than this when we do the earnings
in the second week of October. We
would have factored in, at that
time, the impact of RBS and
many other projects that we are
ramping up,” he added.
Top IT firms like TCS and
Infosys have highlighted certain
issues like softness in the BFSI sector and the cautious approach of
clients in the wake of Britain voting to leave the European Union
could impact their performance.
“We do see some challenges
in BFSI but not nearly to the degree
to what some other folks have
talked about. RBS we have talked
about, there are few clients in
Europe which are seeing downward pressure but at the same time
there are many that are growing
significantly for us,” Sikka said.
He added that the US is witnessing a similar trend.
“A couple of clients have
declined but at the same time there
are some that are growing very
nicely for us. So I don’t see it in the
negative sense,” he said.
?C8
5-LRDFFXVHVLQFXPEHQWSOD\HUV
RIUHMHFWLQJ013UHTXHVWV
([SRUWVFRQWUDFWIDOOLQ$XJXVW
slammed incumbent operators Bhar ti Air tel, Ide a
Cellular and Vodafone for
allegedly refusing to help
their mobile phone users
port or switch to the new
operator.
In a l e tte r to T R A I
C hai r man R S Shar ma ,
Reliance Jio said Bharti Airtel
Ltd, Idea Cellular Ltd and
Vodafone India Ltd are perpetrating “illegal and perverse actions” by refusing to
enable the porting of mobile
number connections.
“Considering that this is
a clear and deliberate breach
of the license conditions,
TRAI must direct incumbent dominant operators to
comply with their license
terms and obligations ...
Failing which it should recommend cancellation of the
respective licenses at the earliest,” Jio wrote.
The three firms did not
offer any immediate comment on the story.
“It is important to note
that this is being done in blatant disregard to license
xports from India
dipped 0.3 per cent to
E
$21.51 billion owing to
=4F 34;78) Reliance Jio has
terms and their obligations
under
t he
Telecommunication Mobile
Numb er
Por t ability
Regulations, 2009 and TRAI
directions,” Reliance Jio wrote
on September 14.
Jio said it has been certif ie d as Mobi le Numb er
Portability (MNP) compliant
by the Telecom Enforcement,
Resource and Monitoring
Cells of all service area and
in this month it wrote to
incumb ents ab out commencing services.
“Inspite of being under
legal and contractual obligation to port the numbers
after a valid request is made,
the incumbent dominant
operators have rejected all
the requests made for porting between September 9
and September 12,” it said
giving data of port requests
rejected.
It said the rejections were
in addition to “the rejection
of MNP request of 4,919
corporate mobile numbers
issued to employees and
m e mb e rs of R e l i an c e
Industries Group by Bharti
Airtel in August 2016. This
was inspite of a confirmation
from Bharti Airtel that there
were no outstanding dues
and that the MNP process
could be completed.”
Reliance had last month
asked all its employees to
shun rival mobile phone operators and shift to Jio.
“Almost all of these rejections have been made on the
baseless and unsubstantiated
ground of ‘violation of contractual obligation’.
The incumbent dominant
operators have not even bothered to elaborate the contractual obligations that have
been violated,” it said.
The “baseless and unsubstantiated” ground of violation of contractual obligation was being raised to
unnecessarily harass customers and prevent them
from availing the services of
Jio, the company said.
Jio asked TRAI to take
serious cognizance of its complaint and intervene by taking
strict action against the
incumbent operators under
the relevant provisions. ?C8
?=BQ =4F34;78
decline in shipments of
products like petroleum
and leather. This is the
straight second month in a
row that exports have contracted. The outward shipments stood at $21.58 billion in August 2015.
The country’s imports
too contracted by 14 per
cent to $29.91 billion, leaving a trade deficit of $7.67
billion in August, which is
the lowest figure in three
months.
The trade gap narrowed
in August this year from
$12.4 billion in the same
month last year, according
to the data released by the
Commerce Ministry.
The main export sectors that recorded negative growth in the month
include petroleum (14 per
cent), leather (7.82 per
cent) and chemicals (5 per
cent).
Reacting to data, the
Federation of Indian
Export Organisations
(FIEO) said the decline has
largely been arrested and
now “we can look for positive growth from October
onwards”.
It would help in taking
the shipments to around
$280 billion in 2016-17,
the FIEO said in a statement.
Cumulatively, exports
during April-August 2016
contracted by 2.98 per cent
to $108.52 billion. Imports
during the period too
dipped by 15.89 per cent to
$143.18 billion, leaving a
trade deficit of $34.67 billion.
Further, fall in gold
imports too helped in
bridging the trade gap. The
pre c i ou s m e t a l i mp or t s
dipped by 77.45 per cent to
$1.11 billion in August
2016.
Oil imports during the
SUHSDUHGQHVVWRUROORXW*67 $GYDQFHWD[6%,,&,&,VHH
3ULPH0LQLVWHUUHYLHZV
?=BQ =4F34;78
rime Minister Narendra
Modi has directed offiP
cials to stick to the implementation timeline of GST
rollout by April 1. In a
review meeting held on
Wednesday evening, Modi
told the officials to keep the
time line of all aspects of
GST preparedness, including the aspects of IT, establishment and infrastructure.
The meeting was
attended by Finance
Minister Arun Jaitley and
t op br a s s of P MO an d
Finance Ministry.
“In order to ensure that
there is no slippage on date
of implementation of GST
from 1st April, 2017, the
Prime Minister reviewed
the progress made on various steps needed for the
rollout of GST relating to
preparation of Model GST
laws and rules to be framed,
establishment of IT infrastructure for both Centre
and States, training of officers of Central and State
Governments and outreach
for awareness of trade and
industry,” said PMO in a
statement.
“ The Prime Minister
directed that all steps must
be completed much before
1st April, 2017. The Prime
Minister observed that GST
Council would need to have
intensive meetings to be able
to make timely recommendations relating to its mandate provided in Article
279A including making recommendations relating to
Model GST laws, GST rates,
goods and services that may
be subjected to or exempted
from GST,” said PMO.
VKDUSIDOO/,&5,/SD\PRUH
<D<108)Traditionally big taxpayers like large banks failed to
cheer taxmen with their second
quarter advance tax payouts,
but others including steel and
cement companies have done
comparatively better, helping
the department remain hopeful of meeting the annual target.
“Tax collection from the
city is rising, despite adverse
business situation and belowpar performance by several
important sectors like banks,”
principal chief income tax
commissioner of Mumbai D S
Saksena told the news agency
today. “Mop-up is rising and is
likely to improve further going
ahead.”
Saddled with high bad
loans and resultant spike in
provisions, largest lender State
Bank of India has paid an
advance tax of only C1,200
crore for the second quarter,
down from C1,620 crore in the
year-ago period, showing a fall
of 26 per cent, department
sources said.
Similarly, largest private
sector lender ICICI Bank too
paid 20 per cent less tax at
C1,200 crore. In the September
tranche last year, it had paid Rs
1,500 crore.
But insurance behemoth
LIC’s tax payment has risen 13
per cent to C2,235 crore from
C1,970 crore a year ago.
Reliance Industries paid
27 per cent more at C2,667
crore.
In the second quarter last
fiscal, it had paid C2,108 crore
in advance taxes.
Software major TCS has
paid 11 per cent less at C1,550
crore from C1,750 crore a year
ago.
Private sector banks like
HDFC Bank and Yes Bank
have done better. While HDFC
Bank has paid C2,400 crore, 20
per cent over C2,000 crore a
year ago, mortgage lender
HDFC paid an advance tax of
C860 crore, against C810 crore
year ago.
Mid-sized private sector
lender Yes Bank too has paid
higher amount at C435 crore,
which is up 40 per cent.
Foreign lender Citibank is
learnt to have paid C700 crore,
down 3 per cent from C720
crore last year. Despite the
massive losses reported in the
first quarter,state-owned lender
Bank of Baroda is learnt to have
paid 25 per cent more in
advance tax at C625 crore during the second quarter, against
C500 crore a year ago.
Sectors like steel and pharma have fared well. Tata Steel
paid C250 crore, double of what
it had paid last year. UltraTech
Cement paid 20 per cent more
at C180 crore.
Auto major M&M paid
C200 crore, up 11 per cent over
C180 crore in the same period
last fiscal year.
Among oil majors, IOC’s
payment was up by around 62
per cent at C1,275 crore from
C785 crore a year ago, while
BPCL paid C540 crore, down
around 2 per cent.
FMCG major HUL paid
C500 crore of advance tax, up 9
per cent a year-ago. Bajaj Auto’s
payout was down by around 13
per cent at C390 crore.
?C8
month fell by 8.47 per cent
to $6.74 billion. Non oil
imports dip 15.65 per cent
to $22.44 billion in August
this year.
Exports were in negative
zone
between
December 2014 and May
2016 due to weak global
demand and slide in oil
prices. Shipments witnessed growth only in June
this year thereafter again
entered into negative zone
in July. The export sector
which recorded positive
growth includesengineering, textiles, pharmaceuticals, gems and jewelery and
iron ore.
The statement said that
non-petroleum exports in
August grew by 1.79 per
cent to $19.08 billion.
During April-August,
the exports dipped by 0.52
per cent to $96.98 billion.
It s a i d t h at e x p or t s
growth have also fallen for
the US (-4.35 per cent), EU
(-2.16 per cent), China (4.94 per cent) but Japan
exhibited positive growth
(8.67 per cent) for June.
Oil imports during the
first five months of this fiscal declined by 22.08 per
cent to USD 32.41 billion.
Further, it said services
exports in July contracted
by 4.11 per cent to $12.77
billion.
The net export of services for April-July 2016-17
was estimated at $21.56
billion, which is lower than
net export of $22.37 billion
in the same period last
year, it added.
8=1A845
0??;4B;0B74B8?7>=4%B%B?;DB?A824B1HD?
C>C!!
=4F34;78)FTTZbPWTPS^UcWTX\_T]SX]V8]SXP[Pd]RW^UX?W^]T&
P]S&?[db0__[TWPbb[PbWTS_aXRTb^UcWT_aTeX^dbVT]TaPcX^]
WP]SbTcbX?W^]T%BP]S%B?[dbQhd_c^C!!CWTX?W^]T&
P]SX?W^]T&?[db[Pd]RWTSTPa[XTacWXb\^]cWX]cWTDBPaTb[PcTSc^
WXccWT8]SXP]\PaZTcUa^\>Rc^QTa&fXcW_aXRTbbcPacX]VPcC%
CWTaTXbdbdP[[hP_aXRTSa^_U^acWT_aTeX^dbeTabX^]bfWT]P]Tf
\^ST[XbP]]^d]RTSQh0__[T0RR^aSX]Vc^X]Sdbcahb^daRTbcWT
X?W^]T%B !'61ePaXP]cfX[[]^fQTPePX[PQ[TPcC%Ua^\Xcb
TPa[XTa_aXRTcPV^UC'!PaTSdRcX^]^UC!!CWTX?W^]T%b
?[db !'61ePaXP]cfX[[bTTPbX\X[PaRdcP]SfX[[QTPePX[PQ[TU^a
C&CWT%#61eTabX^]^UX?W^]TB4fWXRWfPb[Pd]RWTSX]
<PaRWcWXbhTPafX[[]^fQTPePX[PQ[TU^aC##S^f]Ua^\
C#(0__[TSXS]^cR^\\T]c^]cWTaTSdRcX^]X]_aXRTb
228>A34AB?A>140608=BC90H?446A>D?8=
<09>A8CH>A34AB
=4F34;78) 2^\_TcXcX^]2^\\XbbX^]WPb^aSTaTS_a^QTPVPX]bc
9PX_aPZPbW0bb^RXPcTbcWa^dVW\PY^aXch^aSTabX]cf^bT_PaPcTRPbTb
X]e^[eX]VaTP[TbcPcT_a^YTRcbX]cWT]PcX^]P[RP_XcP[aTVX^]U^aP[[TVTS
PQdbT^US^\X]P]c\PaZTc_^bXcX^]P]SX\_^bXcX^]^U°d]UPXa±
R^]SXcX^]b^]QdhTab8]Q^cWcWTRPbTbcf^\T\QTab^UcWT
2^\_TcXcX^]2^\\XbbX^]^U8]SXP228WPeTVXeT]cWTXaSXbbT]c]^cTb
fWX[T^_X]X]VcWPccWTR^\_P]hSXS]^cWT[SPS^\X]P]c_^bXcX^]X]
cWTaT[TeP]c\PaZTcP]S°]^RPbTXb\PST^dc±PVPX]bcXc
E834>2>=B<0AC?7>=48=CA>3D24B³?0=82
1DCC>=´
=4F34;78* EXST^R^]B\Pac_W^]TWPbX]ca^SdRTS²?P]XR1dcc^]³
PRa^bbXcbT]cXaT_a^SdRc_^acU^[X^Bd__^acX]V6^eTa]\T]c³b_a^eXbX^]
^UP\P]SPc^ah²?P]XR1dcc^]³cWTQaP]SWPbX]ca^SdRTS²B>B1T
BPUT³T\TaVT]RhaTb_^]bTP__^]Xcb_^fTa_PRZTSb\Pac_W^]T
EXST^R^]2dQT"CWTP__dcX[XiTb_^fTaQdcc^]PbcWT_P]XRQdcc^]c^
bT]SP]P[Tacc^cWT]d\QTabPSSTSX]cWTT\TaVT]Rh[XbcPccWTcX\T
^UaT`dXaT\T]c
\^]Th
347A03D=k5A830H kB4?C4<14A %! %
jca^l
>=62E834B7C>02@D8A4 0338C8>=0;8=C4A4BC8=E0=:>A584;3;>20C43
8=40BCB814A80>5C74ADBB80=5434A0C8>=
>=62EXSTbWP]SXcbfW^[[h^f]TSbdQbXSXPah>=62EXSTbWEP]Z^a]TUc?cT;cSBX]VP_^aT>EE;Y^X]c[h
bXV]TSSTUX]XcXeTPVaTT\T]cbfXcWA^b]TUccWT]PcX^]P[^X[R^\_P]h^UAdbbXPU^aPR`dXaX]VPSSXcX^]P[ bWPaTbX]9B2EP]Z^a]TUcPR^\_P]h^aVP]XbTSd]STacWT[Pf^UAdbbXP]5TSTaPcX^]fWXRWXbcWT^f]Ta^U
EP]Z^a5XT[SP]S=^acWEP]Z^a[XRT]bT4Pa[XTa>=62EXSTbWWPSbdRRTbbUd[[hR[^bTScWTPR`dXbXcX^]^U $_Ta
RT]cbWPaTW^[SX]VX]cTaTbc^]" bc<Ph! %0UcTaR[^bX]V^UcWT_aTbT]ccaP]bPRcX^]>=62EXSTbWfX[[aPXbT
Xcb_PacXRX_PcX^]bWPaTX]EP]Z^a]TUcc^!%_TaRT]cCWTPR`dXbXcX^]XbbdQYTRcc^aT[TeP]c1^PaS6^8P]S
AdbbXP]aTVd[Pc^ahP__a^eP[bP]SXbTg_TRcTSc^R[^bTQhcWTT]S^U! %CWTPVaTT\T]cfPbbXV]TSQh24>
<P]PVX]V3XaTRc^a=PaT]SaP:ETa\P^]QTWP[U^U>=62EXSTbWP]S2WPXa\P]1^PaS^U3XaTRc^ab
A^b]TUcX]<^bR^f8V^aBTRWX]^] #cWBT_cT\QTa! %EP]Z^aXbA^b]TUcbP]SAdbbXPbcWTbTR^]S
[PaVTbcUXT[SQh_a^SdRcX^]P]SPRR^d]cbU^a#_TaRT]c^UAdbbXP]_a^SdRcX^]CWTSPX[h_a^SdRcX^]Ua^\cWT
UXT[SXbPa^d]S#! Q_S^URadST^X[^]P]PeTaPVTP]Sc^VTcWTafXcWTPa[XTaPR`dXbXcX^]^U $_TaRT]c
>=62EXSTbWbbWPaT^USPX[h^X[_a^SdRcX^]Ua^\EP]Z^afX[[QTPQ^dc Q_SCWTPR`dXbXcX^]^U
PSSXcX^]P[ _TaRT]cQTPabbXV]XUXRP]cbcaPcTVXRX\_^acP]RTP]Sf^d[SPSSPQ^dc"_TaRT]cc^cWTTgXbcX]V
>=62EXSTbWb_a^SdRcX^]PccWTRdaaT]caPcTP]SP__a^gX\PcT[h!!<<c^U^X[P]S 12<^UVPbP]]dP[[h
7X]SX3XfPbfPbRT[TQaPcTSPc=C?21PSPa_daBcPcX^]6a^d_6<=:BX]WPaT`dTbcTScWT[PaVTVPcWTaX]Vc^
_a^\^cTcWTdbT^U^UUXRXP[[P]VdPVTP]SdbTcWTbP\TX]SPX[hdbTCWThP[b^aT`dTbcc^\PZT7X]SXPV[^QP[
[P]VdPVTP]S_a^\^cTXcPbP]P\QPbbPS^a^UAPYQWPbWP1PSPa_daBcPcX^]WPb^aVP]XbTS7X]SX?PZWfPaPUa^\
bcc^ #cWBT_cT\QTa! %3daX]VcWXb_TaX^SePaX^dbR^\_TcXcX^]bfTaT^aVP]XbTSU^acWTT\_[^hTTbP]S
UP\X[h\T\QTab^U=C?2P]S28B5_Tab^]]T[P]SbRW^^[b[^RPcTSX]cWTBcPcX^]_aT\XbTbc^_a^\^cT^UUXRXP[
[P]VdPVT66<P]SbT]X^a^UUXRTabVPeTPfPhcWT_aXiTbc^cWTfX]]Tab^UcWTbTR^\_TcXcX^]b
2<3^U?52<:6^T[aTRTXeX]VcWT_aTbcXVX^db³APYQWPbWP:XacX?aPcWP\?dadbZPaX]cWTRPcTV^ah^UaTVX^]
³0U^acWThTPa! $ %Ua^\cWT?aTbXST]c^U8]SXP?aP]PQ<dZWTaYTTPcAPbWcaP_PcX1WPfP]QhcWT3T_Pac\T]c
^U>UUXRXP[;P]VdPVT<X]Xbcah^U7^\T0UUPXab6^8X]cWT_aTbT]RT^UD]X^]7^\T<X]XbcTaAPY]PcWBX]VWP]S
D]X^]<X]XbcTa^UBcPcTU^a7^\T0UUPXab:XaT]AXYXYdCWXb0fPaSfPbaTRTXeTSQh?52U^aCWXaSCX\TX]Pa^f
U^aTgRT[[T]cR^]caXQdcX^]\PSTXcU^aX\_[T\T]cPcX^]^U>UUXRXP[;P]VdPVT
>558280;F41B8C45>A?<D99F0;0H>90=08BFFF?<D99F0;0H>90=02><
0ccT]cX^]^U<X]Xbcah^U?Tca^[Td\P]S=PcdaP[6PbWPbQTT]SaPf]c^P]d\QTa^UUPZTfTQbXcTb
fWXRWWPeTR^\Td_aTRT]c[hX]R^]]TRcX^]fXcWcWT?aPSWP]<P]caXDYYfP[PH^YP]P8cXbc^QaX]Vc^
cWTZX]S]^cXRT^U6T]TaP[_dQ[XRcWPc^UUXRXP[fTQbXcT^U?aPSWP]<P]caXDYYfP[PH^YP]PXb
fff_\dYYfP[Ph^YP]PR^\CWT^UUXRXP[fTQbXcTP[b^R^]cPX]bUaTT[hS^f][^PSPQ[TU^a\bQ^cWX]
4]V[XbWP]S7X]SXc^QTUX[[TSQhcWT_a^b_TRcXeTQT]TUXRXPaXTb6T]TaP[_dQ[XRP]S^cWTabcPZTW^[STab
PaTaT`dTbcTSc^eXbXccWT\T]cX^]TSfTQbXcTU^aP]hX]U^a\PcX^]fXcWaTVPaSc^cWTDYYfP[PH^YP]P
8]RPbT^UP]hS^dQcc^[[UaTT]d\QTa '!%%%%(%\PhP[b^QTR^]cPRcTSU^aR[PaXUXRPcX^]
>]cWT^RRPbX^]^U7X]SX3XePb #cWBT_cT\QTa! %P:PeXBP\\T[P]fPb^aVP]XbTSPc=PcX^]P[2P_XcP[?^fTa
BcPcX^]3PSaX66<=2?B3TQPbXbBPaZPaP]S?aTbXST]c9PVaXcXBP\PY:PbcdaXBPaZPaX]PdVdaPcTScWTTeT]cQh
[XVWcX]VcWT[P\_FWX[TPSSaTbbX]VcWTVPcWTaX]V3BPaZPadaVTScWTT\_[^hTTbc^_a^\^cTAPYQWPbWPP]SdbT^U
7X]SX[P]VdPVTX]cWTXaSPhc^SPhf^aZX]VCWT³7X]SX3XePb0__TP[Ua^\BPaZPafPbP[b^aT[TPbTS7TP[b^aT[TPbTS
APYQWPbWP0[^ZPaTUTaT]RTWP]SQ^^Z_dQ[XbWTSQhAPYQWPbWPBTRcX^]^U=C?23PSaX06<7A4320]X[:d\Pa
3P]VaTPS^dccWT\TbbPVTP__TP[^U2<3=C?2;X\XcTS6daSTT_BX]VWaT[TPbTS^]cWT^RRPbX^]^U7X]SX3XePb
3a?=BX]VW2<>1W^[P=PcW6<>_TaPcX^]bA7PaXZd\Pa7>37AP]SbT]X^a^UUXRXP[bVaPRTScWT^RRPbX^]
CWT"SPhb_TRXP[XbTSTeT]c^U8]SXPCaPST?a^\^cX^]>aVP]XbPcX^]8C?>cWT (cW
TSXcX^]^U8]SXP8]cTa]PcX^]P[BTRdaXch4g_^88B4fX[[R^\\T]RTUa^\ (cW
BT_cT\QTa! %Pc?aPVPcX<PXSP]=Tf3T[WX28B5XbcWTR^^aVP]XbTa^U8]SXP
8]cTa]PcX^]P[BTRdaXch4g_^0RdacPX]aPXbTafPb^aVP]XbTSPc7P[[=^'^U8C?>
?aPVPcX<PXSP]>]cWT^RRPbX^]2<38C?>?aPVPcX<PXSP];26^hP[
0SSXcX^]P[3XaTRc^a6T]TaP[28B5A:?PRW]P]SP0361daTPd^U?^[XRTATbTPaRW
P]S3TeT[^_\T]c1?A3?PaeTi7PhPcfTaT_aTbT]c^]cWT^RRPbX^]
:_W`f_UVcU`^VdeZTS]RT\
^`_VjdTYV^VT`_WZUV_eZR]
?C8Q =4F34;78
overnment on Thursday
said information about
G
those who declare their black
money under the compliance
window, ending September
30, will be kept confidential.
As regards concerns
regarding confidentiality of
the information filed under
the scheme, it is reiterated that
information contained in a
valid declaration is confidential and shall not be shared, an
official statement said.
“In respect of declarations f iled with the
Commissioner of Incometax, Centralised Processing
C entre, B engalur u [CIT
(CPC)], the declaration shall
not be shared even with the
jurisdictional Principal
Commissioner/Commissione
r and payments made under
the Scheme shall not be visible to the jurisdictional officers,” it said.
Form-2 and Form-4
required to be issued in such
8C^UUXRTbc^aT\PX]^_T]
cX[[\XS]XVWc^]BT_")83B
NEW DELHI: The taxman
will undertake a midnight vigil
on September 30 as CBDT has
directed the Income Tax
department to keep their offices
country-wide open in order to
receive declarations under the
domestic black money window the Income Declaration
Scheme (IDS).
“The last date for making
declaration under the IDS, 2016
is September 30, 2016 and
hence the declarations can be
filed till the midnight of that
day. In order to facilitate the filing of declarations even after
the office hours, the Principal
Chief Commissioners are
instructed to ensure that the
counters for receiving the declarations under IDS, 2016
remain open till the midnight of
September 30, 2016 in all jurisdictions,” the CBDT said in an
order on Thursday.
The Central Board of Direct
Taxes (CBDT) is the policymaking body of the I-T department. Officials said the orders
have been received by the tax
offices in the country and have
been issued after a decision in
this regard was approved by the
CBDT Chairperson.
CBDT boss Rani Singh Nair
will also hold a review meeting
in this regard on September 17
along with all the I-T regional
chiefs of the country.
The Government again
made it clear that all information
and declarations that the I-T
department receives till
September 30 under IDS will be
kept ‘confidential and shall not
be shared’ and has suggested that
such declarations can also be
made online using the e-filing
website of the department. PTI
cases shall be system generated by the CPC, it said.
Similarly, it said, the declaration filed with jurisdictional
Principal Commissioner or
Commissioner shall not be
shared with any authority
within or outside the department including the jurisdictional Assessing Officer.
“Further, the payments
under the Scheme shall neither be reflected in 26AS
statement nor can be viewed
by the Assessing Officer in the
Online Tax Accounting
System (OLTAS) of the
Department in the interest of
confidentiality,” it said.
IDS scheme, launched by
the government on June 1 to
uncover black money, closes
on September 30. As per the
IDS facility, one can pay tax
under the scheme by cash in
a bank and no enquiry will be
made by any bank official.
Under IDS one can come
clean by paying tax, penalty
and cess totalling 45 per cent
of the undisclosed income.
0SWTaTc^cX\T[X]T
^]4<ERWX_QPbTS
RPaSb)A18c^QP]Zb
MUMBAI: RBI on Thursday
asked banks to replace existing
magnetic stripe only cards to
EMV Chip and PIN cards by the
deadline of December 2018 and
no extension will be given. EMV
chip cards, which come with a
microprocessor chip that storeand
protect cardholder data, and PINbased cards enhance security and
risk mitigation in card transactions. In August 2015, RBI had
extended time for banks to issue
cards under the Prime Minister
Jan Dhan Yojana (PMJDY)/ Basic
Savings Bank Deposit Account
(BSBDA)/ other government
schemes to September 30, 2016,
and for other cards the deadline
was January 31, 2016.
Despite the extension of time
given to banks, RBI said that some
banks have approached it seeking
further extension of the timeline
for complying with the instructions. “Keeping in the mind the
objective to further enhance the
security and risk mitigation in card
present transactions, and also the
impact it may have on achieving
the timeline for complete migration of all existing magstripe cards,
it has been decided not to grant
any further extension beyond
the respective timeline.” PTI
BWPaT_d[bTbX\_^ac
STP[bX]PSeP]RTfXcW
6^ecbPhb?PbfP]
E^SPU^]Tc^caX_[TXcb]Tcf^aZR^]]TRcXeXchfXcW9X^
NEW DELHI: Cracking down on
private importers of pulses, the
Government on Thursday asked
them to be transparent in their transactions and submit information
about contracted quantities in
advance for better assessment of supplies and formulation of measures
to check prices. Food and Consumer
Affairs Minister Ram Vilas Paswan
held a meeting with pulses importers
to review the status of imports.
Senior officials of Agriculture, Food,
Consumer Affairs, Commerce,
Finance and External Affairs
Ministries, and investigating agencies like ED were present.
“We have decided to have better coordination between pulses
traders and the Government. The
Minister told them to submit their
import plans in advance, for which
they have agreed to do,” a Food
Ministry official said.
PTI
elecom operator Vodafone
India on Thursday said that
T
it has decided to increase inter-
?=BQ =4F34;78
connection capacity with Reliance
Jio network. “Following guidance
from Trai and clarifications from
Jio regarding its commercial
launch, Vodafone India has decided to increase the points of interconnect (POIs) between the two
operators by thrice and accordingly, increase the capacity to connect,” Vodafone India said in a
statement.
Vodafone is the third incumbent operator, after Idea Cellular
and Airtel, that has agreed to
increase inter-connection points
for Reliance Jio, paving the way
for easy exchange of calls between
subscribers of the two networks.
Inter-connection is required to
enable mobile users to make
calls to customers of other tele-
)RUWUDQVIHURIVHFXULWLHV6HEL
HDVHVGRFXPHQWDU\UHTXLUHPHQW
NEW DELHI: Easing the
process of converting physical
securities into demat form,
markets regulator Sebi on
Thursday gave more flexibility
on documentary requirement
for the securities held in single
name without a nominee. The
move is aimed at making transmission of securities more efficient and investor-friendly.
For securities held in single
name without a nominee, an
affidavit from all the legal heirs
made on non-judicial stamp
paper and claim of legal ownership to the securities might be
sought, Sebi said in a circular.
“In case the legal heir/claimant
is named in the succession certificate or probate of will or will
or letter of administration, an
affidavit from such legal
heir/claimant alone would be
sufficient," it added. Besides, for
value of securities up to C2 lakh,
succession certificate or probate
of will or letter of administration or court decree might be
required.
In absence of these documents, a No objection certificate (NOC) from all legal heirs
of the deceased holder or copy
of Family Settlement Deed
duly notarised would be
sought. Transmission refers to
the transfer of securities from
the account of a deceased holder to that of surviving joint
holder, nominee or legal heir.
For valuations of securities
over C2 lakh, a succession certificate or probate of will or
Letter of Administration or
court decree is required. PTI
C^RaTPcTPcad[hR^]]TRcTSX]R[dbXeTP]S
3XVXcP[8]SXPXcXbeXcP[c^WPeTP[TeT[
_[PhX]VUXT[SQTcfTT]_a^eXSTab^UUTaX]V
cWTbP\TbTaeXRTT]R^daPVTX]]^ePcX^]b
P]SYdSXRX^db[hdbTP_^acU^[X^^U
cTRW]^[^VXTb!6"6P]S#6c^bTaeXRT
cWTTe^[eX]V]TTSb^UR^]bd\TabPRa^bb
cWTR^d]cahbPhbE^SPU^]T
com networks. A mobile operator levies inter-connection usage
charge for each incoming call it
gets from a subscriber of another network.
Incumbent carriers have
been demanding higher interconnection charges compared
with 14 paise they get for each
incoming mobile call on their networks. Reliance Jio, which commercially launched its services on
September 5, has accused the
existing players of not releasing
sufficient inter-connection ports
which it feels is leading to call
drops. “Vodafone India has
always provided points of interconnect (PoIs) to other operators
for all their fair, reasonable and
legitimate requirements and will
continue to do so,” Vodafone said.
“Vodafone is hopeful that all
issues it has raised with Trai and
Jio will be duly considered and
resolved at the earliest.” The
Telecom Regulatory Authority of
India has indicated that it will take
strong action against telecom
operators found responsible for
poor quality of service.
Jio has alleged that the situation on its network has deteriorated significantly in the last few
weeks due to insufficient PoIs,
with over 75 calls failing out of
every 100 call attempts. As per the
rules, not more than 5 calls can
fail in every 1,000 calls made during a month. It further said that
over 22 crore calls have failed on
the Airtel network while 52 crore
have failed cumulatively on the
networks of the three incumbent
operators -- Airtel, Vodafone
and Idea in about last 10 days.
“To create a truly connected, inclusive and Digital India, it
is vital to have a level-playing
field between providers offering
the same service, encourage
innovations and judiciously use
a portfolio of technologies - 2G,
3G and 4G to service the evolving needs of consumers across
the country,” Vodafone said.
=QebYdYecX_`Ucd_bU]QY^
]QZ_b649c_ebSUd_9^TYQ
?C8Q =4F34;78
auritius on Thursday
expressed hope to remain
M
one of the biggest investment
routes to India post revision of
the bilateral tax treaty, as the two
nations move ahead with talks
on trade liberalisation pacts.
After meeting Finance
Minister Arun Jaitley, Mauritian
Minister of Finance and
Economic Development
Pravind Kumar Jugnauth said
the negotiations on Preferential
Trade Agreement (PTA) and
Comprehensive Economic
Cooperation Partnership
Agreement (CECPA)are moving ahead. “In fact, there is now
a delegation from Indian side
visiting Mauritius. There has
been a preliminary draft agreement which will need to be further looked up and discussed.
We are looking forward that
through that agreement we can
extend opportunities for both
Mauritius and India. We have to
increase trade and investment,”
he said.
When asked if FDI inflows
to India from Mauritius will
reduce following revision of
the bilateral Double Taxation
Avoidance
Convention
(DTAC), Jugnauth expressed
hope that the island nation will
continue to ‘play the role of the
biggest investment route to
India’ because it benefits both
the nations. “We need to monitor the situation and we will
review and discuss as and when
there is necessity,” the visiting
minister added. He said the two
countries have successfully
agreed for changes and the protocol on DTAC has already
been signed.
“We are looking now how
to consolidate the relationship
between India and Mauritius,”
he said. After long-drawn negotiations, the amendment to the
1983 DTAC was signed by India
and Mauritius in May. With the
changes, India can impose capital gains tax on investments
routed through Mauritius.
=ReVcVT`gVcj]ZWedDV_dVi%"aed
MUMBAI: Bouncing back towards
the fag-end in an otherwise choppy
trade, Sensex on Thursday closed 41
points up at 28,412.89 with FMCG,
healthcare and realty stocks leading the
gains, tracking a mixed global trend.
Cautious stance adopted by participants, tracking mixed trend in regional markets ahead of the
next week’s US Federal Reserve and Bank of Japan policy meets
too influenced trading sentiment.
“The investors have adopted a wait-and-watch approach
to the global sentiment which is playing between cautious and
optimism over the FOMC meet early next week. Currently, FII's
are sellers in the market,” said Vinod Nair, Head of Research,
Geojit BNP Paribas Financial Services. The 30-share Sensex
after shuttling between 28,454.02 and 28,311.11, settled
40.66 points or 0.14 per cent higher at 28,412.89.
PTI
<X]XbcTa^UBcPcT8]ST_T]ST]c2WPaVTU^a
;PQ^daP]S4\_[^h\T]c6^81P]SPad
3PccPcaThPX]2F0RWXTeT\T]cb8]XcXPcXeTb
^U4B82SdaX]VcWT_Pbccf^hTPab
;<PaZTc3TeT[^_\T]c7TPS6PdcP\6P]Vd[hfXcWA3T_X]STa6a^eTaSdaX]VcWT5Xabc2a^bba^PSb<d[cX
1aP]S2PaF^aZbW^_[Pd]RWX]=^XSP^]CWadbSPhAP]YP]3X\aXkCWT?X^]TTa
INDIAN ORDNANCE FACTORIES
MACHINE TOOL PROTOTYPE FACTORY AMBARNATH
Government of India, Ministry of Defence
NOTICE INVITING OPEN TENDER
(E-Procurement)
The General Manager, Machine Tool Prototype Factory, Ambarnath (India) on behalf of the
President of India invites Open Tender (Two Bid System), from the Indian manufacturers
for following Item:
TE No
Item Description
Qty
Tender
Opening Date
16TE220480
Design, manufacturing, supply & prooving of
dtd: 23/08/2016 test stand for testing of wheel carriage assembly
01 No 23/09/2016
of Dhanush (bofors) 155MM Assembly as per
scope of work attached.
16TE220487
Transportation charges for 'transportation of
dtd: 23/08/2016 defence store including loading from MPF
10WJ
30/09/2016
Ambarnath to GCF/ COD Jabalpur Load carrying
capacity of truck required 3 MT. (As per scope
of work enclosed)
Note. All relevant details, & Terms and conditions etc are available on website :
www.tenders.gov.in and OFB Website http://ofbeproc.gov.in
davp 10201/11/1050/1617
f^a[S !
347A03D=k5A830H kB4?C4<14A %! %
3KLOLSSLQHV
3UHVLGHQW
µRQFHNLOOHG
PDQZLWK8]L¶
Manila: Philippine President
Rodrigo Duterte allegedly
once shot dead a justice
department agent with an Uzi
submachine gun while serving
as mayor of Davao.
The allegation was made
by Edgar Matobato, a self-confessed former death squad
member, before a Senate
inquiry on extra-judicial
killings.
Duterte, he alleged,
ordered him and others to kill
about 1,000 criminals or political rivals over a 25-year period. One Government Minister
called the allegations “lies and
fabrications”
Justice Secretary Vitaliano
Aguirre said Matobato was
“obviously not telling the
truth” while presidential
spokesman Martin Andanar
said investigations into the
president’s time as mayor had
gone nowhere.
Matobato, 57, said he had
been a member of the Davao
Death Squad, a notorious vigilante group allegedly responsible for hundreds of killings.
“Our job was to kill criminals like drug pushers, rapists,
snatchers,” he said.
But he also said that Mr
Duterte’s opponents had been
targeted too, including four
bodyguards of a local rival for
mayor, Prospero Nograles.
In 1993, he said his group
had injured a justice department agent after a confrontation at a road block. Agencies
9Z]]RcjEcf^agZcefR]]j 86WRHQGHPHUJHQF\DJDLQVW0\DQPDU
=ZWedR_TeZ`_d
@SR^R^VVed
eZVUZ__Vha`]]d
2f_XDff<jZ
74?D;;B074038=>78>5;>A830*1>C7A4;40B4
3>2C>ABA4?>AC>=C748A³4G24;;4=C´740;C7
BA0906>?0;0= Q
F0B78=6C>=
ith Republican Donald
Trump surging in a series
of new polls, the big lead that
Hillary Clinton enjoyed for
well over a month has all but
vanished and the two are now
virtually tied nationally. And in
the race for key battleground
States as well, Trump has managed to pull ahead of her in
Florida and Ohio for now.
Even as Clinton resumed
her campaign after a three-day
layover following her pneumonia-induced medical
episode last Sunday and
released new medical records
along with her doctor’s note
that she is “fit to serve” as
President, the news from pollsters was anything but cheery.
The latest poll from New
York Times/CBS News, released
on Thursday, said the two were
tied 42-42 per cent in a fourway race, with two third-party
candidates (Libertarian Gary
Johnson and Green Party’s Jill
Stein) thrown in the mix. In a
head-to-head matchup, the poll
said Clinton has a 2 per cent
edge against Trump among
likely voters.
A RealClearPolitics average
of nine different polls conducted so far this month also
gives Clinton a negligible 1.8
per cent advantage over her
;^]S^])0b[XRT^U@dTT]EXRc^aXP³b
fTSSX]VRPZTSPcX]VUa^\cWT (cW
RT]cdahWPbUTcRWTS $_^d]Sb
PcP]PdRcX^]WTaTCWTRPZTfWXRW
WPbbdaeXeTSUa^\@dTT]EXRc^aXP³b
fTSSX]Vc^?aX]RT0[QTacX] '#
fPbb^[SQh9TabThR^[[TRc^a3PeXS
6PX]bQ^a^dVWA^QTacb
0_aTbT]cPcX^]Q^gX]bRaXQTS
fXcW°CWT@dTT]³b1aXSP[2PZT
1dRZX]VWP\?P[PRT5TQh '#±P[b^b^[SfXcWRPZTP[^]V
fXcW@dTT]EXRc^aXP³bbXV]PcdaT^]
_P_TafXcWcWTa^hP[Rh_WTaCWT
\^]PaRW³bZ]XRZTabZThbUa^\cWT
CXcP]XRP]SFX]bc^]2WdaRWX[[³bWPc
P[b^b^[SUa^\WXbR^[[TRcX^]Pc
2WaXbcXT³bX];^]S^]^]FTS]TbSPh
cWT112 aT_^acTS
?C8
BA0906>?0;0=Q F0B78=6C>=
resident Barack Obama has
announced that the United
P
States will terminate the national emergency against Myanmar
and lift “soon” all the remaining sanctions in recognition of
the country’s progress towards
democratic reform.
Obama made the pledge
W
B[XRT^U@dTT]
EXRc^aXP´bfTSSX]VRPZT
b^[SU^a $_^d]Sb
0\P]PaaP]VTb]Tfb_P_Tab
Ua^]cX]V_W^c^b^UDB
?aTbXST]c1PaPRZ>QP\PP]S
<hP]\Pa´bBcPcT2^d]bT[[^a
P]S5^aTXV]<X]XbcTa0d]V
BP]Bdd:hX
0?
rival — down from a near 8
point lead as of August 9.
Other polls focusing on
major battleground States also
found Trump making swift
inroads. A CNN/ORC poll
released on Wednesday said
Trump now leads Clinton 4641 per cent in Ohio, and 47-44
per cent in Florida. A
Bloomberg Politics poll also
found him enjoying a 5-point
lead (48-43 per cent) in Ohio.
The changing outlook
indicated in the new polls
comes with the Election Day
less than eight weeks away
and the first of three presidential debates less than two
weeks away.
Ecf^a¶dZ_gVde^V_eZ_:_UZRe`
Z^aRTeFDW`cVZX_a`]ZTj+CVa`ce
Washington: Donald Trump’s investments in real estate overseas, including in Indian cities of Pune and Gurgaon, could have
implications on America’s foreign policy if the Republican presidential nominee wins the elections and occupies the White House
next January, a major US weekly said.
In its cover story on Trump’s investments in properties overseas, the Newsweek on Wednesday said as Republican National
Convention was about to get underway in July, the Trump
Organization declared it was planning a massive expansion in
the South Asian country.
“That is a chilling example of the many looming conflicts
of interest in a Trump presidency,” the weekly noted. “If he plays
tough with India, will the government assume it has to clear the
way for projects in that ‘aggressive pipeline’ and kill the investigations involving Trump’s Pune partners? And if Trump takes
a hard line with Pakistan, will it be for America’s strategic interests or to appease Indian government officials who might jeopardise his profits from Trump Towers Pune?” the weekly asked.
According to the weekly, several Indian political leaders
including from the both BJP and the Congress have established
close relationship with the Trump family as a result of its real
estate investment in Pune and Gurgaon.
PTI
He insisted, “Russia has
respected its obligations to fulfil the ceasefire regime in Syria
from the first minute.” US officials have voiced scepticism that
Russia will fulfil its part of the
agreement struck last week
between the two former Cold
War adversaries after years of bad
ADBB80=0A<H278458=
CDA:4HC>38B2DBBBHA80
0]ZPaP)AdbbXP³bc^_0a\h6T]TaP[
^]CWdabSPhfPbW^[SX]VcP[ZbfXcW
WXbCdaZXbWR^d]cTa_Pac^]cWT
R^]U[XRcX]BhaXPX]cWTWXVWTbc[TeT[
\X[XcPahR^]cPRcQTcfTT]cWTcf^
R^d]caXTbbX]RTPRaXbXbX]aT[PcX^]b
CdaZXbWRWXTU^UbcPUU7d[dbX0ZPa
fT[R^\TSWXbAdbbXP]R^d]cTa_Pac
6T]TaP[EP[Tah6TaPbX\^ec^
0]ZPaPX]PRTaT\^]hfXcWUd[[
\X[XcPah_a^c^R^[CdaZXbWcT[TeXbX^]
_XRcdaTbbW^fTS
Myanmar’s de facto leader Aung
>R]RjdZRT`_WZc^dER_kR_ZR
UVScZdTR^VWc`^>9$(!
05?Q :D0;0;D<?DA
piece of aircraft wreckage
found in June off Tanzania
A
has been confirmed as
coming from the doomed airliner MH370, Malaysia said on
Thursday.
The debris, found on
Pemba Island off the Tanzanian
coast, is the latest piece of
wreckage to be linked to the
Malaysia Airlines jet, whose
disappearance remains a mystery. Malaysia’s Transport
Ministry said the piece of
debris, which had been taken
to Australia for expert analysis,
was found to have part numbers, date stamps and other
identifiers confirming it came
from the Malaysia Airlines jet.
“As such, the experts have
concluded that the debris, an
outboard flap, originated from
the aircraft 9M-MRO, also
known as MH370,” a ministry
statement said.
“Further examination of the
debris will continue in hopes
that evidence may be uncovered
which may provide new insight
5XVVLDQPLOLWDU\86µQRW
IXOILOOLQJ¶6\ULDDJUHHPHQW
Moscow: Russia on Thursday
accused Washington of failing
to meet its obligations under
the Syria ceasefire agreement,
while criticising US officials for
voicing scepticism over cooperation with Moscow.
Russian military spokesman
Igor Konashenkov slammed
the US for what he called
“rhetorical fog” intended “to
hide the fact that it is not fulfilling its part of the obligations.”
In a statement, he defined the
US role as “first and foremost to
separate ‘moderate opposition’
groups from terrorists”.
“As of the third day (of the
truce), only the Syrian army is
observing the regime of silence.
At the same time, the ‘moderate opposition’ led by the US is
increasing the amount of
attacks on residential districts,”
Konashenkov said.
following a meeting with
blood over Moscow’s Ukraine
and Syria policies.
AFP
BHA80A468<4<DBC0;;>F083
34;8E4A84B³8<<4380C4;H´)D=
6T]TeP)CWTD=BhaXPT]e^hPbZTS
cWT3P\PbRdb6^eTa]\T]cc^
P[[^fWd\P]XcPaXP]PXSST[XeTaXTb
°X\\TSXPcT[h±X]SXRPcX]VcWT
aTVX\TWPSQa^ZT]Xcb_[TSVTb^]
cWTSXbcaXQdcX^]^U[XUTbPeX]V
bd__[XTbBcPUUP]ST<XbcdaPc^[S
aT_^acTabX]6T]TePcWPcZTh
6^eTa]\T]cP[[hAdbbXPPVaTTS
RadRXP[cX\TfPbQTX]V[^bc^]cWT
ST_[^h\T]c^UPXSR^]e^hbfWXRW
XbPZTh_Pac^UPRTPbTUXaTcWPc
QTVP]<^]SPh
into the circumstances surrounding flight MH370.”
Authorities had earlier said
the piece of debris was “highly likely” to have come from
MH370. However, the confirmation appears to have so far
shed no fresh light on the
plane’s fate.
The Malaysia Airlines jet
was carrying 239 passengers
and crew when it disappeared
en route from Kuala Lumpur to
Beijing on March 8, 2014. It is
believed to have crashed into
the Indian Ocean, but an exten-
sive deep-sea hunt off
Australia’s west coast is drawing to a close with nothing
found yet.
However, several pieces of
debris that apparently drifted
thousands of kilometres toward
the African coast have been
identified as definitely or probably from the Boeing 777.
Those finds have confirmed the plane went down
but have so far shed no light on
why and have fuelled questions
over whether the official search
is focused in the right area.
:Xa_P]RPaahX]VBXZWb^aSTaTS
c^[TPeTbc^aTX]2P]PSP
?C8Q C>A>=C>
wo elderly Sikh men were
stopped by staff and security at a store in Canada and
told they could not enter with
their kirpans.
Harpal Gill, says in the 16
years he has lived in Canada, he
has never been told to leave a
store because of his kirpan, a
ceremonial dagger carried by
Sikhs. “It is my religious symbol. How can you stop me?”
Gill asked the manager of the
Dollarama store.
“I showed her the kirpan
and she said, ‘It is a weapon, a
knife; it is dangerous,’” Gill was
quoted as saying by CBC news.
Despite the fact the two
have been in the store many
times before, they were told to
leave. “It is allowed in the legislature, it is allowed in the federal Government,” Gill added.
A spokesperson at the
T
Dollarama head office said this
is the first time there has been
an issue in any of their stores
across Canada.
Lila Radmanovich, who
works for Dollarama’s media
relations, said the company has
a customer service policy that
does not allow discrimination
based on ethnicity or religion.
The company has reached
out to the Manitoba Sikh
Society and offered apologies to
the men. The company is now
working with staff and security at the Winnipeg store to
teach them the company’s policy, Radmanovich said.
San Suu Kyi in what was her first
official visit to Washington.
“In part because of the
progress that we’ve seen over
the last several months, I indicated, after consulting with
Daw Suu, that the United States
is now prepared to lift sanctions
that we have imposed on
Burma for quite some time,”
Obama said in remarks after a
bilateral meeting at the Oval
Office on Wednesday.
Obama termed it “the right
thing to do in order to ensure
that the people of Burma see
rewards from a new way of
doing business and a new
Government”.
6;>14
CA>CC8=6
134B7;0FH4A908;43
5>A HAB8=;40:20B4
3WPZP) 01P]V[PSTbWR^dac^]
CWdabSPhbT]cT]RTSP[PfhTa^U
TgTRdcTS (& fPaRaX\X]P[P]S
1=?[TPSTaBP[PdSSX]@dPSTa
2W^fWSdahc^ hTPabX]YPX[U^a
bcTP[X]VP]S[TPZX]VcWTSaPUc
eTaSXRc^UP]X]cTa]PcX^]P[
caXQd]P[PWTPS^UXcbST[XeTahX]
! "1P]V[PSTbW2hQTaCaXQd]P[
9dSVT:<BWP\bd[0[P\P[b^
UX]TS[PfhTa5PZWad[8b[P\CPZP
Ra^aT^eTacWT[TPZcWPcWPS
b_PaZTS\PbbXeTR^]ca^eTabhPb
2W^fSWdahP]SWXbUP\X[h
\T\QTabPccWPccX\TR[PX\TS
cWTeTaSXRcfPb_aT_PaTS
QTU^aTWP]SQhcWT;Pf<X]Xbcah
X]bcTPS^UcWTcaXP[R^dac
5>DA:8;;438=?;0=4
2A0B78=278=0
1TXYX]V) 0[XVWcPXaRaPUcRaPbWTS
^]CWdabSPhSdaX]VP]PXabW^f
X]BWXYXPiWdP]VX]7TQTX
?a^eX]RTZX[[X]VP[[U^da_T^_[T
^]Q^PaSCWT_[P]T;4$
\^ST[fXcW#$bTPcbfPb
_a^SdRTSQh0E828]Sdbcah2^a_
>U2WX]P0_X[^cP]ScWaTT
Rdbc^\TabfTaT^]Q^PaSfWT]
cWTPRRXST]cWP__T]TSPc#_\
!C>DA8BCB:8;;438=
10;81>0C4G?;>B8>=
1P[X) Cf^U^aTXV]c^daXbcbfTaT
ZX[[TSP]SPQ^dc!^cWTa_T^_[T
fTaTX]YdaTSX]P]Tg_[^bX^]^]
CWdabSPh^]Pb_TTSQ^PccWPc
fPbUTaahX]VcWT\Ua^\cWT
8]S^]TbXP]c^daXbcXb[P]S^U1P[X
c^;^\Q^Z_^[XRTbPXS
278=0!=3B?024;01
;0D=27BD224BB5D;
1TXYX]V) 2WX]P^]CWdabSPh]XVWc
bdRRTbbUd[[h[Pd]RWTSXcbbTR^]S
Tg_TaX\T]cP[b_PRT[PQ
²CXP]V^]V!³Pb_Pac^UP]
P\QXcX^db_a^VaP\\TQhcWT
2^\\d]XbcVXP]cc^QdX[SP
\P]]TSb_PRTbcPcX^]Qh!!!
cWTcX\TfWT]DB[TS
8]cTa]PcX^]P[B_PRTBcPcX^]
Tg_TRcTSc^V^^dc^UbTaeXRT
F>A;3B>;34BC<0=
8=8BA04;CDA=B "
9TadbP[T\) CWTf^a[Sb^[STbc
\P]cda]TS "^]CWdabSPh
P]ScWT7^[^RPdbcbdaeXe^a[XeX]V
X]8baPT[aTPSXTSU^acWT1Pa
<XciePWWTfPbST]XTSPRT]cdah
PV^WXbUP\X[hbPXSHXbaPT[
:aXbcP[P]^QbTaeP]c9TfUa^\
IPa]^fX]fWPcXb]^f?^[P]S
P]S[XeX]VX]7PXUPfPbQ^a]^]
BT_cT\QTa $ ("cWaTT
\^]cWbQTU^aTcWTFaXVWc
Qa^cWTabUXabcbdRRTbbUd[
_^fTaTSPXa_[P]TU[XVWc
=`_XURjeZ^V_Rad
]Z_\VUe`Z_TcVRdVU
UZRSVeVdcZd\
Tokyo: Napping for more than an hour
during the day could be linked to 45
per cent increased risk of type 2 diabetes, a new study has warned.
Researchers at the University of
Tokyo used data
from 21 studies
involving more than
300,000 people.
They found that
after 60 minutes napping becomes harmful, with risk increasing the more time a person is asleep.
However, there was no link with naps of
less than 40 minutes. They said long naps
could be a result of disturbed sleep at
night, potentially caused by sleep apnoea.
This sleeping disorder could
increase the risk of heart attacks,
stroke, cardiovascular problems and
other metabolic disorders, including
type-2 diabetes.
;TUcXbc_a^cTbcTabcWa^fP_Tca^[Q^\QPc_^[XRT\T]SdaX]VR[PbWTbX]?PaXb^]CWdabSPh
0?
2YHUHDWLQJRQ(LG2YHU.YLVLW.DUDFKLKRVSLWDOV
Karachi: Over 4,000 people went to
private and Government hospitals
due to ailments linked to overeating
on Eid-ul Azha in Karachi, the capital of Pakistan’s southern Sindh
province. The Health Department
said that people went to private and
Government hospitals complaining
of diarrhoea, dehydration and vomiting after the festival marked by traditional feasts.
More than 2,200 people visited
Jinnah Post Graduate Medical
Complex, 1,000 people
went to Civil Hospital
Karachi, 500 had visited to
Abbasi Shaheed Hospital,
Geo TV reported, quoting
a spokesman for the
Health Department.
Due to overeating gastro, dehydration, vomiting are common on
Eid-ul-Azha, Deputy Director
Abbasi Shaheed Hospital Dr Huma
Ahmed said, adding that people
should take minimum meal and try
to avoid eating oily and
junk food.
Director Health
Karachi Dr Shakoor
Abbasi suggested that
people should take vegetables in lunch and
dinner beside meat or mutton and
avoid soft drink specially heart, diabetic and hypertension patients.
Approximately 1,000 people also
visited hospitals for injuries sustained
while sacrificing animals.
eXePRXch "
347A03D=k5A830H kB4?C4<14A %! %
&KHHUVWRHOHJDQFH
?^^YP7TVST´b
]TgcUX[\39
322-$+(*'(ODVWVHHQLQ+ULWKLN
5RVKDQVWDUUHU0RKHQMR'DURKDV
EHHQFDVWRSSRVLWH$OOX$UMXQLQ
XSFRPLQJ7HOXJXILOP'-'XYYDGD
-DJDQQDGKDPUHYHDOHGDVRXUFH
´3RRMDKDVEHHQILQDOLVHGDV
WKHOHDGLQJODG\IRU'-
6KHSOD\VD
FRQWHPSRUDU\JLUOLQ
WKLVURPDQWLFGUDPD
DQGKHUUROHZLOO
DSSHDOWRDOO
VHFWLRQVRIWKH
DXGLHQFHµVDLGD
VRXUFH
7REHKHOPHGE\
+DULVK6KDQNDU
WKHSURMHFWZLOOEH
EDQNUROOHGE\'LO
5DMXZKRKDV
UHXQLWHGZLWK
$UMXQDIWHU
VHYHQ\HDUV
7KHUHJXODU
VKRRWLQJRI
WKHSURMHFW
ZLOO
FRPPHQFH
IURP
2FWREHU
7KLVZLOOEH
3RRMD·VWKLUG
7HOXJX
RXWLQJDIWHU
0XNXQGD
DQG2ND
/DLOD.RVDP
³8S^P[^c^U
Ud]SaPXbTab
U^aRWX[SaT]
fW^PaT
UXVWcX]V
RP]RTa8P\
f^aZX]V^]
cWXbU^ahTPab
P]S:P_X[BWPa\P
WX\bT[URP\Tc^\TP]S
cP[ZTSPQ^dcQTX]VP
_Pac^UcWXb7TbPXS0P_
\dYWTX]e^[eTZPa^Xb
\TX]
°EXeTZ>QTa^X
1aX]VX]Vc^VTcWTa^]T^UcWT
f^a[S³bQXVVTbcXR^]bfXcWPV[^Q
P[R^\TShbcPa30E83142:70<
WPbaTd]XcTSfXcW:TeX]7PacU^a
cWT]Tf²<^STa]4bbT]cXP[b
bT[TRcTSQh3PeXS1TRZWP\³RP\
_PXV]U^a7<CWTR^\\TaRXP[Xb
bTc^]Pa^PScaX__XRZX]VcWT
bc^ahd_Ua^\cWTXaUXabc7<
R^\\TaRXP[c^VTcWTafWTaT:TeX]
_aT_PaTSc^_[PhcWTa^[T^U3PeXS
X]PQX^_XRUX[\
<PZTab^UC^\
2adXbTUX[\bdTS
7KHIDPLO\RIDYLFWLP
RIWKH&RORPELDSODQH
FUDVKWKDWRFFXUUHG
GXULQJWKHSURGXFWLRQRI
720&58,6(
VWDUUHU$PHULFDQ
0DGHKDVILOHGD
ZURQJIXOGHDWKVXLW
DJDLQVW,PDJLQH
(QWHUWDLQPHQW
DQGRWKHU
SURGXFWLRQ
FRPSDQLHV
7KHVXLWFODLPV
WKDWVDIHW\ZDV
FRPSURPLVHG
EHFDXVHIOLJKW
RSHUDWLRQVZHUH
UXVKHGWRVDYH
PRQH\ZKHQWKH
PRYLHZKLFKZDV
RULJLQDOO\WLWOHG0HQD
IHOOEHKLQG
VFKHGXOH
ontrary to the perception of India
not being a patch on the world wine
map, the wine producers of India are
swiftly making their mark on national and
international markets. The home-grown
brews are now being picked up by retail
majors and restaurants in the West which
is traditionally believed to have a more
evolved nose for the good stuff. Marks and
Spencers, in fact, recently picked up Sula
for its shelves. Over the past decade and
a half, wine culture has been making steady
inroads into the drinking habits of Indians.
Consumption of wine has led to a steady
20 percent growth of the
industry, the most consistent
growth in the spirits segment despite the tough
years between 2005 and
2011.
“The Indian drinking culture was dominated by whisky and
beers for a long time.
But wines have been
accepted at last, courtesy
women, the youth and
the lifestyle seeker. And
slowly and quietly, India has
worked on terroir, technique
and grapes to get the finer taste
and finish”, said Sonal Holland,
the first Masters of Wine here. “We
are one of the fastest growing economies
in every aspect and wine is no exception.
At the pace at which it is growing, we are
well on our way to making our impact on
global wine forums,” she added.
India is becoming one of the formidable wine-producing countries in the world
courtesy the makeover induced by massive
spends on research and development.
Wine producers also think that this is the
right time for the evolution of a wine culture. “Being the fastest growing wine market in the world, there is a great opportunity for Indian wines to gain popularity
and compete against the Western brands.
India is the market for the next decade”,
said Rajeev Samant, founder and CEO of
Sula Vineyards. “We sell 95% of
our wines in India and only 5%
is exported. Our export bouquet has the finest and the
most premium range. We have
C
8]SXPXbQTR^\X]V^]T
^UcWTU^a\XSPQ[TfX]T
_a^SdRX]VR^d]caXTbX]
cWTf^a[SP]S^]T^U
cWTUPbcTbcVa^fX]V
R^]bd\Ta\PaZTcb
C40< E8E0 aT_^acb
clearly broken the image of being average.
This shows the growing market India is
becoming.”
So what are the growth drivers? “The
health benefit of wine is one of the major
reasons for increased consumption. The
red variety, especially, has medically
proven health benefits,” said Ravi Gurnani,
director, York Wines. “Apart from that,
wine is a perfect social drink. A glass of
wine in your hand will say elegant, not
hungover or wasted the next day”, he
added. Talking about the experiments done
in wine-making, he said “The experimentation with wine-making is not extended
to the wild limits. We do experiments but
not on the cost of quality of wines.
The Indian producers of wine are
also keen on keeping their product the
best. The regular quality check of
vines, surveying palate fests worldwide, getting international oenologists from both the new and old
worlds for testing and competitive
pricing are some of the reasons,
The extensive research and adapting the correct procedure for
wine-making is also pushing the
wine markets on the growth curve.
Historically, wines were there
over 3,000 years ago. The Moghul
kings, who ruled India before the
British, are known to have been
wine connoisseurs and there is
record of wines imported from
Persia for them and the nobilities.
They also encouraged wine production
for their consumption but phylloxera
destroyed all the vines in 1890s. No new
vines were planted till about 30 years ago.
Now that India is enjoying its wine, there
are still some problems that need to be
attended. “Duties of up to 300% or more
make imported wines extremely expensive. There are several other latent costs
and procedural barriers since wine is still
categorised as liquor. The Indian
Constitution is anti-alcohol and exhorts
the States to introduce prohibition and
gives them the power to form independent
policies,” said Subhash Arora, founder
president of Delhi Wine Club. “It’s like
dealing with different countries, each with
its own complex policies,” he
added.
FWTaTcf^]PcX^]b\TTc
1RWKLQJFDQEHPRUHVRRWKLQJIRUDFRXQWU\ZKLFKKDVZLWQHVVHGDVHULHVRI
WHUURUDFWVLQWKHUHFHQWSDVWRWKHUWKDQWRHQJDJHZLWKFXOWXUHDQGDUW
$53,7$ 6,1*+ UHSRUWVRQ1DPDVWH)UDQFHDFXOWXUDOIHVWLYDORI,QGLDLQ
)UDQFHEHJDQRQ6HSWHPEHUDQGZLOOFRQFOXGH1RYHPEHU
all it a cultural bonaza.
From films of none
other than Satyajit Ray
to recitals by dancers Astad
Deboo and Raja and Radha
Reddy, Namaste France, is a
rare art feast to France by
India.
Indian traditional arts,
music, dance, theatre, cinema,
yoga, fashion and literature
will be showcased at ‘Namaste
France’, a festival organised by
the Embassy of India in Paris
in collaboration with the
Indian Council for Cultural
Relations (ICCR).
Indian classical dancer
and choreographer of Odissi
dancing
style,
Sonal
Mansingh, who is also performing in the festival,
says,“Dance is a dynamic yoga
and I am going to present
something that would make
the Indian dance forms and
dancers unique. The presentation will be a a fusion of different art forms, which will be
glimpse of life. I will try to present dance as a darshan”, says
the dancer, who is also proficient in Bharatnatyam,
Kuchipudi, and Chhau .
Pandit Bhajan Sopori, the
ace santoor maestro, another
participant in the festival, says
that “It’s a kind of cultural
C
n effort to make people
write again, the multi handA
made paper platform-Chamber
of
Ink
has
launched
‘PaperBlanks’ and ‘Paper-Oh’
products to the Indian customers. The products include
journals, dayplanners, address
books and guest books in three
sizes, ranging from 1100 to
1900. As per the owners, the
prices are high because it also
includes some percent of royalty that the brand pays to the
artists whose work has been
used.
“India is a country of art and
culture. The inspiration required
for our products has been
diversely fulfilled here. We as a
handmade paper maker believe
in eco-friendly products with
artistic touch. The notebooks are
either Smyth sewn with minimal
glue or hand stitched which
makes the book open as flat as
possible and the pages never fall
out”, said Sukriti Jiwarajka,
founder of the brand. The writing paper is sourced 100% from
sustainable forests and is uncoated with no added veneer and the
exchange that
youth
from
France and India
will together
showcase their
cultural tradition.”
Sopori
adds,
“This collaboration of two countries is a good
experiment and it
will definitely create a long-lasting
memory in the heart and
mind of the people of both the
countries.”
“Namaste France will be
a milestone, as it is wonderful to bring together people for
cultural exchanges”, says
Ambassador of France to India
Alexandre Ziegler.
He further says,
“France and India
shares a historical
tie in the terms of
culture, fashion and
art, which is also
reflected in excellent bilateral relationship. FranceBonjour India, a
similar kind of cultural festival will be
organised next year in India”.
As many as 30 films of
Satyajit Ray including The Big
City, The Fortress and The
Elephant will be screened at
the festival. Spiritual leader Sri
Sri Ravi Shankar, fashion
designer Rahul Mishra and
Michelin-starred chef Vineet
Bhatia will also be a part of
Namaste France. During the
mega cultural festival two
major Indian festivals-Diwali
and Navratri--would be celebrated.
Contemporar y Indian
dance performance ,‘Divine
Rhythms’, by legendar y
dancer-choreographer Astad
Deboo, kathak by Kumudini
Lakhia, recitals by renowned
kuchipudi duo Raja and Radha
Reddy, by violin maestro L
Subramaniam and sarod by
Amaan and Ayaan Ali Khan
will be the major highlights of
the Namaste France Festival.
The festival is taking place in
23 cities of France.
:DB70=<8CA0
1=5B931DBE3;I518
FWPc0\TaXRP]bRP[[²CadRZb³PaTQXVQdbX]Tbb
U^acWTPdc^X]Sdbcah^dcWTaTP]ScWThS^]c
VTc\dRWQXVVTacWP]cWTUP\^db5^aS5 $
hat Americans call ‘Trucks’
are big business for the auto
W
industry out here and they don't
get much bigger than the famous
Ford F150.
As much as we might complain
about the size of late SUV’s on
Indian roads, these vehicles pale in
comparison to these monsters you
see in America. Take the newly
launched Jeep Grand Cherokee, in
the US it looks positively puny in
comparison to vehicles such as the
Cadillac Escalade. And then there
are what Americans call ‘Trucks’,
now these are not trucks as you and
I know trucks in India, these are
large personal vehicles, almost
always with a flat-bed to haul
your things around, you might
have seen the Tata Xenon and
Mahindra Getaway, well these are
similar, just twice as big.
And these were basic, like
most American vehicles always
were. Simply put together and
easily repaired. Luxury was never
the American way. But those days
are gone, and that is quite evident
in the 2017 Ford F150 King Ranch
that I recently had a chance to drive
on the Ford test track in Dearborn,
Michigan. The F150 is by far and
away Ford's best-selling vehicle, by
some estimates one F150 is sold
every thirty seconds. Despite competitors like the Dodge Ram,
Chevrolet Silverado and now the
Toyota Tundra, the F150 continues
to rule the roost. And like all vehicles the F150 has continued to
grow.
These are some of the headline
numbers. The F150 is 6.19 meters
long, that is more than twenty feet
long. With its (admittedly huge)
mirrors out, the car is over eight
feet wide. The 4x4 version with the
twin-cab weighs over 2.2 tons; but
with the mammoth 3.5-litre V6
EcoBoost engine that produces
365 horsepower and vitally 450
pounds-foot of torque - which
610 Newton-meters for those of
you guys who love metric figures,
this monster can two two monsters,
with a towing capacity of five
tons.
Let me compare those figures
with what we would call a large car
in India, Ford’s own Endeavor.
Which is four feet shorter, a foot
thinner and over two hundred
kilograms lighter for the top 4x4
model with the 3.2 engine. And as
much as I like the Endeavor, albeit
with the smaller engine and twowheel drive (will you ever take an
SUV out to the country?) as I was
to discover the F150 is far more fun
to drive as well.
Yet, do not for one second
think that this is an unrefined lump
of meat, this isn’t a redneck wagon.
Hell no. Far from it, the latest iteration of the F150 has Ford’s most
advanced gearbox yet, possibly
one of the most advanced gearboxes in the world - with ten forward
speeds. That is no typo, this car has
ten forward speeds. And that is
what we drove at Ford’s highspeed test-track outside their headquarters in Dearborn, Michigan.
The version we drove was the
luxurious ‘King ranch’ version,
which is kitted out in acres of
embossed leather and wood, a
state-of-the-art Sony infortainment system that would not be out
of place in a German luxury car.
The interiors of the car has the feel
of a large wooden cabin in the
American countryside, which is
what Ford was trying to achieve
one figures.
But that was not it, Ford wanted a whole posse of journalists to
try out the new F150 at the highspeed test track for a reason. This
behemoth can move at a considerable rate of knots thanks to this
new gearbox, to demonstrate that
to us on the high-speed track
Ford engineers had put ‘Stop’ signs
at strategic points, these showcased
not only how quickly the new F150
went from a stand start up to the
highway speed limit in the US of
70 miles per hour (around 120
kilometers per hour) and beyond
but also how the car used the gearbox to achieve some engine braking as well.
And the car is surprisingly easy
to drive, yes, you know that you
command the roads but the F150
does not feel out of place on the
track. The steering is light, the
gear-changes are smooth and you
can even manually shift gears - useful not so much for the track but
more for country and hilly roads
where you might need to hold a
gear. In the early days, the first
F150’s in the late-1950’s had a
crude three-speed automatic gearbox, but you really appreciate
modern technology. This huge
beast is also economical by
American truck standards, albeit it
would probably give an Indian
small car owner a heart attack. That
said, petrol costs half of what it does
in India out here.
Sure, this is no Mustang, it isn’t
supposed to set the roads alight. But
it can really get a move on when it
needs to. This might look like a
Diplodocus in a world of small raptors, but this can give the raptors a
run for their money. Vehicles like
the F150 work in a huge country
like the United States with large
expanses of rural roads and where
ranches and farms can often expand
as far as the eye can see.
Clearly, something like this can
only be made for the US and
Canada where you need such monstrous vehicles propelled by bigpetrol engines to go anywhere. But
you know what, I drove a lot of cars
at this Ford track day, the utterly
maniacal Focus RS and the new
Fusion (which is an amazing car),
but it was the F150 that left a smile
on my face.
0cadTR^\_P]X^]
2T[TQaPcX]VWd\P]
PacXbcahP]SRaPUc
?P_TaQ[P]Z[Pd]RWTS
faXcX]VY^da]P[b
W^]^daX]VcWTQTPdch^U
PacXbcXRRaTPcX^]Qh
_PhX]Va^hP[chc^TeTah
PacXbcfW^bTf^aZWPb
QTT]dbTSX]cWTR^eTa
1h0=:8C0 908=
covers from recycled binder
boards. Keeping the journals
handy, the designers teamed up
for an accordion-style memento pouches which is also the signature feature to serve the purpose of storing paper ephemera
and other items that can easily
be tucked away. But the feature
that grabs the attention the most
is the closures of the notebooks
involving an ornate metal clasp,
magnetic wrap or a strap. Clasp
closure is an old world charm
with a modern flair and the others being offered by several
brands too.
While grabbing this piece of
art, one would eagerly want to
know the whereabouts of the
design. To answer this query of
any passionate writer, the brand
has come up with the artisan history or rather the inspirational
story at the back of each journal.
The brand has launched its
products with 50 designs from
French textile to Persian Safavid
binding art, from Japanese
Lacquer box patterns to the traditional embroidery from India's
Gujurat region and also the
manuscript of Mahatma Gandhi
eP[[TheXePRXch #
'(+5$'81_)5,'$< _6(37(0%(5
3T\P]SaXbTbU^aSTbXV]TaSTR^aP]S^a]P\T]cPcX^]U^aW^\Tb
By Team Valley Vivacity
one are the days, when
bathrooms were meant
to be basic space for
bathing and relieving oneself
with market trends in recent
years pumping up the basic
requirement to transform it
into a luxurious display of the
home owners monetary and
social 'position'. No longer
remaining a peaceful town
known for its "green hedges
and grey hair", Dehradun with
its increasing population and
rise in constructions and commercial activity has now developed into a decent market for
manufacturers of décor items
and fixtures with various
established and more recent
brands along with a range of
products now being made
available locally.
According to interior
designer Aamir Sheikh, threedimensional wall-papers with
designs and matte flooring are
in trend. "Wallpapers were
available in the past too but
now a days such products with
digital prints are gaining in
popularity. They come in varying shapes, sizes and quality,"
he said. Sheikh further averred
that those people in Dehradun
who can afford it, tend to
spend an average of about Rs
five lakh on bathroom decore.
The cost can rise higher
G
depending on the quality and
brand of the product, he
added.
Akansha Thapar of a local
interiors and developers enterprise said that a considerable
number of people in town are
opting for well established
brands in sanitar y ware.
C onsidering the various
brands, wide range of design
and price range, people can
conveniently choose their purchase according to their budget and taste, said Thapar.
The fittings and fixtures
including wash basins, commodes, designer faucets and
other items are major factors
influencing the feel and look of
the bathroom. With changing
times, toilets these days are
also being perceived and touted by some as symbols of
socio-economic class. "Of the
total budget for constructing a
home, people now spend about
five per cent of the total budget on their bathrooms.
Then there are those who
don't mind spending up to 20
or 25 per cent of their total
budget for construction their
home, said Varun Agarwal of
Parivartan Interiors.
He further opined that
white, grey and light blue
colours are comparatively
more popular among customers in Dehraun. Excessive
use of colour and gaudy is out
of trend with customers in
general going for subtle shades
with neutral colour tones.
"Bath tubs however, have not
elicited popular demand from
the people of Dehradun. The
water here contains calcium
which makes it difficult to
clean. Also people don't really have time to sit and take
long baths in tubs which also
occupy considerable space
which cannot be afforded by
most. While bath tubs have not
picked up in popularity, glass
panels like the ones used in
hotel bathrooms are being preferred by customers, Thapar
said.
Tulika Aswal of Wall Arts
Dehradun averred that
Jacuzzis are also being purchased, though in limited
numbers, by people in
Dehradun. "Some trends seen
in Delhi at times are also
picked up by people in
Dehradun. The bathroom fittings and fixtures which were
accorded little importance in
the past have been picking up
in popularity in recent years.
This change in customer
choice in recent years has been
brought about mainly by factors including rising income,
rising urbanisation, and class
consciousness influencing
middle class," she said.
When it comes to the
installations of lights, people
show a tendency to opt for wall
mounted lighting in lamp
shapes which emit soft and diffused light instead of harsh
directly focused lighting, said
Gaurav of Inside Outside.
=TTSc^PSSaTbb\T]cP[WTP[cWP]S^cWTaXbbdTbRPdbX]VbdXRXSP[cT]ST]RXTb
By Nitika Bhardwaj
ecent years have seen a rise in the tendency among some members of society to resort to extreme steps like
committing suicide due to varied reasons
from relatively small issues to major mental toll taken by the 'modern' lifestyle related issues. The increased commercialisation
in society affecting and even replacing traditional value systems which influence
social attitudes, suicide trends also reflect
the breaking of gender stereotypes in the
state. According to data from the State
Crime Record Bureau of Uttarakhand
(SCRBU) in the past five years, the number of men committing suicide has been
higher than that of women who ended their
lives. Trends show that there has been a rise
in the number of suicides attempted by
males in the age group of 15 to 30 years due
to various factors including interpersonal
relationship issues, failure in academic
examinations and substance abuse. During
the past five years, 34 cases of men committing suicide goaded by relationship-issues
R
were reported compared to the 26 women
suicides during the same period. Official
data points out at a rise in male suicides during the period from 2011 to 2015 whereas
a sudden rise in female suicides was recorded in 2015.
Failure in examination is another cause
of suicides with male suicides due to this factor most comprising those in the 14-29 years
age group. Alarmingly, failure in academic examinations appears to be the most common cause for suicides in both the Garhwal
and Kumaon regions of Uttarakhand. The
female suicides caused by failure in examination involved those in the 15- 29 years
age group. Though there has been a general rise in such suicide cases between 2011
and 2014, only one female suicide and six
male suicides goaded by academic failure
were reported in 2015.
The total number of deaths by suicide
in the years 2011, 2012, 2013, 2014 and 2015
were recorded as 317, 424, 365, 207 and 475
respectively. These cases also include suicides by persons affected by factors like
bankruptcy, inability to pay monetary
Kasiga School
debts, dowry, extra marital affair, divorce,
impotency, infertility, other family issues,
physical and mental issues, extreme poverty, unemployment, physical abuse and
unknown causes in some cases.
Lifestyle issues and rising pressure
have caused a rise in the number of people
of varied ages who find themselves in a situation which appears hopeless to them without the means to escape from the problem.
In some cases, such persons end up choosing the option of committing suicide in desperation to free themselves from the "problematic" situation.
Citing an example of a girl studying at
an institute in Selaqui, Dehradun based clinical psychologist Dr Pratibha Sharma said
that youngsters are attempting suicide
more than any other age group. "The girl was
in a relationship with a male from
Chandigarh who purportedly used to force
her for sex. She has separated from the male
now but still gets terrified by nightmares and
hallucinations of him being in her room and
beating her. He used to beat her when she
refused his demand for sex," said Sharma.
The girl in question had attempted suicide
without success and is presently undergoing counseling, she added.
Another local psychologist Dr Amit
Soni says, "At times, people who consider
the option of committing suicide feel that
they have lost all control with their problems appearing inescapable. They can't think
clearly or make logical decisions. They feel
unable to stop the pain or the person causing it. Affected by low self esteem making
them view themselves as worthless, such
people find themselves unable to end the
sadness. They seem to fear that they will
never regain control of their life and can't
see beyond such a scenario."
Regarding causes for suicide, Dr
Sharma pointed out the inability to accept
failure, academic pressure and disappointments, loss in self esteem and relationship
failures as among the major factors behind
rising cases of suicide in Doon. Sharma, who
also provides her services in the Doon
Hospital further said that on an average, she
gets 15 to 20 suicide related cases in a month
with Dr Soni handling an average of 10 such
cases in a month.
Dr Sharma pointed out that among the
youngsters, girls were generally more vulnerable to get affected by depression and
anxiety disorder. "Girls tend to be more
emotional, vulnerable and easily get attached
to people. These traits, at times make it harder for them to tackle the situation considering social norms and 'family prestige'
issues."
Psychologists state that 80 per cent
youngsters studying in Doon are from other
cities and thus are likely to face more problems than the locals residing with their families. Having a family may be an important
factor mitigating probability of suicide but
it doesn't assure zero suicide attempt.
Absence of parents and a family at times
causes problems for some who feel stifled,
lone and worthless. The absence of emotional connect or emotional support can be fatal
at times in the cases of people vulnerable
to extreme measures, said Sharma.
Every individual may experience differ-
ent conditions and display symptoms with
varying intensity.
"Any sudden change in their behaviour
and habits can be a sign. Loss of appetite or
overeating, inability to concentrate on day
to day work, sleeplessness or stupour, negativity, extreme mood swings are some of
the symptoms seen in those vulnerable to
committing suicide," said psychologist Dr
Rachna Berry.
She lays emphasis on the importance of
proper parenting. "It is very important to let
your child know that no matter what
he/she does whatever he/she goes through
you are unconditionally there to support
them. Such support tends to be missing in
proportion of parents in Indian society
which may also give rise to suicidal tendencies."
Stating that mental health needs to be
considered more seriously breaking old
stereotypes, psychologists stress that those
experiencing protracted or intermittent
sleeplessness, depression and similar issues
should consult a qualified counselor without delay.
language befitting for the occasion.
University of Petroleum and Energy Studies
Tanushree Khattri pursuing B. Tech Power System
Engineering of Electrical Power and Energy from the UPES,
Dehradun finished a two months' internship in a French
University. She was with 'Ecole Nationale Superiere de
Mechanique des Microtechnique, Besancon, France
(ESNMM, France) from June to August this year.
During her tenure, in the Electrical Engineering Lab at
Plateforme Department of ENSMM University, France,
Tanushree worked on the project 'Development of a 3D intraoral scanner'. The scanner will be of great help to ortho-dentists and a big relief to patients with denture problems
because it would be able to make a 180-degree single scan
of the entire denture, instead of sectional scans done these
days. Tanushree has been offered masters in ENSMM, France,
on a scholarship.
Also 146 students at UPES have been offered placement by
IBM
Ecole Globale International Girls' School
The flight of human want has no end, our desires always leave
us wanting more. But in truth, happiness can be found in
even the smallest of things. Life is beautiful in its essence.
This was the soulful message rendered by Atul Pundir in the
form of a brilliant poem written by him titled "Tamanna ki
Udaan" at a function held to commemorate Hindi Divas by
Kasiga School. As the chief guest on the occasion, the prominent lawyer who also enjoys a strong reputation for his writings, Pundir spoke to the students on the subjects of life, aspirations and love. He answered questions about his new book
"Itni Si Toh Baat Hai" due for release later this year. Reflecting
on the true meaning of love, he expounded his philosophy
of love being spiritual in nature and having a very deep interpretation that is often misjudged. "Youngsters often mistake
physical attraction between a boy and a girl to be love.
However, love is a lot more profound. Love to begin with,
is giving without demanding anything in return. To love is
to care," said Pundir. He went on to comment that it is unfortunate that love is treated as a sort of a taboo word or something to be secretive about. True love can never be wrong
and the younger generation should imbibe the right meaning of love. The Chief Guest's literary talent, relevance of subject and powerful eloquence left the staff and students visibly enthralled. The function was hosted by Nutan, the Hindi
teacher at Kasiga who displayed a strong command over the
0LVV)UHVK)DFHVDZKXJHSDUWLFLSDWLRQIURPFLW\
VDVSLULQJPRGHOV
9$ / / ( < * 2 2 ' 7 , 0 ( 6
Valley Vivacity sketches out a weekly listing
of the most interesting events happening in
Dehradun and around, so that you never
miss the coolest thing in town. Have a whale
of a time!!!
WHAT: Cultural Journey To Himalayan
Village
DATE: September 16
TIME: 6 am
VENUE: Uttarakhand
CONTACT: +91-9984464000
WHAT: Mr. And Miss Doon 2016 Auditions
DATE: September 18
TIME: 11.30 am
VENUE: Dug Out Sports Grill and Lounge
CONTACT: 7060458020, 9719067502
WHAT: UK State Ranking Billiards &
Snooker Cham
DATE:September 16
TIME: 7:00 pm
VENUE: 147 Snooker Academy, 2nd Floor,
Om Tower, GMS Road, Dehradun
CONTACT:Pankaj-8899147147, 9935241641
Ecole Globale International Girls' School won Silver and
Bronze medals at the 15th All India Open Karate
Championship in Chennai. Almost 200 students from all over
India participated in this event. The student ranged from 6
to 16 years in age. Hridita Chaudhary won silver medal and
Sonali Sharma won Bronze medal in under 16 categories.
Sanjana Singh won Bronze medal in under 18 category.
WHAT: Star Wars (Dance and acting talent
hunt)
DATE: September 21
TIME: 10:00 am
VENUE: DAV Inter College, Dehradun
CONTACT: 0135 265 4320
WHAT: Finding your life's purpose
DATE: September 23
TIME: 06:00am
VENUE: Camp Tappu Sera, Dehradun
CONTACT: 9811466370
EMAIL ID: mandy@buddhadimension.com
WHAT: Dehra County Fest 2K16
DATE: September 22 - 26
TIME: 08:00 am
VENUE: Parade Ground, Dehradun
CONTACT: 9927399996
WHAT: Booknerds Google Hangout
Featuring Kanchana Banerjee
DATE: September 17
TIME: 11.30 am
VENUE: Indian Institute Of Petroleum,
<RXFDQQRZZULWHWRXVDWYDOOH\YLYDFLW\#JPDLOFRP
Dehradun
CONTACT: 8958260927, 9759360927
WHAT: Dandiya Night- Rock N Dhol
DATE: September 24
TIME: 7 pm
VENUE: WIC, Dehradun
CONTACT: 0135-2740144, 2740132,105
WHAT: Tribute To Ustaad Nusrat Fateh Ali
Khan
DATE: September 16-17
TIME: 10 am
VENUE: Strings and Bowls, Old Mussoorie
Road, Dehradun
CONTACT: 9897447028
b_^ac $
347A03D=k5A830H kB4?C4<14A %! %
DFA6CDE2CDE@E96C6D4F6
A^]P[S^³b[PcT
bcaXZT0VdTa^³b
WPccaXRZWT[_
ATP[2Xchc^
bcPacD2;
RP\_PXV]^]
_^bXcXeT]^cT*
;TXRTbcTafX]
QXV^]STQdc
fWX[TB_dab
U[^]STa
0?Q ?0A8B
railing until the 89th minute against
Sporting Lisbon, Real Madrid was
reminded that becoming the first
club to retain the trophy in the Champions
League era won't be an easy task.
The 11-time champions needed a late
winner from substitute Alvaro Morata to
prevail 2-1 in their opening game in the
competition on a Wednesday night also
marked by Premier League champion
Leicester's maiden Champions League win.
Playing against his former
team, Cristiano Ronaldo was
on the score sheet at Santiago
Bernabeu stadium as he leveled
with one minute left from a
free kick before Morata's
winner in added time.
But the Portugal star was
unable to match Sergio
Aguero, who netted a hat trick with
Manchester City. Sergio Aguero kept up
his explosive start to the season by scoring a hat trick for Manchester City in a 40 win over Borussia Moenchengladbach in
their rescheduled match.
After a one-year absence in the tournament, Dortmund celebrated its return
by putting six goals past Legia Warsaw,
while French clubs Monaco and Lyon
made both winning starts.
Thrashed by Tottenham 4-1 at White
Hart Lane last season in Europa League,
Monaco took its revenge on Europe's
biggest club stage with a 2-1 win at
Wembley. The match was moved to
England's national stadium because of construction work at Spurs' home ground and
drew 85,011 fans, a club-record home attendance and a record for an English club.
Monaco playmaker Bernardo Silva
opened the scoring after only 15 minutes
before Thomas Lemar doubled the lead
near the half-hour mark.
Spurs reduced the deficit through Toby
T
4]V[XbWRWP\_X^];TXRTbcTa2Xch_[PhTabRT[TQaPcTPV^P[PVPX]bc1T[VXP]RWP\_X^]2[dQ1adVVTX]cWT2WP\_X^]b;TPVdT^]FTS]TbSPh]XVWc
0?
0=6AH0;;46A83>D1CB9DE4³B270=24B
0?Q CDA8=
coach Massimiliano Allegri
angrily denied his side is favorite to
Jwinuventus
the Champions League following a
2aXbcXP]^A^]P[S^VTbcdaTbPUcTacWT\PcRW
C^bdXc8]SXP]UP]b
;P;XVP\PcRWTbc^
WPeTTPa[hbcPac
?C8Q =4F34;78
a Liga President Javier Tebas on Thursday
announced that the kick-off timings of the
L
Spanish League matches will be changed and there
would be early starts to suit the ever increasing
Indian football fans.
Inaugurating La Liga's New Delhi office, their
sixth base of operations overseas, in the presence
of LaLiga ambassador Fernando Morientes, Spanish
Davis Cup team led by Rafael Nadal and AIFF officials, Tebas said the kick-off timings will be changed
to 4:30pm local time in Spain (8pm IST).
Indian fans, who normally get to watch the
La Liga matches late at night, will now be able to
watch these games at prime time in late evening.
Tebas was excited about the opening of this
APUPT[=PSP[aXVWcP]S5Ta]P]S^<^aXT]cTb_[PhU^^cQP[[ ?C8
new office and the impact it will have for La Liga.
"It means a lot; this is one of the most important days in LaLiga's history. Being present in India
is very important to us. We have been working
hard towards this for a while and have even made
changes to kick-off times with Indian fans in
mind," Tebas said.
One of Spain's most revered strikers Fernando
Morientes feels that the Gen-Next of the 'La Rojas'
may find it difficult to replicate the success of their
'Golden Generation' as the national team is going
through a difficult transition phase.
"Spanish national team is going through a
change. The transition phase for any national team
is a difficult one. In Europe, the gap between quality of various teams is decreasing. There are far
too many competitive teams now," Morientes, who
is here as a La Liga ambassador.
0?
massive outlay in the transfer market in
the offseason.
In the transfer window, Juventus had
a summer spending spree
which included signing last
season's top goalscorer
Gonzalo Higuain from
Napoli for 90 million euros
($99 million) in the most
expensive transfer in Italian
football history.
Great things were also
expected of Juventus in
Europe, but it opened up its
campaign with a disappointing 0-0
draw at home to Sevilla on Wednesday.
"I think Juventus has the same
ambitions as last year and two years ago.
No more, no less," Allegri said after the
match. "It doesn't mean that because we
had a great transfer window we are now
obliged to win the Champions League,
because winning the Champions League
is not easy. It seems that Juventus is the
only favorite for the Champions League
when it's been 20 years since Juventus
won the Champions League, so we need
to keep our feet on the ground."
?4?0??40;BC>50=B
MANCHESTER: Boos
reverberated around a farfrom-full Etihad Stadium as
City's players lined up for the
Champions League anthem
before their game against
Borussia Moenchengladbach.
It was the same old story on
Wednesday, with only 30,270
spectators inside the 55,000seater Etihad for a game City
won 4-0 with some irresistible attacking
football. "They must forget what happened in the past," Guardiola said. "The
stadium was not completely full so the
only thing we can do is play good so the
people at home say, 'Wow, next time I
will be there.' We have to be so proud
to play in this competition.”
Alderweireld's header in the 45th minute
but couldn't make the most of lots of possession in the second half.
Bayer Leverkusen failed to hold onto
a 2-0 lead in the group's other game, letting CSKA Moscow come from behind
and rescue a point in a 2-2 draw.
Elsewhere, Zinedine
Zidane's coaching skills
BTaVX^
made the difference, as his
0VdTa^
decision to bring in
Morata and James
Rodriguez paid off.
Rodriguez provided
the assist, curling a
perfect ball for
Morata's header.
Sporting had
the match at the
Santiago Bernabeu
Stadium largely under
control and was
rewarded when Brazilian
midfielder Bruno Cesar gave
scored with a shot from inside
the area in the 48th minute.
Ronaldo equalized from an
89th minute free kick.
Borussia Dortmund enjoyed
a stroll in park at Polish champion
Legia Warsaw, scoring with six dif-
.LZLVIDFH0XPEDLLQZDUPXSWRGD\
?C8Q =4F34;78
will be a tricky test for New
as they are unlikely to
IgettZealand
much batting practice on a
pacer friendly Feroz Shah Kotla
track when they face Mumbai in
their only warm-up match of the
tour, starting here on Friday.
Going by the nature of the
pitch on eve of the three-day
game, senior player Ross Taylor
said he was not expecting the
ball to turn much at Kotla, but
was aware it won't be the case in
the three-Test series, starting in
Kanpur on September 22.
"Well, it is part and parcel of
the way Test cricket is being
played. It is no different when
you come to New Zealand. We
leave a little more grass on the
wicket. I guess that is what
home advantage is all about. We
are expecting the wickets to turn
over here. We are not expecting
the wickets to be like this one
here at Kotla. We are expecting
it turn for the Test matches,"
Taylor said referring to Kotla
wicket, which is a fresh one with
a bit of grass on it.
However, he stopped short
of saying that it was a deliberate ploy by the home team to not
=TfITP[P]S_[PhTabSdaX]VP_aPRcXRTbTbbX^]X]=Tf3T[WX^]CWdabSPh
have New Zealand play on a
turning track.
"Not really. It is what we
expected to see here. Last two
tours, we did not even have a
warm up game. So nice to have
one this time. Even the matches we played here in Delhi during World T20 had more grass
than other venues. A warm up
game is a warm up game. It is a
chance to get out and play in
Indian conditions, obviously it
is a lot warmer than back home.
So it is nice to get out and stretch
your legs. We are expecting a
tough match against Mumbai,"
?C8
µ3VReZ_X:_UZRReY`^VZdUZWWZTf]e¶
=4F34;78) BT]X^a=TfITP[P]S
QPcb\P]A^bbCPh[^a^]
CWdabSPhbPXSWXbcTP\fX[[WPeT
c^_a^SdRTb^\TcWX]Vb_TRXP[X]
cWTCTbcbTaXTbc^QTPc8]SXPX]
8]SXPU^acWTUXabccX\T
0bZTSfWTcWTafX]]X]VcWTbTaXTb
WPeTQTR^\Tc^dVWTaU^aeXbXcX]V
cTP\bX]aTRT]ccX\TbCPh[^abPXS
XcfPbSXUUXRd[cc^_X]_^X]cP
aTPb^]U^acWT_aTePX[X]VcaT]S
8S^]cZ]^fXUcWTaTXb^]T
_PacXRd[PaaTPb^]8Uh^daTUTaaX]V
c^8]SXPcWThPaTYdbcPeTahV^^S
cTP\P]SXcXbWPaSc^QTPccWT\
PcW^\T8]cTa\b^U^eTabTPb
eXRc^ahU^adbfTWPeT]^cf^]P
[^c^UbTaXTbfTWPeTf^]CTbcb
^eTabTPbQdcbTaXTbWPeTQTT]
WPaSc^R^\TQh1dccWPcXbcWT
RWP[[T]VT^UCTbcRaXRZTc7^_T
fT_[PhV^^SRaXRZTcWTaTWT
bPXSCWTQXVVTbcRWP[[T]VTU^a
CPh[^aP]S^cWTaQPcb\T]fX[[QT
c^cPRZ[TcWT`dP[Xch8]SXP]
b_X]]Tab0bZTSPQ^dcWXb_[P]b
c^cPRZ[TcWTb_X]]TabCPh[^abPXS
bcXRZX]Vc^WXbbcaT]VcWbfX[[QT
cWTZThP]S^]T^UcWT\XbcWT
bfTT_bW^c
?C8
added the batsman, whose only
Test century in India came back
in 2012.
Such has been the focus on
spin for New Zealand that their
spinners — Ish Sodhi, Mitchell
Santner and Mark Craig — had
a long session on Thursday
while the batsmen created rough
spots on practice pitches to get
used to the sharp turn.
Taylor confirmed that all in
the 15-man squad will get time
in the middle.
For Ranji Trophy champions Mumbai, playing against a
Test team will be an ideal start
to its domestic campaign with
the matches now being played
on neutral venues.
The absence of Akhil
Herwadkar, Shreyas Iyer,
Shardul Thakur and Dhawal
Kulkarni, who are with the
India A team in Australia, gives
Mumbai the chance to test their
bench strength. Rohit Sharma,
who was part of the Duleep
Trophy final, will also be playing the match.
Captain Aditya Tare said his
team will make it tough for New
Zealand. "The wicket looks
nice. It should be a good game,"
said Tare.
ferent players in a 6-0 rout.
Riyad Mahrez scored twice as Leicester
opened its maiden Champions League
campaign with a comfortable 3-0 victory
at Belgian champion Club Brugge.
Sixteen years after its last European
game, the English Premier League champion was unfazed by the occasion and got
off to a strong start, with Marc Albrighton
scoring after just five minutes.
Mahrez then curled a free kick home
and scored his second goal from the penalty spot. The victory gave Leicester the lead
in its group after FC Porto and
Copenhagen drew 1-1.
Lyon top Group H with 3-0 win over
Dinamo Zagreb after Juventus was held to
a disappointing 0-0 draw by Europa
League winner Sevilla.
Playing with a depleted side, Lyon
relied on its homegrown players and the
class of teenager Maxwel Cornet to open
its Champions League campaign in style
with a 3-0 defeat of Dinamo Zagreb.
Lyon quickly opened the scoring
courtesy of Corentin Tolisso's goal.
Jordan Ferri, who honed his skills at
Lyon's renowned academy with Tolisso,
made it 2-0 four minutes into the second
half from Cornet's assist. The 19-year-old
Cornet then scored the third.
1228c^X]eXcTP[[
U^a\TaRP_cPX]bU^a
$cWCTbc\PcRW
?C8Q =4F34;78
he BCCI has decided to invite all the
former India captains to celebrate the
T
occasion of country's '500th Test match'
that will be played against New Zealand in
Kanpur from September 22.
A specially minted silver coin with
500th Test embossed on it is being prepared
for the toss. Senior BCCI official and
UPCA supremo Rajeev Shukla said that a
host of events are being organised by the
BCCI to make the event memorable.
"The BCCI wants to felicitate all the
former captains during the Test match.
Green Park is one of the first four Test
venues in India along with Chepauk,
Wankhede and Eden Gardens. It will be a
fitting tribute to all those former captains,
who could be present on the occasion. The
BCCI is making all arrangements," Shukla
told PTI.
The likes of Nari Contractor, Chandu
Borde, Dilip Vengsarkar, Kapil Dev, Ravi
Shastri, Sunil Gavaskar, Sourav Ganguly,
Sachin Tendulkar, Virender Sehwag,
Krishnamachari Srikkanth are expected to
grace the occasion. Chief coach Anil
Kumble will also be present. Rahul Dravid
is also expected to comeback from his India
A tour assignment.
C`Y^^UbcgY\\TUSYTU9^T>JcUbYUcVQdU*7Q]RXYb
?C8Q =4F34;78
ut-of-favour India opener
Gautam Gambhir feels spinO
ners will decide the fate of the
upcoming three-match Test series
between India and New Zealand,
starting in Kanpur on September
22. Warning the home team
against taking New Zealand
lightly, Gambhir said both India
and New Zealand have fielded
good spinners in their squad and
they are expected play key role in
the series.
"New Zealand has always
been a very gritty kind of a side.
They have always been underdogs, no one rates them very
highly but they have always done
well in ever y conditions,"
Gambhir said.
"They have got a good squad.
They have got three spinners (in
Mitchell Santner, Ish Sodhi and
Mark Craig) and spinners of
whichever sides bowl well it will
eventually decide the series,"
Gambhir said on the sidelines of
the launch of a talent hunt programme, Indian Junior Players
League (IJPL), of which he is the
brand ambassador.
Gambhir scored 320 runs at
an average of 80 per innings in
the recently-concluded Duleep
Trophy to lead India Blue to the
title with consummate ease. But
despite his exploits with the bat,
the selectors once again ignored
him when they picked up the 15member squad for the upcoming
series against New Zealand.
Asked Gambhir about the
recent snub, the aggressive lefthanded batsman curtly said: "I
don't play for selection honestly.
Ultimately my job is to score runs
and that is what I focus on.
"You should just go out there
and look to control things which
you can control, rest is selectors
job. Whatever the selectors decide
it is their opinion. My job is to go
out there and help my team in
winning."
Gambhir reiterated that he is
a "traditionalist" and is not in
favour of any tinkering with Test
cricket.
EP[[Thb_^acbRd[cdaT %
'(+5$'81_)5,'$< _6(37(0%(5
0]TfU^aTXV]b_^ac?XRZ[TQP[[bTcU^a[Pd]RWX]3TWaPSd]
By Anupma Khanna &
Nitika Bhardwaj
ttarakhand is all set to
launch the popular
game of Pickleball,
with a State Pickleball
Association to be formalized
soon. A blend of badminton
and tennis, Pickleball has a
history as interesting as its
name. As informed by All
India Pickleball Federation
(AIPA), "The game got its
star t back in 1965, in
Bainbridge Island, just a short
ferry ride away from Seattle,
WA When Congressmen Joel
Pritchard, William Bell and
Barney McCallum came
home from a game of golf one
day to find their kids bored
and restless, they set out to
create a game that would
engage them through the lazy
days of summer. They wanted to create a game that
would be challenging, but
still accessible. They handed
the kids ping-pong paddles
and a wiffle ball, and lowered
the net on their badminton
court. In the coming days
both kids and adults alike fell
in love with the game." While
some say that the name
"Pickleball" was derived from
that of the Pritchard's family
dog, Pickles, other sources
state that the name actually
came from the term "pickle
boat", referring to the last
boat to return with its catch.
A memoir by Joan
Pritchard, Joel Pritchard's
wife recounts that the name
came "after I said it reminded me of the Pickle Boat in
crew where oarsmen were
chosen from the leftovers of
U
other boats. Somehow the
idea the name came from
our dog Pickles was attached
to the naming of the game,
but Pickles wasn't on the
scene for two more years.
The dog was named for the
game."
The bir thplace of
Pickleball in India is Mumbai.
It is pertinent to note that
once done, Uttarakhand will
By Team valley vivacity
ll sports enthusiasts and sports
officials from the state have lauded the government's decision to
honor Manish Rawat, a small town boy
from Chamoli, Uttarakhand. Manish
Rawat has secured 13th position in Rio
Olympic-2016 in the category of 20 km
race walk and thus has been promoted.
This decision has given some hopes
to players, coaches and state sports
associations as the condition of sports in
the state is not up to mark. Analysing the
situation of sports in Uttarakhand from
the perspective of officials we tell you
what is wrong exactly and what can be
done to improve it.According to
Virendra Singh Rawat, founder of
Dehradun Football Academy, government does not take interest in this sector. He tells that most of the associations
exist only on papers. They have no
records, no achievements and still the
government is providing them with
funds.
A
become the ninth state in the
country to be affiliated with
AIPA, the existing eight members being Maharashtra,
Rajasthan, Jharkhand,Bihar,
Har yana,
Pondicherr y,
Mumbai and Madhya
Pradesh.
With a table- tennis like
bat, badminton like court and
lawn- tennis like playing style,
pickle ball is a fun mix of the
Invented by U.S Congressman, Joel
Pritchard in 1965, Pickleball is a
fun and easy racquet sport that
combines badminton, tennis and
table tennis
three traditional racquet ball
games. Two, three or four
players use solid paddles
made of wood or composite
materials to hit a perforated
polymer ball, similar to a
wiffle ball, over a net. While
the world practice is to have
three categories- sub- junior,
junior and
Senior, India follows only
the latter two, as the game is
FWPcPX[bb_^acbSTeT[^_\T]cX]DccPaPZWP]S.
reflecting upon the situation he
said, "Condition is very poor. No system
is being followed. The fake associations
are taking money from governments and
do not organise any tourney. Players are
informed at 11th hour about tourneys
and championships which is not acceptable."
He further points out that no jobs
and fraud sports authorities are hindering its development.
Bijendra Rana, Secretary of the
Uttarakhand Baseball Association rather
sees problem in families and mindsets of
people over here. He points out that children these days are burdened with syllabus, studies, entrance exams and getting good scores. If not studies other
things such as gadgets and video games
involve them which give them no out-
put or life skills. The rest of children who
want to take up sports do not get support from their families and parents.
Girls especially have a tough time fighting and they finally give up against societal norms.
He further adds that good facilities,
infrastructure and jobs can increase the
development rate.
Mandeep Grewal, Secretary General
of Uttarakhand Basketball Association
blames it on the politics going on in this
field. He says that a lot of politics is
involved in Olympic association medal
tally. Further he criticised the government and ministers to form a logical and
full proof policy.
He while talking to The Pioneer
appreciated the honouring of Manish
Rawat and expects the same for all the
budding and existing players. He hopes
no other player goes through the struggle Manish Rawat has gone through to
reach here.
Grewal too agrees with the opinions
of the above two officials and says that
no jobs, no proper training and facilities
is the root problem. Prem Kumar,
Secretary of Paralympics Association of
Uttarakhand pointed out to the discrimination that is prevalent from long. He
not only talks of Paralympics and other
sports but other games in comparison to
new and modern games. Like Kabbadi
doesn't stand a chance in front of football. "Audiences will anytime prefer to
watch a football match over Kabaddi or
Kho-Kho etc."
Coming to Paralympics and stating
the discrimination he mentioned that,
Rio Olympics was telecasted by almost
all sports channels and people watched
it with much interest. But how many
people know that Rio Paralympics are on
and how many channels are telecasting
it or are publishing its news? With a long
pause he said, "You see that's the difference I'm talking about."
While all the above secretaries from
different associations pointed out problems and ridiculed the government of its
policies, P.C Verma, Secretary of Cricket
Association of Uttarakhand appreciated
the development happening.
He pointed out to the international
level sports infrastructure in the state
and said, "I don't find any problem anywhere. We're doing very fine and development of sports is increasing at an
excellent speed. We have world class
ATeXTfP]SRaTfX]cTaeXTf^U\^eXTB^deT]Xa
By Nitika Bhardwaj
ouvenir, directed by
Vaibhav Bisht is a 40 minutes short horror film with
a message. This film is a regional film and was showcased in
the recently concluded 2nd
Dehradun International Film
Festival 2016 and we interacted with its team too.
Vaibhav who also plays
the character of Armaan in the
film has kept the medium of
the film in Hindi. Answering as
to why he went for Hindi and
not Garhwali as language he
said, "a movie whether short or
long is made for audience. We
don't have Garhwali audience
in our region unlike that of
Bhojpuri, Tamil, Telugu or
Bengali. The youth there speak
these languages and understand it and follow it. Whereas
our people here do not speak
Garhwali and neither see
Garhwali films. So when the
people only don't support any
piece of work in their language
how and why will people make
films in those languages. Until
and unless the film appeals the
mass it is of no use. Thus I
make my films in Hindi only."
"The most important
aspect of regional films is that
they lack mass appeal. It is only
made for a specific number of
people. These days no new
filmmaker would want to limit
himself and confine to only
regional audience. Rather he
will want to increase his or her
horizons and be globally
known," said Archit Saini,
Creative Director of the film.
Archit Saini is a choreographer also and has worked in
the film industry for a long
time. Sharing about his experience of working in regional
still to find a place among little children in the country.
"The ball has small holes
in it and is served with an
underhand stroke. It requires
average athletes' skill to play
the game. Compared to tennis that requires high power
and badminton that has
indoor
requirements,
Pickleball is an all season
game that can be played both
S
films he said, "It was difficult.
As a creative director I use to
get everything I required for
setting up things while in
Mumbai. But here I had to
arrange and wait for things
myself. Lack of facilities,
resources, things and people
posed a problem. But you have
to know how to work with even
less resources. I have tried my
best to make the most of what
I had.
He further added that it is
time now that Uttarakhand
should have good acting institutes and theatre schools. "Not
only talents here will get a platform but people over here will
get exposure and will open to
other scopes in the film industry. A film is not a one man
show. It isn't easy to make. We
require many people to be a
part of it. The schools and institutions will not only make
actors but technicians, cameraman, light man, directors,
choreographers and what not."
"The best part of our film
is that everything is local. All
our cast and crew belong from
Dehradun. All the locations are
of Dehradun," shared Abhishek
Kapoor who plays Vikram in
the film.
He told that he likes
Dehradun a lot and plans to
work here only. "Why not work
and promote our own industry
and why to work anywhere else
when you are getting opportunities in your own hometown.
I won't go hunting and struggling for work in Mumbai. We
have a lot of work here in our
region and a lot of things are
unexplored here. I love being
in Doon and I plan to work
here only until and unless
something big comes my way."
The same team won an
award in last year's film festival for their film 'cross' which
was based on Chinese infiltration.
"People have done revolutionar y changes through
movies. Language isn't a barrier according to me if your concept, story, direction and all the
other things are solid. The city
should have institutes so that a
lot more filmmakers and technicians are made which contribute a lot to the regional cinema. Also government intervention is must to make
avenues and employment in
this sector," he said.
Souvenir is the story of a
house located in Kasol,
Himachal Pradesh. The people
living nearby regard it as haunted and captivated by a spirit
which kills people.
Owner of the house
Armaan played by Vaibhav
Bisht lives in Delhi and sends
his girlfriend Natasha played by
Vidushi to live in that haunted
house.
She too experiences paranormal activities in the house
but continues her stay irrespective of it. She calls up Armaan
to come to the house ASAP.
Before Armaan reaches the
house that black form captivates her in the house and tries
to kill her.
Natasha all restless asks the
reason as to why is it following
her. To which the form says
that he's taking revenge of
what she did with Vikram
played by Abhishek Kapoor.
Going into flashback, we
see that Vikram and Natasha
were in relationship and
Vikram use to love Natasha like
psychos. He killed himself.
The black form is Armaan.
He further tells her that Vikram
was his only best friend and she
has invited havoc on her by
being the reason of Vikram's
death.
At the end while Armaan
seeks Natasha to kill her
throughout the house two men
enter the house. They are electricians and came to fix the
antenna which receives high
radiation. One electrician tells
the other that due to this high
radiation people experience
unusual things here. Also the
high radiation has made people mentally disturbed and
killed some. There is nothing
wrong with the house and
fixes it. Eerie atmosphere and
tuneful music was well crafted
but poorly placed. The
sequences between Natasha
and the spirit succeed in moderately terrifying the viewers.
After the first half, the pace
slackens in the second half of
the film. The flashback, which
is supposed to be the soul of a
horror, starts off on a very slow
note and ends too early.
The scenes were too dark
to make out what was happening. The climax doesn't measure up to the expectations. The
end is uncertain and the viewers had no idea as to on what
note did the movie end. The
end seems confusing, as after
the radiation is corrected,
Armaan with a dagger in his
hand moves towards Natasha
to kill her. This particular
aspect seems a bit far stretched.
A more appropriate ending
sequence should've been
thought of.
The music and background
score was easy on the ears. A
song sequence showing
Armaan and Natasha's
romance was not required
though. Dialogues did not go
along with the mood of the film
and neither did their acting.
Another director from
Chandigarh, Daman Sidhu
whose film Jaavitri was also
showcased during the festival,
liked the film Souvenir. She
praised the efforts put in by the
team and expects to see more
good films in near future.
"Though the execution was
not up to mark but the message
was really good at the end.
They linked all the paranormal
activities to science which is
very new. We need more fresh
minds and ideas like these so
that diversity in our industry
continues."
In an era when women are
more attracted and adamant in
pursuing acting she took up
direction. Being a mother of
two she shared her experience
of directing the film. "I was flipping into two roles. On the sets
I used to have camera on one
side and my kid on the other.
Yes it is difficult to be a director with a family to look after
but even my crew is my family. They have cooperated a lot
and that's how this film happened."
"Also I believe that direction and acting is all a matter
of choice. I always wanted to
direct and thus when I thought
it is the right time to direct a
film I did it," she concluded.
<RXFDQQRZZULWHWRXVDWYDOOH\YLYDFLW\#JPDLOFRP
outdoor and indoor,"
informed Amit Kumar, who is
likely to the secretary of the
State Pickleball Association.
On how did this unique game
find its way to Uttarakhand,
Kumar said,
"I am an avid sportsman
and I came to know about this
game from my acquaintances
in the sports field. I found it
quite interesting and new and
applied for the state association in March this year.
Thebody with 9 members
will launchthe sport in the
State with a training camp for
coaches in Dehradun as soon
as it gets registered. We are
hoping this to happen this
September.
The vision is to have
trained coaches introduce
Pickleball in schools and rural
areas of Uttarakhand.
The AIPA has hosted
three national championshipsso far, and the fourth
tournament is slated for
November this year in Jaipur.
The aspiration of Pickleball
players of India is to compete
at the international level, a
feat for which AIPA needs to
get Pickleballregistered under
the sports ministr y and
should be played in a minimum of 10 Indian states.
Pioneers of Pickleball in
Uttarakhand are eyeing the
national championship in the
pink city."We shall scout for
players in training camps that
we hope to be able to organize
soon .The game is easy to
learn and we shall get technical trainers and coaches from
other states to train forthe
national championship,"stated Kumar.
infrastructure and sports colleges in
Dehradun and Haldwani and our players are achieving heights. They are getting good opportunities and with 2018
national games lining up we will give a
good message to nation."
He mentioned that though the state
is new there is still a lot of room for
improvement. "It is a gradual process and
gradually we are building good players
here."
"It is time that the government
should come into action now and get
involved with this. The sports quota
which was 4% and was removed should
be implied again in all sectors. The players are not getting employment and thus
this is one of the biggest reasons why
youngsters do not want to take up
sports in our state," said V.S. Rawat.
Bijendra rana, opined that,
"Uttarakhand has no dearth of players
but there is a dearth of coaches, faculties and institutions here to properly
enrich them and make them world class
players."
5 ( & , 3 (
Sweet and Sour Paneer (Cottage Cheese)
INGREDIENTS
For the sauce:
Tomato ketchup
Soy sauce
Sugar
White Vinegar
Water
OTHER INGREDIENTS
Cottage cheese
Onion
Chopped ginger &garlic
Corn flour
Hot garlic sauce
Salt
White pepper
Oil
- 6 tbsp
- 2 tbsp
- 2 tsp
- 2 tbsp
- 1 cup
- 300 g, cut in cube
- thinly sliced
- 1 tbsp
- 1.5 tbsp
- 1tsp
-to taste
- 1 pinch
- 1 tbsp
VEGETABLES
Onion cut into cubes
Capsicum cut into cubes
Tomato cut into cubes
Pineapple cut into cubes
-1
-1
-1
- 1 tea cup
METHOD
Marinate cottage cheese with corn flour, salt, white pepper
and water.
In a pan, deep fry cottage cheese cubes for 3-4 minutes, till
they turn light brown. Remove and set aside.
Add oil in separate wokthen add chopped ginger and garlic,
onion, capsicum, tomato and pineapple and mix well. Sauté
on medium heat till the vegetables are light brown.
After mixing it well, add a small amount of water and put
tomato ketchup,hot garlic sauce,vinegar, white pepper and
salt in it.
Add the sauce to the pan. Bring to a boil and cook till it
thickens slightly.
Stir to coat the cottage cheese and capsicum in all the sauce
and allow it to simmer gently.
Recipe by Yogesh Nawani of First Gear Cafe