May 21, 2007 - Brevard Business News

Transcription

BBN
Vol. 25 No. 21
May 21, 2007
Brevard
$1.00
Business
News
A Weekly Space Coast Publication
Chamber reaches out
to business community
for support of Academy
By Ken Datzman
In one of its key initiatives, the
Melbourne–Palm Bay Area Chamber of
Commerce is reaching out to the business community hoping to gain broader
support for its results–oriented career–
academy programs at area high schools.
The three–year programs, which are
affiliated with a national organization,
help equip students with the skills they
need to enter the work force, or go on to
college. They play a role in developing
citizenship, too. In general, the programs
provide focus for young people.
The 10–year–old Academy of Business and Finance at Melbourne High
School, for example, is recognized as one
of top programs of its kind in the nation.
This fall, the Chamber plans to launch a
second Academy of Business and Finance
at Viera High School, following up on its
success at Melbourne High. The Chamber also runs an Academy of Construction and Design at Palm Bay High
School. They are joint ventures of the
Chamber and the Brevard County School
District.
In order to plan for the expansion into
Viera, the Chamber needs to identify
additional partners to serve as mentors
or advisers for the program. It also needs
business professionals and individuals
who are excited about the concept and
can provide resources or internships for
the expansion.
“The funding for all of our Academy
programs is a community effort right
now,” says Kim Brown, chairperson of
the Melbourne–Palm Bay Chamber and
chief financial officer for Coastal Mechanical Services, whose company has
been a supporter of the program and
provides summer internships for rising
seniors. “We are reaching out to the
community to help us come up with the
resources to build the passion and to
build the programs.”
Area attorney Joel Boyd, who is vice
chair of education for the Melbourne–
Palm Bay Chamber, is a strong proponent of Academy programs. Their
effectiveness in improving students’
performance has been measured nationwide. According to a study by researchers
at Columbia University, four out of five
Academy graduates go on to two–year or
four–year colleges. Boyd has ambitious
goals and wants to extend the reach of
Please see Career Academy, page 19
BBN photo — Adrienne B. Roth
The Melbourne–Palm Bay Chamber recently hosted a Community Leadership Breakfast on Business
Education Partnerships at Suntree Country Club. From left: Kim Brown, Chamber chair and CFO of
Coastal Mechanical Services; Shannon Meyer, CEO, Melbourne–Palm Bay Chamber; attorney Joel
Boyd, Chamber’s vice chair of education; Deborah Ballard, Chamber’s director of workforce development and education; and attorney Ed Kinberg, president of the Chamber Education Foundation.
Teaching kids about money pays big dividends
By Kara McGuire
Scripps Howard Service
Archerd — received our “financial
education,” under the close watch of an
unforgiving credit card company, not our
loving parents.
“I wanted to spare my kid,” said
Archerd, 52. “There are more sharks in
the water now.”
Michael, now 19 and finishing his first
year at the University of Minnesota–
Morris, was thrilled with the arrangement. “She didn’t always buy me
everything I wanted anyway, so at least
then I had a choice.” His mom was
thrilled because instead of saying “no”
she could say, “you have your own
money, you decide.”
Michael proved a fast learner. Within
a week, he was packing lunches instead
of buying them at school (his parents
Please see Teaching Kids, page 16
PRESORTED STANDARD
US POSTAGE
PAID
BREVARD BUSINESS NEWS, INC.
Would you give $200 a month to an
11–year–old? Elizabeth Archerd did.
The Minneapolis mom had been
pondering how to teach her son Michael
Zajicek about money management, when
she saw an “Oprah” episode that showed
her the way. It featured a book about
teaching kids financial responsibility
called “Capitate Your Kids,” by John
Whitcomb (Penguin, $13).
She wasn’t crazy about the title, which
refers to putting a financial head on your
kid’s shoulders, but she loved the
concept: to teach kids about budgeting by
putting them in control of their costs.
Here’s what she did. First she sat
down with Michael and figured out how
much money she spent on him monthly
for clothes, sports, school supplies and
lunches. That’s where the $200 came
from. She gave him the entire amount in
fives, 10s and 20s and said to make it
last.
Michael took the $200 and divided it
by expenses. Then he stored it in
different envelopes for different purposes.
If he had money left at the end of the
month, he kept it. If he ran out, he could
borrow from the following month’s
amount — with interest. When describing the method, Archerd’s peers were
doubtful. They said if it were their kids,
they’d waste the money. “That is the
total point, she tried to explain. “It gives
young people a chance to learn and even
make mistakes if that is their learning
style.”
That’s how many of us — including
BBN
DIGEST
Y ou spell it S-t-i-f-e-l;
you say it “Steefel”
Nicholaus
Either way Streifel
it means
the same thing:
pick upservices
BBN since 1890
Quality investment
5-7-07
tailored to your
individual needs!
page 6
Member SIPC
Investment Services Since 1890
Member NYSE
The Laughlin, McCarthy, Potter Wealth Management Group
Brian W. Laughlin
Jim T. Potter
E. Brendan McCarthy Dennis W. Laughlin
(321) 757-7209 • (888) 767-7565
6767 North Wickham Road, Suite 304
Melbourne, Florida 32940
Own Your Own
Condo Office/Flex/Warehouse
Turn rent into real estate PROFIT.
Luce
next in series
The only new office/flex space in Palm Bay
Prime location 1320 Culver Drive
Easy I-95 access at Palm Bay Road
Bays from 2,760-27,600 sq. ft.
Affordable Pricing
Excellent Financing Available
Custom office packages available
Occupancy 1st quarter 2007
Contact
Tom Andrews
954.612.1210
www.realtyinvestmentservices.com/palmbay95.htm
tomandrews@realtyinvestmentservices.com
Disclaimer: Oral representations cannot be relied upon as correctly stating representation of the developer. For correct
representations, make reference only to a contract for sale entered into with the developer and to any documents required by
section 718.503. Florida statutes, to be furnished by a developer to a buyer or lessee (if applicable). The depictions and information
herein are for general information only and subject to change without notice. This is not an offer to sell, or solicitation of offers to buy
the condominium unit, including but not limited to solicitations in states where such offer or solicitation can not be made.
BREVARD BUSINESS NEWS / 2
Call Adrienne Roth at 951-7777 for Advertising Information
OMNI Healthcare’s Dr. Malis
on staff at Wuesthoff Melbourne
Dr. David Malis of OMNI Healthcare, a fellowship–
trained pediatric otolaryngologist, was recently awarded
staff privileges at Wuesthoff Medical Center Melbourne.
“I am happy to bring pediatric experience to the
children and families of Brevard County,” said Dr.
Malis. “As a parent of four children, I know how difficult
it is to see sub–specialists. With offices in both
Melbourne and Viera, I am able to offer unparalleled
pediatric ear, nose, and throat care to children, while
saving their parents the inconvenience of driving to
Orlando. I am thrilled to be joining the community and
to be at the forefront of bringing pediatric sub–specialty
surgical care to Brevard County. It is an honor.”
He has practiced for more than 15 years. Dr. Malis
received his undergraduate training at Lehigh University and his medical degree from The Medical College of
Pennsylvania, in Philadelphia. He completed his
residence training at Madigan Army Medical Center,
Tacoma, Wash., and otolaryngology training at Brooke
Army Medical Center in San Antonio, Texas. Additionally, Dr. Malis concluded his fellowship training in
pediatric otolaryngology at Children’s Hospital and
Health Center in San Diego, Calif.
Dr. Malis is board certified in otolaryngology. He is a
diplomat of the American Academy of Otolaryngology—
Head and Neck Surgery, in addition to being a Fellow of
both the American College of Surgeons and the American Academy of Pediatrics. Further distinguishing Dr.
Malis, is his membership in the American Society of
Pediatric Otolaryngology and the Society for Ear, Nose,
and Throat Advances in Children.
Dr. Malis is accepting new patients at his offices in
Melbourne and Viera. For more information or to
schedule an appointment, call 676–2353, or visit
www.mykidsent.com.
National Realty recognizes top producers
Gale Bray, broker of National Realty of Brevard, has
announced the company’s top–producing associates for
April. Top listers were: Steve Johnson, of the Melbourne
office; Elaine Chambers, Indialantic; Cary Kuschel,
Satellite Beach; Andy Waterman Team and Robert
Beatty, Palm Bay; Laura Speigner, Port St. John; and
Sue Ann Waser, Suntree–North Melbourne. Top sellers:
Mike Miller, Melbourne; Hope Turner, Indialantic;
Caroline Caliendo, Satellite Beach; Andy Waterman
Team; Beatty; Joyce Hallowell, Palm Bay; Karen Vidak,
Port St. John; Waser; and Kim and Robert Sisko,
Suntree–North Melbourne. Top producers: Eleanor
“Beth” Glover, Melbourne; Elaine Chambers,
Indialantic; Kuschel; Andy Waterman Team; Chad
Wamsley, Palm Bay; Vidak; Liane Ivey, Suntree–North
Melbourne; and the Siskos.
Dreyer handles real–estate transaction
Mutual Exchange LLC purchased the Babcock Plaza
retail strip center on North Courtenay Parkway in
Merritt Island for $3.25 million. The seller was W.S.
Babcock Corp. Michael Dreyer, president of Coldwell
Banker Commercial Sun Land Realty of Florida Inc. in
Melbourne, negotiated the sale as a transaction broker
between W.S. Babcock Corp. and Mutual Exchange
LLC. Dreyer has been an active full–time broker in
Brevard County since 1981. His full–service office
specializes in investment counseling, market and
property analysis, retail sales, leasing, build–to–suit
and site selection, among other areas of expertise.
Dreyer became a Certified Commercial Investment
Member in 1991.
MAY 21, 2007
BBN
DIGEST
MIMA’s Dr. Marzano takes
part in Rotary medical mission
1ER]HVIEQSJXLMWPMJIWX]PI
Peter Marzano, an internal medicine physician with
MIMA, recently returned from a medical mission to San
Pedro Sula, Honduras, where he served more than 140
patients during the four–day visit.
The trip, sponsored through the Rotary Club of
Orlando, assists physicians with travel arrangements
and provides an opportunity for residents in Honduras
to receive much–needed medical care by qualified
doctors.
“My first medical mission trip was enlightening on
many levels and I would encourage any physician to go,”
said Dr. Marzano. “Seeing the tremendous need for
health care in this little village, as well as how much
help we could provide in such a short period of time,
reinforced why I became a physician in the first place.”
Traveling with three other physicians, Dr. Marzano
treated patients of all ages, but most commonly dealt
with scabies, intestinal parasites and upper respiratory
infections at the clinic in Honduras.
“We are proud of Dr. Marzano’s community service
and thank him for his dedication to his profession,” said
Al O’Connell, MIMA’s chief administrative officer. “Dr.
Marzano’s caring and compassion for the work he
performs on mission trips translates into the day–to–
day relationships he builds with his patients.”
The Rotary Club of Orlando is looking for additional
physicians to participate in a mission trip on June 21–
24. The trips are Thursday through Sunday and the
physician is accompanied the entire visit. Fluent
Spanish is not required, but is helpful. If needed, an
interpreter is provided. If you are interested in signing
up, call 725–4500, extension 425.
Certified by the American Board of Internal Medicine, Dr. Marzano received his medical degree from The
American University of the Caribbean West Indies and
performed his residency at Mercer University in
Georgia.
Villa Verde
new ad emailed
3RP]ERIPMXIRMRI[MPPPMZIMX
FULL COLOR
7
.YWXWXITWJVSQXLI%XPERXMG3GIERERHFYMPXHMVIGXP]SRXLI&ERERE6MZIVMR'SGSE
&IEGL*PSVMHE:MPPE:IVHISJJIVWTVMZMPIKIHVIWMHIRXWESRISJEOMRHSTTSVXYRMX]XS
S[RXLIYXQSWXMRPY\YV]PMZMRK
)EGLMRGSQTEVEFPIVIWMHIRGIGSQTVMWIWWUJXGSVRIVYRMXWJIEXYVMRKFIH
VSSQW¹FEXLW¾SSVXSGIMPMRK[MRHS[WGYWXSQGEFMRIXV]VIRS[RIHXSTSJXLI
PMRIETTPMERGIWERHLERHQEXGLIHMQTSVXIH-XEPMERQEVFPI 7QEVXLSYWIXIGLRSPSK]
TERIPWGSRXVSPEPPGSQJSVX^SRIW°PMKLXMRK EMVGSRHMXMSRMRK HVETIV]WLEHIWERHWYV
VSYRHWSYRHW]WXIQWJSVQYWMGERHTVI[MVIH¾EXWGVIIR8:W
*SVXLIYPXMQEXITIEGISJQMRH:MPPE:IVHI[EWFYMPX[MXLFIXXIVXLERLMKLIWXGSQQIVGMEP
LYVVMGERITVSSJWXERHEVHWMRGPYHMRKEFEGOYTKIRIVEXSV 6IWMHIRXWGERVIWXIEW][MXL
WXEXISJXLIEVXWIGYVMX]W]WXIQWXLVSYKLSYXJVSQXLI[EPPIHERHKEXIHJVSRXIRXV]ERH
GPSWIHGMVGYMXGEQIVEWXSFMSQIXVMG½RKIVTVMRXVIGSKRMXMSRW]WXIQWEXIEGLHSSV
RBC Centura Bank promotes Collura
RBC Centura Bank has announced the promotion of
Rebecca Collura to Brevard County market executive.
The announcement was made by Roger Cook, regional
president for Florida Commercial Markets of RBC
Centura Bank. Collura has been employed with RBC
Centura Bank since January 2005. She has 10 years
banking experience in Brevard as a commercial lender.
Collura is a graduate of the University of North Carolina at Charlotte, with a bachelor’s degree in business
administration. She is an affiliate member of the
Melbourne–Palm Bay Area Chamber of Commerce,
serves on the Panther Board of Florida Institute of
Technology, as well as the Advisory Board of Viera
Business Academy. RBC Centura serves personal,
business and commercial clients in the Southeast
through more than 270 full–service banking centers, an
extensive ATM network, and telephone and Internet
banking. RBC is a wholly owned subsidiary of Royal
Bank of Canada. Collura may be reached at the Suntree
office. The number is 752–2710.
Three join RR board of directors
Rolling Readers Space Coast Inc. has welcomed three
new board members. They are: Alyssa Hickson of
Titusville, who has many years of experience in the
charitable sector; Barbara Moore of Rockledge, CEO of
the Child Care Association of Brevard; and Vicki Sacco
of Port St. John, an experienced grant writer and
administrator who is the principal of Riverview Elementary School in Titusville.
MAY 21, 2007
XVSPPSRXLIFIEGLFEXLIMRFVIEXLXEOMRKZMWXEWJVSQ]SYVTVMZEXIFEPGSR]SVPSYRKI
MRXLILIEXIHTSSP;LEXIZIV]SYVIWGETIMXGERRS[FI]SYVW
/IRRIH]7TEGI'IRXIVMWRIEVF]ERH3VPERHS-RXIVREXMSREP%MVTSVXERH(MWRI]EX
XVEGXMSRWEVIPIWWXLERLSYVHVMZIE[E]
-J]SYXLMRO]SY´ZIWIIRPY\YV]]SYLEZIR´XWIIRER]XLMRKYRXMP]SY´ZIWIIR
:MPPE:IVHI7MQTP]I\XVESVHMREV]4VMGIHJVSQQXSQMPPMSR
7SYXL'SGSE&IEGL*PSVMHE
[[[KVIIRIMRXIVREXMSREPGSQ
%15!,(/53).'
/00/245.)49
+VIIRI-RXIVREXMSREP6IEP)WXEXI
2%XPERXMG%ZI7YMXI''ETI'EREZIVEP*097%
p g
Medical & EMT Supplies
Uniform
Mart
Uniform
Mart
Uniform Mart
Featuring
Products
pick
up
BBN
pick
up
BBN
Uniforms Shoes Accessories
7-03-06
Bus 1-23-06
card
if needed
page 6
676-0000 page 9456-5654
Melbourne
Shopping Center
1387 S. Babcock Steet
Merritt Island
325 E Merritt Island Cswy.
Merritt Island
321-308-0334
Bus card if needed
e-mail - Yourhomesearch@aol.com
2000 Highway A1A
Indian Harbour Beach, FL 32937
Nancy Taylor
Broker/Owner
BBN
EDITORIAL
Anthrax paralyzes the body’s immune cells with lethal toxin
By Ann Griswold
University of Florida researchers have revealed how
the inhaled form of anthrax paralyzes the body’s
defenses and prevents immune cells from reaching the
site of infection. Anthrax killed five people in 2001 when
letters containing the bacteria’s spores were sent
through the mail. The UF findings, published in the
“EMBO Journal,” may lead to quicker diagnoses for
anthrax victims.
The disease causes flu–like symptoms that can take
weeks to develop, according to the Centers for Disease
Control and Prevention. But once the first symptom
appears, the disease progresses rapidly and patients
often die from shock before they realize they have more
than a common cold. The current method of detecting
anthrax relies on lab cultures that can take days to
complete. “We’re looking for approaches to detect
anthrax earlier in the blood,” said Russell During, a
postdoctoral fellow at UF’s College of Medicine. “We’re
trying to develop a test that would allow detection
within two or three hours of the bugs entering the blood
and secreting toxins.”
Once inhaled, anthrax releases a lethal toxin that
immobilizes the white blood cells that normally seek
and destroy invading bacteria. Just traces of the toxin
can slow movement of these cells, called neutrophils, by
50 percent, UF researchers discovered.
“Neutrophils have to get to the infection to kill
anything. If you paralyze them so they don’t move, they
BBN
Brevard
Business
News
4300 Fortune Place, Suite D
West Melbourne, FL 32904
(321) 951-7777
fax (321) 951-4444
(email) brevardbusinessnews@earthlink.net
PUBLISHER
Adrienne B. Roth
EDITOR
Ken Datzman
OFFICE MANAGER
Frank Schiffmann
Brevard Business News is published every Monday by
Brevard Business News Inc. Bulk Rate postage is paid at
Melbourne, FL and Cocoa, FL. This publication serves
business executives in Brevard County. It reports on
news, trends and ideas of interest to industry, trade,
agribusiness, finance, health care, high technology and
commerce.
Letters to the Editor must include the writer’s signature
and printed or typed name, full address and telephone
number. Brevard Business News reserves the right to edit
all letters. Send your letters to: Editor, Brevard Business
News, 4300 Fortune Place, Suite D, West Melbourne, FL,
32904.
Subscription Rates for home or office mail delivery are
$26.00 for one year (52 issues). Send all address
changes to: Circulation Department, Brevard Business
News, 4300 Fortune Place, Suite D, West Melbourne, FL,
32904.
can’t protect you,” said Dr. Fred Southwick, division
chief of infectious diseases at the UF College of Medicine and the study’s lead author.
But exactly how the anthrax toxin wards off neutrophils has puzzled scientists for years. Immune cells rely
on rod–shaped filaments called actin to propel them
toward an infection. In a previous study, Dr. Southwick
found that the toxin prevents actin assembly, leaving
neutrophils stuck in the mud.
“Actin is important because it’s the motor that causes
neutrophils to move,” said Dr. Southwick. “So it’s like
cutting the gas to the motor.”
Anthrax literally cuts the gas line. The toxin works
like a pair of scissors, snipping off the ends of a key
protein and preventing the transmission of messages
within the cell. As a result, immune cells never receive
the green light to assemble the actin motor, Southwick’s
findings demonstrate.
“Together, these studies provide important clues
about how anthrax escapes the immune system during
infection,” said Nick Duesbery, deputy director for
research operations and senior scientific investigator at
the Van Andel Institute in Grand Rapids, Mich.
In 1998, Duesbery discovered that the toxin interrupts the transmission of signals within cells. But Dr.
Southwick’s study is the first to explain how anthrax
can short–circuit a cell signal to block neutrophil
movement, a realization that has eluded scientists for
years. The finding almost escaped Dr. Southwick’s
research team as well, which was looking for proteins
that interacted directly with the toxin.
“I would say it’s the scientific equivalent of finding a
needle in a haystack,” Dr. Southwick said.
The team compared before and after snapshots of
neutrophils exposed to a purified form of the toxin, as
well as images showing how protein expression changed
in cells. After scrutinizing the images for hours, During
finally identified one protein that seemed to disappear
upon exposure to anthrax.
The protein turned out to be responsible for gathering the components of actin and shuttling them to the
center of the cell, where they are assembled into
filaments. “We’ve discovered that through this pathway,
lethal toxin blocks the function of a protein that regulates how actin assembles,” said Dr. Southwick, who
believes his findings may also explain how anthrax
paralyzes other types of cells, like the platelets that
normally help blood clot.
“We know that patients with anthrax bleed,” Dr.
Southwick said, adding that victims of inhalational
anthrax often suffer hemorrhages in their lungs and
lymph nodes. “No one understands why, and it could
very well be due to paralysis of platelets.”
During and Dr. Southwick are currently looking for
additional proteins targeted by anthrax. They hope to
develop a diagnostic blood test that detects the bacterium by checking for telltale changes in protein expression.
Dr. Southwick’s team used an unusual approach to
tease out the anthrax toxin’s effects on cell migration:
They allowed the immune cells to be hijacked by
another bacterium, Listeria monocytogenes. Listeria is
often used as a tool to study actin because it commandeers human cells and induces them to form the
filaments, which the bacteria use to navigate around the
body.
“We used one bacterium to weed out another. I’m not
aware of anyone ever doing that,” Dr. Southwick said.
“In an individual cell, you can’t figure out where the
actin is assembling and what’s controlling it. But
Listeria seems to use the same pathways that a cell
uses to crawl. So anything that blocks Listeria we
predict would also block neutrophils from crawling. And
that’s what we found.”
Florida Tech trustees support Golden Anniversary Campaign
Demonstrating their allegiance to the university they
help oversee, Florida Tech trustees have already
contributed generously during the silent phase of the
Golden Anniversary Campaign for Florida Tech. They
have, so far, collectively pledged and given more than
$4.8 million. “Though we are just coming out of the
campaign’s silent phase, the participation rate among
trustees is already 100 percent,” said Phillip Farmer,
trustee and campaign chair. “You can be sure that this
is a success we will build on.”
l Trustee F. Alan Smith and wife Sharon have
pledged $270,000 toward the campaign, which will
allow the College of Business to establish a Visiting
Executive Program. The program will support visits to
campus from corporate executives who will share their
expertise with students. Smith is a retired executive
vice president of General Motors Corp.
l Also supporting the College of Business, Trustee
Dale Dettmer and wife Pam have donated more than
$270,000 for a Dettmer Family Scholarship. Dettmer is
a partner in the law firm Krasny and Dettmer in
Melbourne.
l Trustee Joseph Caruso Sr. is channeling his love of
baseball to help talented athletes by allocating a more
than $150,000 donation to baseball scholarships.
Caruso is president and CEO of Omnifirst Capital
Corp., and owner of two minor league baseball teams.
l Trustee John Slack gave more than $40,000 to
create the Panthereum, located mid–campus off
Country Club Road. The outdoor music and performing
arts venue has already been the site of numerous
student concerts, the Jazz at the Panthereum series and
painting demonstrations. Slack is retired president and
CEO of DBA Systems Inc.
“We are extremely proud and glad that our trustees
are rising to this important occasion and providing this
solid foundation to the Golden Anniversary Campaign,”
said President Dr. Anthony Catanese.
‘Proteus Review’ winners announced
The 2007 edition of “Proteus Review,” Brevard Community College’s online literary arts magazine, has been
published and the winners for the publication’s writing and photography competition have been selected. The
winners are: Poetry: John White, student, “Sarah’s Dinner”; Prose: Stephanie Lynch, student, “David DeVinni”; Art:
Michelle Barone, student, the charcoal drawing “Self–Portrait”; and Photography: Bree Lundberg, student,
“Against the Grey Sky.” The publication can be viewed at www.brevard.cc.fl.us/proteus/. All submissions were
blind–judged by a panel of faculty jurors and each winner will receive an award equivalent to $100. “The ‘Proteus
Review’ staff congratulates the winners and expresses appreciation to all individuals who submitted entries for the
summer issue,” said Tracy Fritz–Summerall, student editor of the “Proteus Review.”
MAY 21, 2007
BBN
DIGEST
MTC forms unique partnership
with Florida Tech in Melbourne
MTC Technologies Inc., a public company, has
announced the formation of a unique relationship with
the Florida Institute of Technology to supplement the
research and development capabilities of MTC’s C4ISR
Group. “MTC’s C4ISR group delivers solutions that give
our military decision– makers a winning edge to fight
global terrorism,” says Mike Cauldwell, senior executive
vice president of C4ISR.
The company recently hosted a ceremony at the
C4ISR engineering division facilities in Satellite Beach,
celebrating the teaming of MTC with Florida Tech.
“Florida Tech brings a vast knowledge base and a
wealth of highly technical research capabilities that will
be an excellent marketing tool when pursuing new
opportunities to expand MTC’s footprint in the national
defense arena,” he said.
In particular, MTC will be working “extensively”
with the College of Engineering, which hosts several
research centers and laboratories including the Center
for Remote Sensing, Wireless Center of Excellence, and
the Center for Software Testing, Education and Research.
Frank Kinney, Florida Tech vice provost for research,
attended the ceremony and expressed the importance of
this new relationship. “This is the first time that
industry has aggressively pursued our capabilities.
Usually we are the ones out there trying to get companies to utilize our expertise. That has really impressed
us. We greatly appreciate that effort and look forward to
an exciting future together,” Kinney said.
Also in attendance from Florida Tech were Bob
Merrill, director of technology transfer, and Dr. Robert
Sullivan, Dr. Fredric Ham, Dr. Brian Lail and Dr.
Samuel Kozatis, all of the Department of Electrical and
Computer Engineering.
The two organizations are working together pursuing
new opportunities with the Department of Homeland
Security and the U.S. Special Operations Command.
MTC, through its wholly owned subsidiaries, delivers
warfighter solutions involving systems engineering,
information technology, intelligence, and program
management services to the Department of Defense.
The company was cited by “Forbes” as 16th of the “25
Fastest–Growing Technology Companies.” MTC was
founded in 1984 and is headquartered in Dayton, Ohio.
MCC
new ad emailed
Students take awards at conference
Eight Florida Tech students received awards for
their research papers at the Florida Academy of
Sciences Annual Meeting & Research Conference. The
conference was held at the University of South Florida
in St. Petersburg. Award–winning students in the
Atmospheric and Oceanographic Sciences Section were
Danielle Carpenter, outstanding graduate student
paper and the Sigma Xi graduate award for Florida
Tech; Charles Mulligan, graduate honorable mention;
Jacqueline DeAngelo, undergraduate honorable
mention; and Brian Zielinski, outstanding undergraduate student paper and American Association for the
Advancement of Science Award for a male student.
Award–winning students in the Physics and Space
Sciences Division were Jorge Landivar, outstanding
graduate student paper; Robert Bruntz, graduate
honorable mention; Jessica Edwards, undergraduate
honorable mention; and Christine Gabrielse, outstanding undergraduate student paper and the Sigma Xi
undergraduate award for Florida Tech. Sigma Xi is an
international scientific research society.
MAY 21, 2007
BBN
ADVERTISERS
Clay Stephens
new ad emailed
FULL COLOR
Nasa Palms Professional Center Office Condominiums
Seven
Seven buildings
buildings @
@ 6000
6000 sq
sq ft
ft each
each
Office
Office units
units from
from 2000
2000 square
square feet
feet
Custom
Custom floor
floor plans
plans to
to suit
suit each
each buyer
buyer
Prime
Prime Central
Central Melbourne
Melbourne Location
Location
Between
Between Holmes
Holmes and
and Wuesthoff
Wuesthoff
New
New Units
Units Available
Available Now!
Now!
152
152 N.
N. Harbor
Harbor City
City Blvd.,
Blvd., #200
#200
Melbourne,
Melbourne, FL
FL 32935
32935
321-751-6850
321-751-6850
N
Naassaa
PPaalm
lmss
LLooggoo
55-1
-144-0
-077
ppaaggee ??
from
from +/-1780
+/-1780 to
to 6000
6000 square
square feet
feet ready
ready
for
for immediate
immediate sale
sale and
and buildout!
buildout!
MAY 21, 2007
BBN
DIGEST
United Way honors Ramsey
for three decades of service
United Way of Brevard recently hosted a retirement
party for employee Frank Ramsey at Durango’s in
Cocoa Beach. Board members, employees and volunteers were in attendance to recognize Ramsey’s 30 years
of service to the organization and the community.
After a stellar career in the U.S. Air Force as a
fighter pilot, Ramsey brought his expertise and talents
to United Way of Brevard. During his tenure at United
Way, he served in many capacities, most notably as
campaign director. Ramsey also stepped into the role of
acting executive director in 1993 when John Nelson,
then executive director, succumbed to cancer.
Ramsey has been instrumental in the growth and
success United Way has seen over the years during his
tenure, said Rob Rains, United Way of Brevard president. Though his first campaign raised just over
$887,000, the 2006 campaign hit an all–time high of
$6.1 million. “Although Frank has worked part–time for
the last few years, he continued to be a vital part of our
United Way,” Rains said. “He has been a tremendous
resource for us all and will be sorely missed. But he’s
promised to come back and volunteer a bit and we’re
grateful to him for that.”
Ramsey was recognized at his retirement luncheon
by the Office of Personnel Management for the Combined Federal Campaign through the presentation of a
certificate for his years of service. Representing NASA
at the Kennedy Space Center, Nap Carroll presented
Ramsey with a framed launch graphic commemorating
his service to United Way and to the Combined Federal
Campaign.
Those in attendance included David Brock, Dr.
Laurette Bryan, Mel Broome, Nap Carroll, Libby
Donoghue, Tom Eye, Bunny Finney, Ken and Peggy
Gallant, Bill and Carolyn Hoskinson, Daryl Gilbert,
Jack Johnson, Dr. Maxwell King, Linda Lawrence,
George Mikitarian, Don Ramsey, Mark Ramsey, Joe
and Janette Robinson and Patrick Wigglesworth.
BOUVIER & ASSOCIATES
CERTIFIED PUBLIC ACCOUNTANTS
Bouvier
pick up BBN
4-23-07
page 3
YOUR B
USINESS COLOR
IS OUR BUSINESS
FULL
Small Business Services
Corporate & Individual Tax Returns
Auditing & Accounting
Financial Reviews & Compilations
BCC Board of Trustees to meet May 21
The Brevard Community College Board of Trustees
will meet on Monday, May 21, in the Parrish Student
Center (room 210), on the Melbourne campus, 3865 N.
Wickham Road. A workshop will be held at 3 p.m.
followed by the meeting at 4:30 p.m. For more information, call Jim Ross, vice president for advancement and
public affairs, at 433–7023.
MAY 21, 2007
1031 Exchanges
American Institute of Certified Public Accountants
Florida Institute of Certified Public Accountants
National Association of Certified Valuation Analysts
3210 N. Wickham Road , Suite 5 Melbourne, FL 32935
Phone 321-752-9967 Fax 321-752-9927
www.bouvierassoc.com
You can enhance
your company's image
with one simple move!
SHS students design plans for Habitat
During this current school year, students at Satellite
High School have been working to help Habitat for
Humanity of Brevard design floor plans for a two–story,
five–bedroom home; build wooden models of the houses,
and put building documents in a CAD system. The
students in Lesa Lorusso’s level 2 and 3 Drafting,
Illustration Design Technology classes have been
getting hands–on opportunities. After hearing Joe
Gassman, CEO of Habitat for Humanity, spoke to their
classes in September 2006 about the need for more
affordable housing in Brevard County, the students
traveled to the Habitat worksite to begin their building
experience. Once back in the classroom, they went to
work on putting current designs into a CAD format;
designing the new plans and building models of their
plans. On Wednesday, May 16, the drafting students
will make a special presentation of their accomplishments to the Habitat for Humanity staff. For more
information on this unique partnership, contact Habitat
for Humanity at 255–5800.
Accounting Software Support
Tax Planning & Strategies
Qualified Intermediary for
New copy in box
just pick up
photo
One Harbor Place offers you
Melbourne's best office views
overlooking the scenic Melbourne
Harbor and the Indian River, not to
mention covered parking and a
fitness center. From the sixth floor
business center, offering the total
corporate environment, to beautiful
private suites for your expanding
needs, One Harbor Place provides
the ultimate image of success.
One Harbour Place
FULL COLOR
One Harbor Place
pick up BBNAnd for a limited time, lease rates
pick
up BBNare being offered at a substantial
3-26-07
savings. Call Todd Rosborough,
1-23-06
page 6 SIOR at 751-0700 or One Harbor
at 725-7256 for details.
page ???? Place
No other address makes you look
so good.
FULL COLOR
FULL COLOR
ONE HARBOR PLACE
S.R. 192 and U.S. 1
Melbourne
BBN
DIGEST
Palm Bay Commerce Centre
grand opening set for May 18
Surfside Playhouse
pick up BBN
5-07-07
page 8
PALM BAY— Realty Investment Services and the
Greater Palm Bay Chamber of Commerce will host a
ceremony at noon on May 18 to mark the opening of
Palm Bay/95 Commerce Centre.
Businessowner can tour the newly constructed
27,600–square–foot condominium office/flexible–space
project. The facility is situated immediately southwest
of exit 176, at the I–95/Palm Bay Road interchange, off
Palm Bay Road. Other projects located in the vicinity
on Culver Drive include the recently opened Mercedes
Homes Model Center, the Osler Medical Building and
the Palm Bay Senior Center.
The Palm Bay/95 Commerce Centre features an
upscale Florida vernacular design. It offers
businessowners an opportunity to own their office
space instead of leasing.
Attractive financing programs for buyers at Palm
Bay/95 Commerce Centre are available through
Indian River National Bank, Mercantile Commercial
Capital LLC, The Bank Brevard and GE Capital. A
unique 97 percent loan program is also available
through Elect Mortgage. Representatives from these
financing sources will be available to discuss your
specific financing needs.
Visit www.realtyinvestmentservices.com/
palmbay95.htm, or call (954) 612–1210 for more
information about the ceremony and luncheon. To
learn more about the project, e–mail
tomandrews@realtyinvestmentservices.com.
Milo Zonka forms financial–services firm
Milo Zonka, a certified financial planner, has
announced the formation of Zonka & Associates Inc.
The independent financial–services firm serves
individual and corporate clients from its office in the
Eau Gallie section of Melbourne. Through its relationship with Linsco/Private Ledger (LPL), Zonka &
Associates provides comprehensive financial planning,
investment management and investment–advisory
services. Zonka, who has eight years experience with
national financial–services companies, serves as
president as well as general securities principal. “My
focus is on the individual,” said Zonka. “Firms with
millions of clients and their own corporate agendas
cannot truly individualize their approach. A small,
client–centric firm with relationships in the dozens
can.” Zonka serves as chairman of the Valkaria
Airport Advisory Board, vice chairman of Brevard
County’s Investment Committee, and is on the Florida
Tech Alumni Association Board of Directors. For more
information, call 253–2838, or visit
www.ZAfinancial.com.
Clark Scholarship recipient announced
At Florida Tech’s annual Honors Convocation in
April, Ashley Bacon was the recipient of the Dr. Kerry
Bruce Clark Endowed Scholarship in Marine Biology.
She earned the award for her strong academic record,
involvement in research, campus community activities
and vision for professional development. Bacon, from
Stratford, Conn., is currently a junior majoring in
marine biology. She is a member of the Tri–Beta
biological honor society and Phi Eta Sigma national
honor society for freshman students. Dr. Kerry Bruce
Clark was a member of the biological sciences faculty
from 1971 until his death in 1999. A full professor, he
was named a 1996 Fellow by the American Association for the Advancement of Science in honor of his
work documenting rare species of sea slug.
MAY 21, 2007
BBN
DIGEST
Zoo invites community to
May 27 ‘Paws On’ event
The Brevard Zoo is getting ready to begin renovations on the children’s play area, known as “Paws On.”
The community is invited to visit the zoo from 11 a.m. to
4 p.m. on Sunday, May 27, to say goodbye to “Paws On.”
On June 2 and 3, the zoo will begin renovation of the
13 year–old exhibit.
It’s the first project identified in the zoo’s 10–year
business plan that includes renovation of many of the
existing exhibits and addition of new exhibits and
animals in the future. The first phase of the “Paws On”
renovation will be the Wildlife Detective Training
Academy, which is scheduled to open in August. The
rest of the nature discovery area will open in the
summer of 2008.
“We are encouraging patrons to join us on May 27
and share any of their photos of playing in the ‘Paws On’
children’s area and, more important, share their
memories with us. We will have a banner for guests to
sign saying goodbye,” said Andrea Hill, marketing
director for Brevard Zoo.
The Brevard Zoo was built by the community
starting in the spring of 1992. “Paws On” was one of the
first exhibits completed. It is estimated that more than
16,000 volunteers helped build the zoo.
According to Keith Winsten, the zoo’s executive
director, “Paws–On” was a second home to a generation
of Brevard’s children who grew up visiting the zoo. “Now
after 13 years of service, it’s beginning to show its age.
Luckily, a zoo team, working with members of the
community, have designed an even more exciting
nature play space for children that will open in stages,
starting this summer. We want to recognize all of the
individuals who helped build the original ‘Paws–On’ and
to invite them to help us build the new one.”
For more information, call 254–9453 or visit
brevardzoo.org.
DESIGN.PIPPRINT.
MAIL.
Printing
PIP CAN DO IT.
pick up BBN
5-14-07
page 8
WE’RE THE SPECIALISTS IN DESIGNING, PRINTING, COPYING, FINISHING
AND MANAGING YOUR DOCUMENTS. WE’LL EVEN PROVIDE YOU WITH MAILING SERVICES. FOR
DOCUMENT SOLUTIONS THAT CAN IMPROVE YOUR EFFICIENCY AND YOUR IMAGE, CALL PIP TODAY.
BUSINESS PACKAGE SPECIALS • FULL COLOR PRINTING SPECIALS
SAVE ON DIRECT MAILING
951-4354  Fax: 724-5307
Eberle selected for program in Japan
Louise Eberle, a second–grade teacher at Manatee
Elementary School in Viera, has been selected for an
international educational experience as part of the
Japan Fulbright Memorial Fund (JFMF) Teacher
Program. Eberle, who has spent 25 years as an educator, will visit Japan for three weeks in October and
November. “We are proud to have Ms. Eberle represent
our school, our district and our state in this exciting
adventure,” said Carl Brown, principal of Manatee
Elementary. “We look forward to sharing with our
students the first–hand knowledge of Japan she’ll gain
as part of this experience.” The JFMF Teacher Program, sponsored by the government of Japan, provides
American primary and secondary–school teachers and
administrators with fully–funded short–term study
tours of Japan. The program is designed to increase
understanding between the people of Japan and the
United States by inviting U.S. elementary and secondary educators to visit Japan and share their experiences
with fellow Americans upon their return. This year, up
to 400 outstanding educators from all 50 states and the
District of Columbia are being invited to participate.
Writers to meet at West Melbourne Library
Published and beginning writers will meet at the
West Melbourne Library, 2755 Wingate Blvd., in West
Melbourne, at 7 p.m. on Wednesday, May 23, for
editorial review and peer discussion of their writing
samples. Attendees do not need to be members of any
formal writer’s group to participate. Mary Brotherton
will lead the meeting. Call 574–0541 for more details.
MAY 21, 2007
1480 Palm Bay, Road NE
Palm Bay, Florida 32905
www.pip.com/palmbayﬂ
E-mail: info@pipcandoit.com
©2007 PIP PRINTING and DOCUMENT SERVICES
National
pick up BBN
5-14-07
page 2
Artemis
pick up BBN
5-14-07
page 9
Woodlake
pick up BBN
5-14-07
page 2
BBN
BUSINESS
Central Florida businessman Fred Hudson expands into Brevard
County with 65,000–square–foot retail furniture store in West
Melbourne — showcases the company’s new, sharp store design
By Ken Datzman
Businesses out of the area continue to see Brevard County has a solid market
for expansion. With more than 500,000 residents, the county’s demographics are
attracting growth companies like Hudson’s Furniture.
A private company based in Central Florida, Hudson’s Furniture is unveiling its
new 65,000–square–foot retail store in West Melbourne, a showcase project for the
business that is expanding into select Florida markets and positioning itself for the
future.
Broyhill Furniture Galleries by Hudson opened recently, catching the attention
of passersby on West New Haven Avenue. The classy complex is next to Saturn
Space Coast and shows off the company’s new design.
“We think it’s a beautiful facility and a nice addition to the community,” said
Tabitha Davis, Hudson’s corporate trainer and the store’s manager. “This is our
16th store in Florida. We’re growing. We have another store set to open in the next
couple of months in Pinellas Park. The projections are to open two or three more
stores in the next two to three years in Florida.”
Company founder C. Fred Hudson III opened his first furniture store in
Ormond Beach 25 years ago. Today, Hudson operates more than 20 stores in
Florida, North Carolina and Georgia. The corporate offices, warehouse and
distribution center are in Sanford.
Hudson’s business model centers on providing a high level of service to its
customers, offering attractive pricing and a wide selection of furniture and accessories from multiple manufacturers, in pleasant surroundings.
About five years ago, Hudson’s opened on East Colonial Drive in Orlando. Davis
said a number of its customers were from Brevard. “We decided to start looking for
property in Brevard County.”
The company was able to get a prime piece of real estate not far from I–95.
Davis, who is from Brevard County, says Hudson’s is Florida’s largest Broyhill
Showcase Gallery. Broyhill is part of Furniture Brands International, the nation’s
largest home–furnishings manufacturer. It manufacturers such brands as
Thomasville, Henredon and Drexel Heritage.
While Broyhill is Hudson’s flagship brand, the store also sells a full slate of
mid–priced furniture and furnishings by other manufacturers. They include Lane,
Lexington, Stanley, Bench Craft, Aspen Home, Bernhardt, Berkline and Stearns &
Foster.
“Everything that is available in the marketplace, in our price range, we pretty
much carry. There are some exceptions. But overall, we offer quality products and
value pricing. That is the cornerstone of our success. Hudson’s provides a lot of
‘look’ for the money. Fred (Hudson) spends a lot of time locating the right piece of
real estate in a desirable location to make it all work.”
She says her company “loves the Brevard demographics.”
Hudson’s is looking to draw customers to the new West Melbourne showroom,
which employs 30 people, from throughout Brevard and Indian River counties,
Davis said. A growing number of furniture stores are locating on West New Haven
Avenue. “People typically shop two or three stores before they make a purchase,”
she said.
The showroom is at 4260 W. New Haven Ave. The store is easy to browse
because of its open layout. “Everything is set up in home–style vignettes,” said
Davis, who joined Hudson’s five years ago as a salesperson at the Orlando store
and grew her career with the company. “The customer can see what the bedroom,
the dining room and the living room look like together. They don’t have to walk
half way across the store to see if things match. There are vignettes throughout the
entire showroom.”
She adds, “This store offers one–stop shopping for the customer. There are not
too many things we can’t do for the customer. We can customize just about
everything on our showroom floor — from the fabrics to the leathers to providing
optional beds. Most of the collections offer lots of options for customers and they
really like it.”
Hudson’s also runs a full–service, in–house interior–design business.
Over the past two decades, household furniture purchases increased significantly, from $29 billion in 1985 to $78 billion in 2005, or 168 percent, according to
the Aktrin Furniture Information Center.
Tabitha Davis is Hudson’s corporate trainer and manager of the company’s newest store at 4260 W.
New Haven Ave. in West Melbourne. Tony Villa is sales manager. The store is next to Saturn Space
Coast. Broyhill Furniture Galleries by Hudson sells a full slate of mid–priced brands including Lane,
Aspen Home and Bench Craft. This is Hudson’s 16th store in Florida.
With the housing market in a recovery mode, furniture sales have been soft in
many parts of the nation. Davis says Hudson’s is bucking the trend.
“Furniture sales have been strong for us. The industry has been down, but we’re
still up. I think that says a lot about Fred Hudson and how he runs his company.
He runs the business with a lot of integrity. We offer customers the best possible
service and outstanding product value. As long as our customers and our salespeople are happy, we’re a success all the way around.”
Hudson’s complex on West New Haven Avenue has space available for lease.
The facility was designed to accommodate related businesses, such as interior
design shops and flooring companies, for instance. “There are a lot of options
available for the lease space,” she said. “It can be leased as one large building, or
the space can be divided into three separate buildings.”
Space is available from 5,000 to 40,000 square feet. For more information on
leasing, call Jim Graves at (407) 462–9530 or e–mail
JLGraves@hudsonfurniture.com.
MAY 21, 2007
BBN
BUSINESS
Write your way to the top — high–school students can sharpen
their writing, get creative in Florida Tech’s Summer Writing Camp
led by experts Marcia Denius and Mary Mullins; more camps set
By Ken Datzman
Fundamental writing skills have been on the decline for some time. The rise of
electronic communications and advanced technology in the workplace seem to have
compounded the problem. Yet the need to write clearly has never been more important, especially in business and in the classroom.
“Good writing is such a prized possession. And you have to learn to think clearly
before you can write clearly,” says Marcia Denius of Florida Tech, an assistant
professor in the Department of Humanities and Communication.
She and colleague Mary Mullins will conduct the second annual Summer Writing
Day Camp for high–school students July 9–13 on the Melbourne campus. “We love
what we do. It’s very rewarding,” says Mullins. The camp aims to sharpen students’
skills in writing SAT and college–application essays, as well as offer enriching
experiences in poetry writing and film scriptwriting.
The creative writing sessions will be held from 9 to 11:30 a.m.; essay writing and
language skills will be offered from 12:30 to 3 p.m. “We would like the students to
apply for both aspects of the workshop, but they don’t have to,” said Mullins, an
instructor.
The cost is $275 per student for both sessions (a $75 registration fee will be applied
to the cost of the camp). Enrollment includes a notebook of writing tips. There will be
guest speakers and writing experiences for the students in Florida Tech’s Botanical
Garden. The registration deadline is June 29. For additional information, contact
Delilah Caballero at 674–7248, or e–mail dcaballe@fit.edu.
Last year’s camp got good reviews from the students. “They all seemed to really
enjoy it,” said Denius. “Their evaluation at the end was glowing. The students said
they learned a lot. They get a full gamut of writing experiences in the one–week
camp.”
“We are going to have some fun, too,” says Mullins. “It’s not just going to be all
school throughout the week. We will have some games like Grammar Jeopardy. On
the last day of camp, we’ll have a team essay contest. The students will work in teams
of three.”
On the SAT writing piece of the workshop, students will gain hands–on experience,
said Mullins, who started teaching at Florida Tech in 1978. “In addition to the actual
producing of the SAT essay, we’re going to be studying the verbal section. A part of the
verbal section now is grammar and editing, and all the tools that make up the writing
component.”
The class of 2006 was the first to take the new version of the College Board’s SAT
featuring a writing section.
At Florida Tech, Mullins teaches remedial writing, freshman composition and
writing about literature. She also teaches public speaking. Mullins majored in speech,
drama and English and holds degrees from Louisiana State University and Memphis
State University. MSU is now known as the University of Memphis. For the past five
years, Mullins has also run her own SAT prep business. There have been success
stories. Her very first student raised his verbal score 200 points and went on to earn a
scholarship to the University of Miami.
Denius, who joined the Florida Tech faculty in 1992, teaches creating writing and
script writing, and a new course she put together last year on science and literature.
She is a graduate of the University of Florida, with a degree in English literature.
Denius has a master of fine arts from the University of Vermont, with an emphasis on
poetry, and a master of arts from the University of Central Florida. She has studied
abroad, too. Denius studied at Universitat Wien in Vienna, Austria, and at the
Universidad de Mexico. Her first job out of college was at the National Security
Agency in Washington, D.C., where she was a cryptanalyst.
Her late father–in–law, Homer Denius, was a strong support of Florida Tech since
its inception in 1958. Homer Denius co–founded Radiation Inc. and was chairman of
the company when it merged with Harris Corp. in 1967.
Here are some highlights of other Florida Tech summer camps:
l Students entering the sixth through 12th grades are invited to take part in the
Marine and Environmental Science Camp. The camp, which meets July 23–27, from
9 a.m. to 3 p.m., is an “odyssey of discovery.” Students will enjoy fresh air and exercise
as they explore Brevard’s coastal ocean, the Indian River Lagoon and small creeks.
They will take a boat tour, test water quality, sample and identify estuarine and
marine plankton, and fish with a seine in seagrass beds.
MAY 21, 2007
Marcia Denius, left, and Mary Mullins of Florida Tech’s Department of Humanities and Communication will conduct the second annual Summer Writing Day Camp for high–school students the week
of July 9–13. The camp aims to improve students’ skills in writing SAT and college–application essays,
as well as offer enriching experiences in poetry writing and film scriptwriting.
Registration is due by July 6. The fee is $325 per student for day campers or $575,
which also covers meals and lodging, for out–of–town participants. For more information, contact Tonya Mitchell at 674–8096 or e–mail dmes@fit.edu.
l The Focus on Applying Mathematics in Engineering camp will be held July 9–13,
from 8 a.m. to 5 p.m., on campus. The experience is designed for high–school students
who have already taken precalculus. The students will take on “real–world” civil
engineering projects using precalculus mathematics. They will conduct related
laboratory experiments, master engineering tools such as spreadsheets, and learn the
scientific principles behind the engineering.
“The student will learn from college professors and practicing engineers and get a
head start on an engineering career,” said Dr. Ashok Pandit, head of the Florida Tech
Department of Civil Engineering.
A computer will be assigned to each student. The cost to attend the camp is $700
for overnight students, which includes all meals and evening entertainment. The cost
is $425 for day students and includes lunch. The registration deadline is June 15. The
camp is one of three offered by the Florida Tech Department of Engineering. The
other two, known as construction camps, will be held July 16–20 and July 30–Aug. 3.
For more details about all three camps, contact Christel Noyes at 674–8048 or e–mail
cnoyes@fit.edu.
l Florida Tech also conducts a full slate of summer sports camps and clinics for
youngsters and adults. The lineup includes camps on baseball, basketball, snorkeling,
soccer, tennis, volleyball, softball and rowing. The dates and pricing are available by
calling the Athletics Department at 674–8032.
BBN
DIGEST
Mike Erdman Toyota is named
Certified Toyota Mobility dealer
Junior Achievement
Junior Achievement
use new one
next add
in series
Call for information on how you can help
and
phone number 636-1000
MERRITT ISLAND— Mike Erdman Toyota/Scion has been named a Certified
Toyota Mobility Dealer by Toyota Motor Sales U.S.A.
“Mike Erdman Toyota/Scion joins an exclusive but growing group of Toyota dealers
certified to assist the physically challenged so that they can enjoy the mobility others
take for granted,” said Jim Lentz, executive vice president of TMS. “Our ‘Moving
Forward’ theme is more than just an advertising tag line. It’s a commitment to our
customers, especially those with special needs that require the installation of adaptive
equipment.”
The Mike Erdman Toyota dealership qualified for this certification by:
l Establishing the Mike Erdman Mobility Center as a specialist in understanding
mobility issues and the appropriate adaptive equipment available to meet the
transportation needs of physically challenged customers.
l Appointing Chuck Shierry as Mobility Champion sales manager. Shierry
completed special training in order to be more knowledgeable in offering transportation solutions.
l Ensuring that select Toyota models with adaptive equipment are on display on
the showroom floor.
“We’re extremely proud to have completed the certification process for this invaluable program and we’re equally proud that Toyota has committed to addressing the
needs of people in our community with disabilities or mobility issues,” said Bill
Kennedy, general manager of Mike Erdman Toyota and Scion.
Toyota Motor Sales U.S.A. established its consumer Toyota Mobility Assistance
program in 2001. The program provides Toyota new vehicle customers with cash
assistance of up to $1,000 of the cost of adaptive equipment for Toyota vehicles.
Eligible equipment includes wheelchair restraints, wheelchair–accessible ramps,
power swivel and lift seats, steering devices and hand controls. Any original purchaser or lessee of a new Toyota, Scion or Lexus vehicle may participate in the Toyota
Mobility Assistance Program.
Additional information is available by calling Shierry at 454–4430, extension 178.
Tim Armstrong earns CFP designation
Call for information on
how you can help
636-1000
ERA Showcase
pick up BBN
5-14-07
page 5
CPA Wealth Management Services, a client–centered financial planning and
investment advisory firm, recently announced that Tim Armstrong has earned the
Certified Financial Planner designation. “By passing this examination, Tim has
achieved a goal that separates him from financial planners who lack that professional
designation,” said Thomas Kirk, president and CEO of CPA Wealth Management
Services in Brevard. “The rigorous criteria for passing the CFP certification exam
ensures our clients receive the best quality advice and assistance for their long–term
financial security.” Of 3,642 candidates who took the exam when Armstrong did, only
54 percent passed. CPA Wealth Management Services is a member of the Hoyman
Dobson family of companies. For more information, call 254–1668.
Needelman to run for County Clerk of Court
State Rep. Mitch Needelman (R–Melbourne) has submitted his intent to run for
the Brevard County Clerk of Court seat in 2008. He filed papers with the Brevard
County Supervisor of Elections. Needelman has served as the representative of House
District 31 since being elected in 2000, and is completing his final two–year term.
Because of term limits, he is ineligible to run for the Florida House of Representatives
in the 2008 elections. A retired Florida Marine Patrol officer, Needelman holds dual
master’s degrees in public administration and human resources development. “I have
always put Brevard County residents first and foremost in legislation I created or
voted on in Tallahassee. My motto is: ‘Promises Made, Promises Kept.’ I will take the
same amount of dedication and enthusiasm and use it to benefit our county court
system and residents,” he said. Call Ruth Montelione, campaign consultant, at 777–
6150 for more information.
Health First approves Palm Bay Hospital expansion
The Health First Board of Directors has approved an additional $15.5 million to
complete the Palm Bay Community Hospital expansion. The funds will be used to
complete a third floor, which was previously scheduled to be built at a later date. The
third floor will add 40 all–private inpatient beds and a 12–bed intensive–care unit.
Earlier this year, Health First approved $68 million for construction that would
almost double the size of Palm Bay Hospital. Including the third floor, the expansion
will now provide for 80 additional all–private inpatient beds, expansion of the Emergency Department with 10 new observation beds, two new special–procedures suites,
a larger food–service area and cafeteria, new rehabilitation and respiratory therapy
areas, and the additional 12–bed ICU. Construction is scheduled to be completed in
2009. Palm Bay Hospital is currently a 60–bed, full–service facility.
MAY 21, 2007
DIGEST
BBN
$3.8 million renovation is
finished at Merritt Square
MERRITT ISLAND — Merritt Square has completed a $3.8 million renovation
that includes lighting improvements, a Food Court update, new seating areas and a
redesigned main entrance. The changes, which are part of the 800,000–square–foot
mall’s ongoing redevelopment efforts, have brightened the center’s feel and offer a
more contemporary and comfortable shopping environment, said Robert Sheard,
Merritt Square general manager.
“Merritt Square is responding to the growing demands of a dynamic local community. Through these renovations, we will be able to offer even more exceptional
shopping choices, as well as an enhanced level of comfort for the entire family,” he
said. A redesigned main entrance opens up the outside view of the front–entry doors
and increases the amount of natural light down the center’s north concourse. A
simplified architectural design, which was inspired by the casual, distinctive style of
Florida’s many coastal bungalows, features galvanized metal roofing and columns
covered with cast–stone veneers and sea–glass tiles.
The facades of the center’s northwest and south mall entrances also have been
given a facelift with fresh paint, new decorative concrete sidewalks and upgraded
landscaping. New soft–upholstered seating areas further enhance the shopping
experience and provide shoppers a comfortable place to relax. Situated near the mall
entrances of Merritt Square’s four anchor department stores, each area consists of
beach–style furniture that is constructed of teak and upholstered with brightly
colored, durable fabrics.
An exterior monument signage program consists of new signs at each of three
entrances along State Road 520 (Merritt Island Causeway) and Sykes Creek Parkway, and helps increase the mall’s visibility from both roads.
Additional exterior signage along the center’s ring road provides visitors with easy
direction to its anchor stores, the Food Court and the Cobb 16 Theatres. All are
branded with Merritt Square’s new logo.
New interior directional signage similarly provides visitors with easy direction to
its anchor stores, the Food Court and the Cobb 16 Theatres.
New skylights above the Food Court, center court and Sears courtyard give way to
increased natural light in the center’s common areas. Interior brightness is further
enhanced by improved down and directional flood lighting. In addition, 32 large,
round decorative chandeliers are suspended at various points throughout the mall
and are made of polished, stainless steel frames with fabric shades to simulate white
canvas.
The removal of built–in planters has provided the Food Court with a more open
and airy feeling and the space for additional seating. Further Food Court updates
include new tile accents, tables, paint and decorative pendant lighting. New ceramic
tile in the common area located between the Food Court and the Cobb 16 Theatres
further accentuates the space’s greater sense of light.
Merritt Square is anchored by Dillard’s, JCPenney, Macy’s and Sears. For more
information, visit www.merrittsquaremall.com.
Gala raises $230,000 for breast cancer technology
The Wuesthoff Health System Foundation raised more than $230,000 for breast
cancer technology and services during its fifth annual gala event. Held at the
Clemente Center at Florida Tech in Melbourne, more than 440 guests attended the
black–tie affair. Highlights of the event included video testimonials featuring personal
stories of breast–cancer survivors Dottie Gatti, Retta Huff and Theresa Williams, all
Brevard residents. Joe Scarborough was the keynote speaker. The gala was sponsored by the following businesses and individuals: Central Brevard Anesthesiologists,
Community Educators Credit Union, Dr. and Mrs. Shashin Desai, Dr. and Mrs. Gopal
Gadodia, “Florida Today,” Walter and Dottie Gatti, National City, Harris Corp.,
Hematology Oncology Associates of Central Brevard, Scott and Retta Huff, Mercedes–
Benz, Porsche, Audi of Melbourne, Northern Trust, Northrop Grumman Corp., Drs.
Sumant and Snehlata Pandya, Rockwell Collins, Wachovia Foundation, the Wasdin
Family and LTD/Waste Management.
Health Savings
CECU
Accounts
Community Educators Credit Union is now
offering Health
Savings
Accounts(HSAs)!
pick
up BBN
5-14-07
An HSA is an account
that you can put money in
to save for future
pagemedical
16 expenses.
Two great ways
to save!!
Health Savings Account
x Rate: 5.07% APY
(Annual Percentage
Yield)*
x Dividends:
Paid quarterly;
compounded quarterly,
based on the average
daily balance.
x Minimum to open: $10
x Rate: same as CDs
x Dividends:
Paid monthly;
compounded monthly,
based on the average
daily balance.
x Minimum to open:
$2,500
CECU membership is required. Must have a High Deductible Health
Plan. Eligibility to open an HSA is subject to applicable laws.
Membership is open to all residents of Brevard and surrounding
counties. $5 deposit required to open primary share account. *Rates
are subject to change. Account federally insured by NCUA.
Zonta Club awards scholarship to Perkowski
The Zonta Club of Melbourne awarded its Young Women in Public Affairs/Monica
Jean Campell Scholarship to Caroline Perkowski, a senior at Eau Gallie High School.
Perkowski is from Melbourne and plans to attend the University of Central Florida
majoring in microbiology. She currently volunteers at Holmes Regional Medical
Center and plans to join Doctors Without Borders upon graduation. Perkowski will
now become eligible for the YWIPA scholarship in District 11, which encompasses
Florida, Georgia, Alabama, Tennessee, Mississippi, South Carolina, North Carolina,
Bahamas and Puerto Rico. The scholarship recognizes young women committed to
leadership in public policy, government and volunteer organizations.
MAY 21, 2007
HSA Savings Certificate
of Deposit
321/690-2328
www.cecu.org
CECU is federally insured by the
National Credit Union Administration.
BBN
EVENTS
Electronica Cosmic Concert at BCC
The Electronica Cosmic Concert will feature
cutting–edge sound designs throughout June every
Saturday at 9 p.m. in the Brevard Community College
Planetarium and Observatory, 1519 Clearlake Road,
in Cocoa. Students from the Musical Instrument
Digital Interface sequencing class in the BCC Fine
Arts Department created the sound designs for the
program, said Scott Cockerham, instructor for the
class. The light show sequence, which was created by
Mark Howard, director of the planetarium, is uniquely
crafted to entertain and educate. “The light show is
truly phenomenal,” Cockerham said. “It was the
consensus that we had to share this with the public.
We have some really talented students that when
given this unique opportunity really excelled. The
future of music is here and it’s exciting. With basic
computer skills creating and arranging music is more
accessible than ever before.” For more information, call
the Planetarium at 433–7372.
Imperial Plaza
new ad emailed
Easter Seals’ Walk With Me benefit May 19
FULL COLOR
Easter Seals will host its annual Walk With Me
fund–raiser at 8 a.m. on Saturday, May 19. The one–
mile fitness walk will unite thousands of Melbourne–
area participants at Wickham Park to raise money
and awareness for Easter Seals’ services and help
change the lives of people living with autism and other
disabilities. Registration for this year’s Walk With Me
is available at either www.walkwithme.org or by
calling 723–4474, extension 3105. Every individual
and team participant will be paired with an Easter
Seals Honorary Ambassador— a child or adult with a
disability directly benefiting from Easter Seals’ local
services— and have an opportunity to meet in advance
of the event, learn about his or her personal story, and
even cross the Walk With Me finish line together. “The
Melbourne event is an opportunity for families,
friends, neighbors and colleagues to walk together for
fitness and a common purpose–to help people with
disabilities,” said Gail Edwards, executive director.
This year a new two–mile race is included for all
runners. The race begins at 7:30 a.m. Participants pay
a $15 entry fee in advance or $20 the day of the event.
Visit www.spacecoastrunners.org to register.
Shuler to conduct public auction in Titusville
Cliff Shuler Auctioneers & Liquidators Inc. will
conduct a public auction at 1 p.m. on Sunday, May 20,
in downtown Titusville. He has been contracted by the
cities of Titusville and Cocoa Beach, Brevard Community College, bankruptcy court, secured lenders and
private estates to sell at auction a wide range of
merchandise. The auction will include vehicles,
motorcycles, furniture, vending machines, tools and
jewelry. Additionally, Shuler & Shuler Real Estate
Auctioneers Inc. will auction residential acreage in
Mims, St. Augustine and Apopka. For photos and
more details, visit www.soldfor.com. A brochure can be
picked up on site at 422 Julia St., in Titusville.
Chamber to host Power Lunch May 24
“MORTGAGE MONEY”
Dependable, Careful, Professional
Crissy
pick up BBN
5-14-07
777-3232
page lender
7 since 1981”
“Brevard’s most referred
Allied
pick up BBN
5-14-07
page 5
The Melbourne–Palm Bay Area Chamber of
Commerce will host a Power Lunch at 11:30 a.m. on
Thursday, May 24, at the Hilton Melbourne Rialto
Place. The speakers will include Sen. Mike
Haridopolos and Rep. Thad Altman. They will discuss
the 2007 General Session and the impact of this year’s
approved legislation. The registration deadline is noon,
May 21. The cost is $20 for members in advance and
$30 at the door. Guests can attend for $35. Register at
www.melpb–chamber.org, or call 724–5400
MAY 21, 2007
BBN
EVENTS
HHB to offers summer youth program
This summer, Habitat for Humanity of Brevard
County will be offer a Community Builders Youth
Program for students 14 to 18 to work in the area
focused on ending poverty housing. Two orientations
will be held— May 31 at 10 a.m. at Macedonia
Missionary Baptist Church, and June 21 at 10 a.m. at
Faith Viera Lutheran Church. Reservations are
required. The summer program provides students the
opportunity to gain valuable community–service hours
and develop skills in teamwork while assisting in
various areas. For more information on how you can
participate, call Karen at 255–5800.
Tech to host Capstone Golf Tournament
Florida Tech will host the inaugural Capstone
Classic Golf Tournament on Friday, June 15, beginning with an 8 a.m. shotgun start at the Turtle Creek
Golf Club in Rockledge. The tournament is a College of
Engineering fundraiser to support scholarships and
senior design projects. Registration begins at 7 a.m.
An awards luncheon takes place at noon and a putting
contest, which is $10, is ongoing throughout the day.
The entry fee is $110 each or $400 for a foursome.
Several sponsorship opportunities are available,
ranging from a $200 hole sponsorship to an $8,000
presenting sponsor donation, with four other sponsorship levels in between. Each year, Florida Tech
engineering students join in teams to design and
construct a student project to fulfill a bachelor’s degree
graduation requirement. The 2007 projects include a
hydrogen plane, an unmanned automated plane, a
rocket engine test stand and a racing electric car. For
more information, call Florida Tech’s Office of Development at 674–6220.
National City
new ad on cd
SPOT COLOR
pick up BBN
5-07-07
page 3
Sheriff’s Office to teach firearms course
The Brevard County Sheriff’s Office will be instructing a citizen defense firearms course on Saturday,
June 23, from 8 a.m. to 5 p.m. This handgun course
will cover basic knowledge of firearm laws, and the
hands–on application of how to handle, load and fire
your gun. While this course will satisfy the state
training requirement for those seeking a concealed
weapon permit, it does not qualify for an armed–guard
permit. You may call the Bureau of Licenses at (850)
488–5381 for any information about the concealed–
weapon permit. The course is open to persons over the
age of 21. Also, those who are 19 or 20 years of age
may attend but only if a parent or guardian is present
during the range portion of class. Registration is
limited to 12 citizens. Submit a $25 check or money
order made out to the Brevard County Sheriff’s Office
and address it to 700 Park Ave., Titusville, Fla, 32780:
Attention Career Development Unit. You must include
this information with your check: your full name,
complete mailing address, phone number, Social
Security number, date of birth and gender.
‘Battle of the Bands’ benefit in Cocoa
The Brevard Museum of History and Natural
Science has announced its first “Battle of the Bands”
benefit event to be presented by Ron Allen Entertainment from 11 a.m. to 7 p.m. on Aug. 11 at F. Burton
Smith Park in Cocoa. Tickets are $10 person. Fourteen bands on two stages will bid for a top prize of a
three–hour recording session. There will be vendors
with food, beverages and memorabilia and a 50–50
drawing. For more information, call JaNeen Smith,
executive director of the Brevard Museum, at 632–
1830, or visit www.brevardmuseum.org. You can also
contact Ron Allen Entertainment at
djron@ronallenentertainment.org.
MAY 21, 2007
CAG Architects
pick up BBN
5-14-07
page 14
www.cag-architects.com
SPOT COLOR
BBN
DIGEST
Waterfront event a success, $750,000 in boat slips sold
NEW SMYRNA BEACH— The New Smyrna Harbour Club’s (NSHC) first
Hampton–Style Seafood Festival was a big success, with more than $750,000 in boat
slips sold at the recent event. In addition, $250,000 in slips were sold the day preceding the festival and an additional $400,000 the Monday following as registered
boaters began receiving invitations in the mail and visited the sales center to secure a
permanent home for their boat.
“Being early in a rising market gives slip owners the opportunity for some pretty
spectacular gains in terms of pricing options” said Scott Miller, NSHC’s director of
sales and marketing. “The event went above and beyond our expectations with 180
potential buyers in attendance.”
The NSHC served a full range of seafood delicacies at the festival.
Formal invitations went out to select registered boaters and current NSHC
members inviting them “to take advantage of this last opportunity to get their hands
on low, introductory prices on a limited number of Dry Rackominiums and Wet
Dockominiums Slip. The owners not only saved, but they are accruing interest on
their deposit while waiting to close,” says Miller.
The NSHC is a luxury, private wet and dry boat–storage facility tucked into a
yacht–club setting with “five–star concierge service,” he said. “Owners enjoy unparalleled amenities of a yacht–club atmosphere featuring a martini and cigar lounge,
waterfront cocktail bars, tiki–hut barbeque, spa, fitness center, swimming pool,
gourmet deli and coffee shop.”
Miller said with waterfront property and boat storage at “high–demand with
limited commodity, NSHC is a great opportunity for boaters and investors to secure a
permanent home at a great price for their boats.”
Call (386) 427–4792 or visit www.newsmyrnaharbour.com for more information.
WFIT
new ad emailed
FULL COLOR
Petrillo tribute to Sinatra May 20
Entertainer Sonny Petrillo and his quintet will perform a tribute to Frank Sinatra
in a concert presented by the Space Coast Jazz Society at 2 p.m. on Sunday, May 20,
at the Cocoa Beach Country Club, 5000 Tom Warriner Blvd. The quintet includes
Petrillo on vocals and saxophone, Ron Teixeira on piano, Ron Pirtle on bass, Chuck
Dickey on drums and Steve Cochrane on guitar. The cost to attend is $7 for SCJS
members and $10 for nonmembers. Tickets can be purchased at the door. For more
information, call 453–4191.
Military veterans networking event
The Small Business Development Center at Brevard Community College will host
a meeting of the Veterans Business Network of Central Florida from 5 to 7 p.m. on
Wednesday, June 20, at the Melbourne Campus. The event will be held in building
10, room 112A. The event is designed to provide a regular networking forum where
military veterans can learn about business experiences and opportunities from each
other. To register, call 433–5570 or e–mail pfrimmers@brevardcc.edu.
Teaching Kids
Sutton
Sutton
suit
pick
up
BBN
pick up
BBNSUIT
BUILD
TO
5-14-07
1-23-06
page 9
725-1240
page 18
Continued from page 1
didn’t charge him rent or require him to chip in for groceries or heat). He bought shoes
less often. He saved for pricey purchases such as video games and school band trips. If
he didn’t have enough money to go to the movies, he didn’t go.
Archerd remembers Michael once asking for a larger dollar amount, explaining his
allotment wasn’t enough to buy several video games. She seized upon this teachable
moment, explaining that as an adult you can’t say to your boss: “I want to spend more
money, so you have to pay me more.”
As he got older, his parents kept building on his financial knowledge. They also
tweaked his monthly amount as expenses grew.
He opened a checking account through a credit union at age 14. Many credit
unions and banks have programs to educate children about balancing a checkbook,
saving, and budgeting. Don’t overlook those resources; some kids need to learn fiscal
responsibility from someone besides mom and dad.
At age 16, he applied for a credit card with a low limit.
When the first bill arrived, his mom tried to convince him to pay only the minimum
amount due so he could see the impact of interest rates on his balance.
He told her “I kind of get the picture” and paid it in full, a behavior he continues.
Just 21 percent of his peers do this, according to 2005 research by student loan
provider Nellie Mae. The average balance for undergrads is about $2,000.
While the method worked with barely a hiccup, there was a time when he bounced
a check for a high school band trip. And only recently did he realize what a bite ATM
fees were taking out of his bank balance.
Still, he said he feels better prepared financially than some of his friends, who work
more and spend more than he does. He’s also glad he understands how credit works,
especially since he receives at least 10 credit card offers a month.
MAY 21, 2007
BBN
ADVERTISERS
A Heartfelt
Presenting Sponsor
Coffee & Cordials
MIMA
Ernst & Young, LLP
Heartlab, An Agfa Company
Dinner Sponsors
Bovis Lend Lease, Inc.
Brevard Emergency
Services, P.A.
Coastal Mechanical
Services, LLC
Henry Family Foundation
Holland & Knight, LLP
Pediatrix Medical Group, Inc.
Space Coast Medical
Imaging Consultants
Space Coast Pathologists, P.A.
SunTrust Banks, Inc.
Thank You to
CNI
pick up BBN
Sponsors of the
????
25th Holmes
Table Sponsors
Regional Medical
AT&T
Brevard Anesthesia Services, P.A.
Champion Solutions Group/IBM
Healthcare Solutions
Cisco Systems, Inc.
Comp Serv, Inc.
Phil & Jeanne Farmer
Gatto's Tires & Auto Service
Nanialei Golden, MD
Grape Escape Committee
Members
Health First Health Plans
Hill, Adams, Hall & Schieffelin
Chris & Gail Kennedy
Metro Aviation, Inc.
Miller Electric
Northrop Grumman
Dr. Lee & Elizabeth Scheinbart
St. Jude Medical Rhythm
Management Division
TriZetto
VISICU, Inc.
Center Anniversary
Benefit Ball
Your support raised
May 19, 2007
$270,000 for lifesaving
YOUNG EAGLES
equipment and a family
DAY
room for the
hospital’s
FREE
Plane Rides
Invitations
HKS Architects, Inc.
For anyone
Between 8 and 17 Years old*Photography
Neonatal
Intensive
Robinson & Robinson Electrical
Registration
Contractors, Inc.
Soft Computer Consultants
8:30
to 12:00 pm Merritt Island Airport
Caream
Unit.
Large Hanger at the End of Airport Road UBS Securities, LLC
Sponsor Party
Baughan Law Firm, P.A.
The Young Eagles Program,
Berman, Hopkins, Wright &
developed by the EAA Aviation Foundation,
LaHam, CPAs, LLP
welcomes young people
Dana Investment Advisors, Inc.
into the world of aviation. Flights are aboard a
Walter & Dottie Gatti
FAA registered airplanes flown by licensed pilots. M.H. Williams Construction
Group, Inc.
Young Eagles will see the earth and sky
in a new and exciting way,
soaring like an eagle among the clouds,
while developing an understanding of the possibilities that flight
– and life in general – have to offer.
1350 S. Hickory Street
A never to be
forgotten
experience!!
Melbourne,
FL 32901
e-mail:321-434-7140
youngeaglesfly@aol.com
phone: 543-2798 and leaved a message
*Parent or guardian must sign a permission slip
MAY 21, 2007
25th Silver Anniversary
Sponsors
ADAMS Management Services, Inc.
B&B Office Equipment, Inc.
BRPH Architects & Engineers, Inc.
Dr. & Mrs. Joseph Chanda/
Joe & Hope Chanda
Chuck Clemente & C3 Foundation
Commercial Roofing, Inc.
Community Educators Credit
Union
Corporate Financial
CPA Wealth Management
Services
Flammio & Schultz Financial
Group, A.G. Edwards
Florida Dermatology Associates Ruben Moreno, MD
Ford & Harrison, LLP
Michael & Carol Ann Gaich
Jack & Martha Hartley
Dr. Edwin Hayes - OB/GYN
Specialists of Brevard
Nick & Diane Heldreth
Dr. Tim & Jackie Hollingsworth
Frank & Nina Lewis
Kitty McLamb, RN, ARNP
Mark S. McTammany, MD, OB/GYN
Melbourne Greyhound Park, Inc.
Milliman, Inc.
Ohlson Lavoie Collaborative
Osler Medical
PBS&J
Pro-Tech Roofing of Brevard, Inc.
Riverside Bank
Bryan & Judy Roub
Bernard Smedley
Southern Janitor Supply, Inc.
Theisen Development, Inc.
Patrons
Allstate Insurance - Deborah K.
Rufo & Associates
Associated Credit &
Collection Bureau
BB&T
Richard & Gail Beagley
Browning’s Pharmacy &
Health Care, Inc.
Burton, Schulte, Weekley,
Hoeler, Robbins & Beytin, PA
Carlton Fields, P.A.
Casabella Development, LLC
M.J. Castellon, MD, FACS Aesthetic Plastic Surgery Center
CMR Constructors, Inc.
Dr. Joe & Susan Collins
Delta Dental Insurance Company
Downs Electrical
Constructors, Inc.
Dr. Chris & Sharon Finton
Florida Business Bank
Florida Power & Light
Gray Robinson, P.A.
Greenspoon Orthopaedics
HealthSouth Sea Pines
Rehabilitation Hospital
Lexmark International, Inc.
Rich Martinson, CFP, A.G. Edwards
Mead Construction, Inc.
McKesson Information Solutions
Novell, Inc.
Pediatrics in Brevard
Richard's Paint
Manufacturing Co., Inc.
Rissman, Barrett, Hurt,
Donahue & McLain, P.A.
Skylight Healthcare Systems
Smith Hulsey & Busey
Sorensen Moving &
Storage Co., Inc.
The Bank
TLC Engineering for Architecture
Vicom Systems, Inc.
Wickham Commons Office
Building Partnership
Benefactors
Address N’ Mail, Inc.
Bobo, Ciotoli, Bocchino,
Newman & Corsini, P.A.
Boggs Gases
Charles & Cynthia Boyd
Brandt Ronat & Company
Dr. Anthony & Sara Catanese
Gene & Becky Cavallucci
Dr. Harris & Debbie Cherin
Dr. Shashin & Dipty Desai
John & Darcia Francey
Dr. Gopal & Nina Gadodia
Larry & Jan Garrison
David & Grace Gillis
Bob & Pat Henry
Darrell & Valerie Holloway
Roberta Humphreys
Howard & Christine Lance
Dr. Robert & Gloria Mandel
Jane McCallum & Bob Stover
Mead Johnson Nutritionals
Mike & Gwen Means
Tom & Susan Moran
Charles & Nancy Ragland
Brad & Debbie Roub
RSM McGladrey
Dr. David & Sunny Rudloff
Adley Z. Sedaros, MD
Jerry & Mary Senne
George & Dr. Rebecca Wagaman
Bob & Susan Walters
In-Kind Sponsors
AllStar Printing
Brevard Business News
Caffé Uccello
Phil & Jeanne Farmer
Hometown News
Paragon Printing & Graphics
Satellite High School Jazz Quintet
Space Coast Living Magazine
TMG, Inc.
BBN
ADVERTISERS
A BUSINESS RETIREMENT PLAN
CAN ACTUALLY SAVE YOU MONEY.
Space Coast Credit Union
Learn how. Request your free copy of
Bedor & Silvernail
“Five Money-Saving Reasons to Have a
AgRetirement
Edwards
pick
up
Business
Plan.”
SPOT COLOR
[24778-v1-0538] BUS-125-0506
BBN
pick up BBN
12-18-06
page4-30-07
15
page 15
FULL COLOR
SPOT
COLOR
255-2330
pick up BBN
5-14-07
page 17
7925 N. Wickham Rd.
Viera, FL 32940
Tom Bedor, CFP®
Financial Consultant
CERTIFIED FINANCIAL PLANNER™
Betts Silvernail
Financial Consultant
VP-Investments
5-20159
2005 A.G. Edwards & Sons, Inc. • Member SIPC
YOUR “LOCAL” CERTIFIED
DEVELOPMENT COMPANY
C OMMERCIAL
“OWNER OCCUPIED”
MORTGAGES
Florid 90% Financing Available
florida
business
Volk Law Offices
pick up BBN
4-23-07
page 18
SPOT COLOR
development
corporation
SBA 504 Loan Program
50% 1st Mortgage Bank/Private Lender
40% Florida Business Development Corp.
@ 20 year below market fixed rate
10% Borrower/Business Owner
Call Tim, a former banker
with 21 years experience, at
407-352-2551
or email tcramer504@aol.com
today for more info.
FLORIDA BUSINESS
DEVELOPMENT CORPORATION
7021 Grand National Drive, Ste 100,
Orlando, FL 32819
logo and
photo
8/7/06
page 12
Timothy O. Cramer
Executive Vice President
Central/North Florida
MAY 21, 2007
BBN
SPECIAL FOCUS
Career Academy
Continued from page 1
the programs to more students in the region. “I would
like to see an Academy program in every high school in
South Brevard, and for us to have a $1 million endowment in three to five years.” He adds, “It’s very doable
with the support of the business community.”
The foundation is a tax–exempt way to make a
charitable contribution. “The monies that we raise go
directly into programs that help students,” said attorney
Edward Kinberg, president of the Melbourne–Palm Bay
Chamber Education Foundation. “It’s not just money
that goes to a school district for general purposes. The
foundation’s goals are to support our students and make
sure they receive the same quality of education the
Academy has been delivering for the last 10 years, and
to provide the resources to train other Chambers to
duplicate what we’re doing, because we can’t do it all
ourselves.”
Boyd says there is a demand to increase both the
number of participating high schools as well as the
courses of study in the Academy programs. He says it
takes two to three years of planning before an Academy
can open. So far, the program has targeted only public
high schools. But Boyd said the Chamber “wants to
pursue the parochial–private environment and include
schools such as Melbourne Central Catholic and Holy
Trinity.”
The initial program expense is $25,000, said Brown.
“That’s just the maintenance cost. Then you have the
internship component and the scholarships we are
hoping to provide. So, it’s about a $75,000 expense every
year.”
“If we add one new school a year for the next couple
of years, by the time they are fully phased–in, we’re
looking at an expense of $300,000 a year,” Boyd said.
How can the community help? “We’re looking for
matching business donations,” says Brown. “Every little
gift helps. Businesses and organizations can pick a
program and bring interns into their company, too.”
Artemis International Technologies in Melbourne is
another business that provides paid summer internships for Academy students. Funding an internship
costs $1,500.
“It’s an excellent way for the business community to
get engaged and help the Chamber meet a portion of the
financial commitment of the program,” said Travis
Proctor, founder of Artemis. “We guarantee that every
junior in the program will be provided an internship
during the summer. So, it’s one of the key ways a
business can help. Some companies may not be set up to
host an intern in their work environment. If that is the
case, perhaps they could provide $1,500 to fund an
intern at another business.”
Shannon Meyer, president and CEO of the
Melbourne–Palm Bay Chamber, says the Academy
programs play an increasingly important role in
developing “a qualified work force for area employers.
Chamber members say they need people ready to enter
the work force who have the right skills. Through the
Academy, we place the students in internships, provide
career shadowing, and bring in guest speakers. Another
key component of the program is soft–skills training,
which is very important. For example, they learn how to
lead a business meeting and they may not get that in a
regular school setting.”
The local program is affiliated with The National
Academy Foundation in New York, which was founded
25 years ago as a partnership between business leaders
and educators. The NAF is a leading educational reform
organization. It has a network of more than 500 career–
themed academies serving nearly 50,000 students
annually across the country.
Sandy Weill, former CEO of Citigroup, founded the
NAF. Today, more than 2,000 corporations are involved
with local Academies throughout the nation, securing
internships, volunteering in the classrooms, acting as
mentors and serving on local advisory boards.
“The Academy is a dynamic program that produces
results,” says Brown. “The small class–size learning
environment and the integrated curriculum are
powerful tools. The educational leaders in Tallahassee
see this as a very effective structure.”
Brown has been fully entrenched in Academy
programs in Brevard and even out of state. Before she
moved to Florida 15 years ago, Brown was active at a
high school in Salt Lake City, Utah, where her daughter
was enrolled in the Academy of Business and Finance.
She was a tutor for the program. “So when I came to
Florida I had it in my blood. Our company really
believes in the Academy model and we bring students
into our organization all the time.”
Kinberg has been another dynamic force behind the
program. He’s the founder of the Melbourne High
School Academy of Business and Finance and of the
Construction and Design Program at Palm Bay High.
“When we started the program at Melbourne High
School one of the leaders from the National Academy
Foundation came here and I jokingly said to him,
‘Welcome to the best NAF program in the United
States.’ He kind of laughed and walked away.” Kinberg
said the same person returned to Brevard four years
later on an NAF visit, but didn’t remember him. The
representative told Kinberg that on his first visit
someone at the Academy had projected success on a
national scale for the program. “We’re a small community yet we have one of the best NAF operations in the
nation. Part of the success is because of the vision the
Chamber had in making this an effective and meaningful partnership, really pushing the business partners
into the schools,” Kinberg said.
The NAF recognized the Melbourne High School
Academy of Business and Finance for their 100 percent
intern placement of all Academy rising seniors every
year of the program. It makes the program one of the
top Academies of its kind in America. The average
national placement is around 60 percent, said Deborah
Ballard, director of workforce development and education at the Melbourne–Palm Bay Chamber.
Said Brown, “We were fortunate to have created a
pathfinder program. Now it can become a role model for
increasing the emphasis on business and education in
the state. The teacher is at the center of the program’s
success.”
The Chamber recently hosted a Community Leadership Breakfast on Business Education Partnerships at
Suntree Country Club. The dining room was packed
with business people. “This was our first broad sweep of
reaching out to people and explaining the role of the
Academy. Now our mission and responsibility is to
follow up,” Boyd said.
The Bank Brevard
next in series
MAY 21, 2007
Grand Opening
The Parrish Healthcare Center at Port St. John, built with environmentally friendly
techniques, is “Healing in Nature.” This next generation of health care will preserve
and protect your health and that of the surrounding land.
The facility brings you a healing touch, compassionate care and the latest state-ofthe-art equipment and technology in a “green” environment unlike anything else in
our area. It features digital diagnostic imaging, cardiopulmonary services, physical
therapy/rehabilitation, laboratory services, physician offices and more.
HEALTHCARE CENTER
Meet the
Radio Disney AM 990
Fun Squad!
Fun, Games & Entertainment
Join us on June 9 from 10 a.m. to 2 p.m.
Events:
• Taiko Japanese Drummers from 10:30 to 11 a.m.
• Opening ceremonies at 11 a.m.
Also:
• Facility tours from 11:30 a.m. to 1:30 p.m.
• Health information booths and screenings
• Bounce House, Larry the Bird Man, magicians,
face painters, jugglers and fire engines
• Food, giveaways and fun for everyone
Parking:
Special thanks to our sponsors:
Parking available along eastbound
lane of Port St. John Parkway.
Courtesy shuttles will be available
during the event.
Skanska USA
Sodexho USA
Meadowhawk – powered by Dragonfly
Water Treatment Systems
Keep Brevard Beautiful
For more information, visit www.psjhealthcenter.com
H For
E A
I N G visitI www.psjhealthcenter.com.
N
N A T U R E
moreL information,
Located on the
southwest corner
of Grissom and
Port St. John
Parkways

May 21, 2007 - Brevard Business News

Transcription

Similar documents

What is manufacturing?

Overview of Deseret Ranch - East Central Florida Corridor Task Force

Customer`s recommendations using the SCI technology:

REAL ESTATE RATE CARD

View brochure

June 04, 2007 - Brevard Business News

American Heart guide helps drive Wuesthoff`s success in cardiac

August 15, 2011 - Brevard Business News

Newsletter May 2013